Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01650g8.262ON58658629290.0
TDEL0F038908.262ON4764059531e-122
KAFR0B055408.262ON5194148851e-112
SAKL0H17028g8.262ON5503828101e-100
NDAI0J013808.262ON6244167963e-97
KLTH0G13684g8.262ON5084167803e-96
NCAS0B038508.262ON5884137863e-96
Kpol_392.68.262ON4573547632e-94
Smik_4.3568.262ON5763727722e-94
YDR110W (FOB1)8.262ON5663727722e-94
Kwal_56.237998.262ON4883887652e-94
Suva_2.2708.262ON6323877675e-93
Skud_4.3718.262ON5803677602e-92
Ecym_43088.262ON5293947264e-88
AGR086C8.262ON5343487171e-86
Kpol_543.388.262ON4423506854e-83
KLLA0F19140g8.262ON5274036776e-81
CAGL0B01771g8.262ON5364046551e-77
KNAG0H032408.262ON5194145772e-66
TBLA0E044308.262ON4813685383e-61
TPHA0A018108.262ON4574095285e-60
TPHA0J007408.262ON4083604758e-53
TBLA0F030708.262ON4453754224e-45
NDAI0D03010na 1ON778129930.013
NDAI0B06160singletonON140350810.34
NDAI0D03060singletonON130362810.35
NDAI0G00550singletonON41255790.44
NDAI0D00680singletonON23462780.52
NDAI0G00600singletonON48864761.2
YBR115C (LYS2)3.369ON139261716.4
Kwal_26.90788.735ON110269707.0
Smik_49.2singletonON55057698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01650g
         (586 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...  1132   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   371   e-122
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   345   e-112
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   316   e-100
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   311   3e-97
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   305   3e-96
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   307   3e-96
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   298   2e-94
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   301   2e-94
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   301   2e-94
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   299   2e-94
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   300   5e-93
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   297   2e-92
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   284   4e-88
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   280   1e-86
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   268   4e-83
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   265   6e-81
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   256   1e-77
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   226   2e-66
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   211   3e-61
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   207   5e-60
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   187   8e-53
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   167   4e-45
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    40   0.013
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            36   0.34 
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              36   0.35 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    35   0.44 
NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON}                35   0.52 
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    34   1.2  
YBR115C Chr2 complement(469748..473926) [4179 bp, 1392 aa] {ON} ...    32   6.4  
Kwal_26.9078 s26 complement(1063916..1067224) [3309 bp, 1102 aa]...    32   7.0  
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    31   8.7  

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/586 (95%), Positives = 557/586 (95%)

Query: 1   MSKRKPLTQQKLASEEEHEIEGEPKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLL 60
           MSKRKPLTQQKLASEEEHEIEGEPKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLL
Sbjct: 1   MSKRKPLTQQKLASEEEHEIEGEPKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLL 60

Query: 61  EQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCHKWKGESSEIEYYYLRSRYFV 120
           EQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCHKWKGESSEIEYYYLRSRYFV
Sbjct: 61  EQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCHKWKGESSEIEYYYLRSRYFV 120

Query: 121 SEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVT 180
           SEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVT
Sbjct: 121 SEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVT 180

Query: 181 AISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRD 240
           AISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRD
Sbjct: 181 AISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRD 240

Query: 241 YFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSL 300
           YFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSL
Sbjct: 241 YFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSL 300

Query: 301 KLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGD 360
           KLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGD
Sbjct: 301 KLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGD 360

Query: 361 LLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGVLFLENNKEEHKTVEAVKENITHSD 420
           LLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGVLFLENNKEEHKTVEAVKENITHSD
Sbjct: 361 LLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGVLFLENNKEEHKTVEAVKENITHSD 420

Query: 421 PDEERAENDNTNDTQVRIDEGDVSPSKTEPVXXXXXXXXXXXXXXXXXXIRRPEDEPIDD 480
           PDEERAENDNTNDTQVRIDEGDVSPSKTEPV                  IRRPEDEPIDD
Sbjct: 421 PDEERAENDNTNDTQVRIDEGDVSPSKTEPVEQRDEDGEDRRGESDEADIRRPEDEPIDD 480

Query: 481 AIEQKKEGNARNHLKNSAEVMVANIPNDNHVNTVQMQPAIVRDDYIYDSDELADYNLEVE 540
           AIEQKKEGNARNHLKNSAEVMVANIPNDNHVNTVQMQPAIVRDDYIYDSDELADYNLEVE
Sbjct: 481 AIEQKKEGNARNHLKNSAEVMVANIPNDNHVNTVQMQPAIVRDDYIYDSDELADYNLEVE 540

Query: 541 QKRYKRMRKSNDADDKSMSEMGPXXXXXXXXXXXQSSTNMDESIEL 586
           QKRYKRMRKSNDADDKSMSEMGP           QSSTNMDESIEL
Sbjct: 541 QKRYKRMRKSNDADDKSMSEMGPRKKRKLLGRKLQSSTNMDESIEL 586

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  371 bits (953), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 274/405 (67%), Gaps = 8/405 (1%)

Query: 1   MSKRKPLTQQK--LASEEEHEIEGEPKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLN 58
           M+ +KP T Q+  +  +E H    E K        ++ +F+ P M + +       MN+ 
Sbjct: 1   MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKS-QFLAPSMGESYKEYANSYMNME 59

Query: 59  LLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSR 117
           LLE+G ++ L++Q ++ GQ+   IYELIR+++L+   L     KW  +S+E +Y +L  R
Sbjct: 60  LLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRR 119

Query: 118 YFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDY 177
           Y+   ENG+V DR++ D+IVCEP  +F L+MC+HL N+H+T   I+  L K Y+NITRD+
Sbjct: 120 YYA--ENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDF 177

Query: 178 IVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLY 237
           +  A+ YCS CNPD   +P +K RHKN++  LLPLERVHIE+FE FD E I  +F+++LY
Sbjct: 178 VQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLY 237

Query: 238 FRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEH 297
            RDY +R+VW+ PL+N K KH++ A+ + LLG+  +PIF+ES+T+D++ LFD+C Q+   
Sbjct: 238 CRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGK 297

Query: 298 YSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGR 357
           Y++KLGLG  +S +FH NGIK MK+LL + K +C+ DWN+CL+YGP+H+N+  N  + G 
Sbjct: 298 YNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGI 357

Query: 358 PGDLLFTSVPDCNRKFVKKRNDVILD-TPSQQVVHLGEGVLFLEN 401
           P DLL+ S    NRK  + + ++I+D  P+Q VVH+ +G+L+LE+
Sbjct: 358 PNDLLYHS-DHTNRKHFRPKQEMIIDELPAQNVVHVNKGLLYLED 401

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  345 bits (885), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/414 (42%), Positives = 257/414 (62%), Gaps = 15/414 (3%)

Query: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97
           +IVP M + + S     MNL LL++G  E  +FQ ++ G LT++ Y+LIR+D+L+   L 
Sbjct: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106

Query: 98  RCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156
             + KW   ++E  Y +L+ RY+  + NG++ D  R D+IVCEP  +F ++M  HL NNH
Sbjct: 107 STNPKWTKITAEPRYLFLKRRYY-RDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNH 165

Query: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVH 216
                IH +L   Y+NITRD  + A+ +CS CNP+ K    +K +H+N+Y EL+PLERVH
Sbjct: 166 GFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVH 225

Query: 217 IEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIF 276
           IE+FEPF  EKI+ ++SH+LY RDY SRY+W+LPL+N K KH++  M+S  L   R PIF
Sbjct: 226 IEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIF 285

Query: 277 LESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWN 336
           +E+ ++D + +FD+C +IA  Y L++GLG      FH  GI+ MK  L +H+EECL  WN
Sbjct: 286 IETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWN 345

Query: 337 LCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGV 396
           LCLKYG +  N   N  + G PGDLL + + +C+ KF +K   ++ +  S+ V+ +  G+
Sbjct: 346 LCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL 405

Query: 397 LFLENNKEEHKTVEAVKENITHSDP-DEERAENDNTNDTQVRIDEGDVSPSKTE 449
           +FLE + E H           H +P DE + E D + D +   D G V P  TE
Sbjct: 406 IFLEVD-EPHDE--------PHDEPYDEFQFEGDQSIDEE---DMGAVMPPATE 447

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 242/382 (63%), Gaps = 6/382 (1%)

Query: 24  PKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIY 83
           PK K V  K  N +++ P + +  V+     +N+ LLE+G  + +++  +V GQLTQ  Y
Sbjct: 12  PKSKDVCSKPTNNDYVTPKLGESQVT-YSTDLNVELLERGGRDFIKYLESVKGQLTQAQY 70

Query: 84  ELIRSDTLSIANLERCHKWKGES-SEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPAS 142
           ELI++DTL++  L         S +E +Y +L+ RY+V + + +V D KRDD IVCEP  
Sbjct: 71  ELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYV-DSDQIVRDHKRDDTIVCEPEL 129

Query: 143 MFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRH 202
           M+ L++  HL NNH+    +HR L   Y+NITRD++     YCS+CNP  + KPF K +H
Sbjct: 130 MYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKH 189

Query: 203 KNVYWELLPLERVHIEVFEPFDG-EKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIR 261
            N Y  LLPLER+H+E+F+PF   E I+ ++SH+LY RDY SR+VW+ PL     + ++ 
Sbjct: 190 TNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVP 249

Query: 262 AMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMK 321
            ++ FLL LPR+PIFLE+TT+DR+ +FD+C  IA  Y L +GLG+ NS  F+ NGI+ MK
Sbjct: 250 QLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMK 309

Query: 322 ELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVI 381
            LL ++K++C +DW +CLKYG +H N   N    G   DLL   V  C +KF  KR  +I
Sbjct: 310 YLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKII 369

Query: 382 LDTPSQQVVHLGE--GVLFLEN 401
            +  +  VV L +  G++++EN
Sbjct: 370 HELFAHNVVTLKDTGGMVYVEN 391

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  311 bits (796), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 159/416 (38%), Positives = 246/416 (59%), Gaps = 27/416 (6%)

Query: 31  KKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDT 90
           K+   G +++P + + ++  +   ++++LL++G    L FQ ++ GQL + +YELIR+ +
Sbjct: 84  KRRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKS 143

Query: 91  LS----IANLERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHL 146
           L+     AN    H     +       L  R +V++  G V D+ R +RIVC+P  ++ +
Sbjct: 144 LTEETLAANFPHFHAPTRCA-------LFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEM 196

Query: 147 VMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVY 206
           +M  HL N+H      H  L   YANITRD++  A+ +CS CNP     P  K +H N Y
Sbjct: 197 MMTCHLMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYY 256

Query: 207 WELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSF 266
             +LPLERVHIE+FEPF+G+KI+G++SH++Y RDY SRY+ + PL+N K K+++ A++  
Sbjct: 257 KGMLPLERVHIEIFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKL 316

Query: 267 LLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGS 326
           L  LPRIPIF+E+ +++ +  FD+   I E Y + +GLG+K ++RFH  G+K MK LL  
Sbjct: 317 LFNLPRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEG 376

Query: 327 HKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPS 386
           H++ECL DW +CLKYGP + N   N  + G P DLL  +V D   K ++K   +I   P 
Sbjct: 377 HRKECLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPK 436

Query: 387 QQVVHLGEGVLFLENNKEEHKTVEAVKE-NITHSDP------DEERAENDNTNDTQ 435
             +V +G G ++LE         E VK+ NI + D       D E+ +N+N N  Q
Sbjct: 437 DNIVQIGNGSIYLE---------EKVKDPNIDNYDAMLGEEYDSEQEDNNNKNTDQ 483

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  305 bits (780), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 254/416 (61%), Gaps = 22/416 (5%)

Query: 25  KRKKVNKKSRNG-EFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIY 83
           ++ +V+K+ R+  EF +P + +  +     G+NL LLE+G  + +++Q +V GQLTQ  +
Sbjct: 5   EKSRVDKRRRDKVEFDMPAVGEP-IEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQF 63

Query: 84  ELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPAS 142
           +L+RS +L+  NL     K    + E ++  L+ RY+V + +G+V D K  D +VCEP  
Sbjct: 64  DLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYV-DADGIVRDYKCSDTVVCEPEL 122

Query: 143 MFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRH 202
           MF L+MC HL+N H+    +H  L   YAN TR +    + YCS+CNP+ + +P++K RH
Sbjct: 123 MFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRH 182

Query: 203 KNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRA 262
            N+Y  LLPLERVH+E+  PF  E I+G +SH+L+FRDY+SR+VW+ PL+ D  + + + 
Sbjct: 183 TNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKG 241

Query: 263 MSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKE 322
           + + LL LPRIPIF+E++TIDR+ LF+ C  +A  YSL +GLG+  S  F  NG++ ++ 
Sbjct: 242 LLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRY 301

Query: 323 LLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVIL 382
           LL  ++E+CL+ W +CLKYG  + N N N    G PG+LL ++V D  R+F  KR D+I 
Sbjct: 302 LLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIE 361

Query: 383 DTPSQQVVHLG-----EGVLFLENNKEEHKTVEAVKENITHSDPDEERAENDNTND 433
              ++ VV +       G+++LE+     K             PDEE    +N  D
Sbjct: 362 KLFARNVVEIKVSGRRRGIIYLEDETSAFKM------------PDEEYISAENETD 405

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  307 bits (786), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 154/413 (37%), Positives = 242/413 (58%), Gaps = 17/413 (4%)

Query: 25  KRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYE 84
           KR K  K+ +   +++P + +K+   +   M+L  +++G  E  +FQ T+ GQL +  YE
Sbjct: 69  KRDKPIKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYE 128

Query: 85  LIRSDTLSIANLE----RCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEP 140
           LI++++L+   L     +  K++  S  +   +L  RY + E+ G V D+ R +R+VCEP
Sbjct: 129 LIKTNSLTQETLSATALKMDKFRAASRLV---FLNRRYGLDEQ-GNVRDKLRQNRMVCEP 184

Query: 141 ASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKK 200
             ++ ++M  HL N+H      H+ L   Y+NITR ++     +CS CNP  +  PF+K 
Sbjct: 185 VFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKY 244

Query: 201 RHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMI 260
           +H N +  LLPLERV +EVFEPF GEK+ G++  +LYFRDY SR++W++PL+N K  H++
Sbjct: 245 KHINWFKGLLPLERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLV 304

Query: 261 RAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDM 320
             +S  +  + RIPIF E+TTI+ +  FD+  +I E Y + +GLG K   +   NG+  +
Sbjct: 305 DLISKMIFSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQI 364

Query: 321 KELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDV 380
           ++LLG HKEECL DW +CLKYGP   N  +N  + G PGDLL   +PD   K   K   +
Sbjct: 365 RKLLGPHKEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQI 424

Query: 381 ILDTPSQQVVHLGEGVLFLENNKEEHKTVEA---------VKENITHSDPDEE 424
           + D P++ +V +G G ++LE+   E    E           ++N+ H   DEE
Sbjct: 425 LQDLPTENIVKIGRGCIYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEE 477

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  298 bits (763), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 147/354 (41%), Positives = 227/354 (64%), Gaps = 6/354 (1%)

Query: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYY 112
           G+N  L  +G ++  +FQ T+ G L+Q+IY+LI +D L+   + R   KW  +S+E +YY
Sbjct: 76  GLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYY 134

Query: 113 YLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYAN 172
           +L++RY+VS++   V DR+ DD+I+C P  +  +V+C+HL N H    ++HRNL K YAN
Sbjct: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194

Query: 173 ITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEK-IQGR 231
           I+R     ++ YCS CNP    KP +K +   VY  LLP ER+HIE+F+PF  EK I+G 
Sbjct: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGT 254

Query: 232 FSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLC 291
           +SH+LY RDY+SRYVW+ PL+    K + + + ++   + + PI++ES+TI+R  L  + 
Sbjct: 255 YSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMV 314

Query: 292 GQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNIN 351
            +IA  Y L++G+G+ NS  FH NG++ MK+LL  H++ECL DW +CLKYG    N   N
Sbjct: 315 QKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKN 374

Query: 352 VSSDGRPGDLLFTS-VPDCNRKFVKKRNDVILDTPSQQVVHL--GEGVLFLENN 402
               G P +LL  S + +C+ K+  K+N VI +T    ++ L  G+  ++LE+N
Sbjct: 375 RKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDN 428

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 238/372 (63%), Gaps = 4/372 (1%)

Query: 33  SRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLS 92
           S++   I+P M + +   +   +NL LLE+G  E+  F  ++  QLTQ+IYELI++ +L+
Sbjct: 43  SKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLT 102

Query: 93  IANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSH 151
              L++   K+ G  +E +  +L+ +Y+V +E G V D + +D+I CEP  ++ +VM +H
Sbjct: 103 ADTLQQISDKYDGVVAENKLLFLQRQYYVDDE-GNVRDGRNNDKIYCEPNHIYDMVMATH 161

Query: 152 LQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLP 211
           L N H+    +H  L   +ANI+   I     +CSKCN   K KP ++ +  ++Y +LLP
Sbjct: 162 LINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLP 221

Query: 212 LERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLP 271
           +ER+HIEVFEPF GE I+G++S++L  RDY S ++W+LPL++ K KH+I  +SS  L   
Sbjct: 222 MERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFA 281

Query: 272 RIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEEC 331
           R+PIF+ S+T+D++ L+D+C +IA  Y L++GLG+K+S RFH  GI  +   L S+KEEC
Sbjct: 282 RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEEC 341

Query: 332 LQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVH 391
           L DW  CL+YGP+  N+  N  +  +P  +L + +P  N KF  KR  VI +T S+ +  
Sbjct: 342 LADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFK 401

Query: 392 L--GEGVLFLEN 401
              G+G+++LE+
Sbjct: 402 TAGGKGLIYLED 413

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 241/372 (64%), Gaps = 4/372 (1%)

Query: 33  SRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLS 92
           S++   I+P M + +   +   +NL LLE+G  E+  F  ++  QLTQ+IYELI++ +L+
Sbjct: 41  SKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLT 100

Query: 93  IANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSH 151
              L++   K+ G  +E +  +L+ +Y+V +E G V D + +D+I CEP  ++ +VM +H
Sbjct: 101 ADTLQQISDKYDGVVAENKLLFLQRQYYVDDE-GNVRDGRNNDKIYCEPKHVYDMVMATH 159

Query: 152 LQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLP 211
           L N H+    +H  L   +ANI+   I     +CSKCN   K KP ++ +  ++Y +LLP
Sbjct: 160 LMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLP 219

Query: 212 LERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLP 271
           +ER+HIEVFEPF+GE I+G++S++L  RDY S ++W+LPL++ K KH+I  +SS  L   
Sbjct: 220 MERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFA 279

Query: 272 RIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEEC 331
           R+PIF+ S+T+D++ L+D+C +IA  Y L++GLG+K+S RFH  GI  ++  L S+K+EC
Sbjct: 280 RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKEC 339

Query: 332 LQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVH 391
           L DW  CL+YGP+  N+  N  +  +P  +L + VP  N KF  KR  VI +T S+ +  
Sbjct: 340 LADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFK 399

Query: 392 L--GEGVLFLEN 401
           +  G+G+++LE+
Sbjct: 400 MAGGKGLIYLED 411

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  299 bits (765), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 153/388 (39%), Positives = 237/388 (61%), Gaps = 22/388 (5%)

Query: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYY 112
           G+N  LL +G  + +++Q +V GQLTQ+ ++L+RS  L+  NL     K    + E ++ 
Sbjct: 34  GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFL 93

Query: 113 YLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYAN 172
            L+ R++V + +G V D K DD +VCEP S+F L+MC HL+N H+    +H  L + YAN
Sbjct: 94  LLKRRFYV-DADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYAN 152

Query: 173 ITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRF 232
            TR +    + YCS+CNP+   +P++K RH N+Y  LLPLERVH+E+  PF  + I+G +
Sbjct: 153 TTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFP-KLIEGLY 211

Query: 233 SHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCG 292
           SH+LY RDY+SR+VW+ PL +++   + +A  +FLL LPR+PIF+E++T+ R+ LF++C 
Sbjct: 212 SHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCE 271

Query: 293 QIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINV 352
            IA  Y L +GLG+  S  F  NG++ ++ LL  ++E CL+ W++CLK+G  + N   N 
Sbjct: 272 NIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNA 331

Query: 353 SSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHL-----GEGVLFLENNKEEHK 407
              G PG+LL ++V D  R+F  KR ++I    +  VV L       G+++LE+     K
Sbjct: 332 RVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSAFK 391

Query: 408 TVEAVKENITHSDPDEE--RAENDNTND 433
                        PDEE   AEN+  N+
Sbjct: 392 M------------PDEEYISAENETENE 407

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  300 bits (767), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 150/387 (38%), Positives = 242/387 (62%), Gaps = 10/387 (2%)

Query: 24  PKRKKVNKKSRNGE------FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQ 77
           P+R+K      + E       I+P M + +   +   +NL LLE+G  E+  F  ++  Q
Sbjct: 79  PQRRKTTSPRESRESLKDRLLILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQ 138

Query: 78  LTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRI 136
           LTQ+IYELI++ +L+   L++   K+ G ++E +  +L  +Y+V  E G V DR+ +D+I
Sbjct: 139 LTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLFLERQYYVDNE-GNVRDRRNNDKI 197

Query: 137 VCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKP 196
            CEP  ++ +VM +HL N H+    +H  L   +AN +   I     +CSKCN   K KP
Sbjct: 198 YCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKP 257

Query: 197 FQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKR 256
            ++ +  ++Y +LLP+ER+HIEVFEP+ G+ I+G++ ++L  RDY S ++W+LPL++ K 
Sbjct: 258 LKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKF 317

Query: 257 KHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNG 316
           KH+I  +SS  L   RIPIF+ S+T+D++ L+D+C +IA  Y L++GLG+K+S RFH  G
Sbjct: 318 KHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGG 377

Query: 317 IKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKK 376
           I  ++  L S+KEECL DW  CL+YGP+  N+  N  +  +P  +L + VP  N KF  K
Sbjct: 378 ILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETK 437

Query: 377 RNDVILDTPSQQVVHL--GEGVLFLEN 401
           R  VI +T ++ +  +  G+G+++LE+
Sbjct: 438 RERVIENTYARNMFTMAGGKGLIYLED 464

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  297 bits (760), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 233/367 (63%), Gaps = 4/367 (1%)

Query: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97
            I+P M + + + +   +NL LLE+G  E+  F  ++  QLTQQIYELI++ +L+   L+
Sbjct: 49  LILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQ 108

Query: 98  RCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156
           +   K+ G  +E +  +L+ +Y+V  E G V D + +D+I CEP  ++ +VM +HL N H
Sbjct: 109 QISDKYDGVVAENKLLFLQRQYYVDNE-GNVRDGRNNDKIYCEPKHIYDMVMATHLMNKH 167

Query: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVH 216
           +    +H  L   +AN +   I     +CSKCN   K KP ++ +  ++Y +LLP+ER+H
Sbjct: 168 LRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIH 227

Query: 217 IEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIF 276
           IEVFEPF G  I+G++ ++L  RDY S ++W+LPL++ K KH+I  +SS  L   R+PIF
Sbjct: 228 IEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 287

Query: 277 LESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWN 336
           + S+T+D++ L+D+C +IA  Y L +GLG+K+S RFH  GI  ++  L S+KEECL DW 
Sbjct: 288 VTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWG 347

Query: 337 LCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHL--GE 394
            CL+YGP+  N+  N  +  +P  +L + VP  N KF  KR  VI +T S+ +  +  G+
Sbjct: 348 KCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 407

Query: 395 GVLFLEN 401
           G+++LE+
Sbjct: 408 GLIYLED 414

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  284 bits (726), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 155/394 (39%), Positives = 226/394 (57%), Gaps = 27/394 (6%)

Query: 60  LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRY 118
           L+ G  E ++   TV GQLTQ IYELI S+TLS   L E C K    + E ++  L+ RY
Sbjct: 56  LDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRY 115

Query: 119 FVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYI 178
            + +  G V D KR+D  V EP  +F ++M +HL N H+    IH++L   YAN+TRD+ 
Sbjct: 116 SILQ--GNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFT 173

Query: 179 VTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFD---GEKIQGRFSHL 235
                YCS CN D   K F + +H NVY +++PLER H+E+F PFD    EKI+ ++SH+
Sbjct: 174 NLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHV 233

Query: 236 LYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIA 295
           LY RDY SR+VW+LPL+    + ++ A++  L  + R+PIFLE+ T+DR+ +FD+C  IA
Sbjct: 234 LYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIA 293

Query: 296 EHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSD 355
             Y LK+GLG+ +   F  NG+  +K L   HKE+C+++WN+CL+     +NQN +    
Sbjct: 294 RKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVR 353

Query: 356 GRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLENNKEEHKTVEAVK 413
           G P DLL   + +   KF  K+  +I +  +  VV   E  G+++LE++           
Sbjct: 354 GIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVV----- 408

Query: 414 ENITHSDPDEERAENDNTNDTQVRIDEGDVSPSK 447
                 D DE   ENDN   T+        SPSK
Sbjct: 409 ------DEDEHGPENDNVPVTE--------SPSK 428

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  280 bits (717), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 146/348 (41%), Positives = 216/348 (62%), Gaps = 8/348 (2%)

Query: 60  LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRY 118
           +++G  E  +   TV GQLTQ+IY+LI SDTLS   L E C K    + E +Y  L+ RY
Sbjct: 50  IDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY 109

Query: 119 FVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYI 178
               + G+V DRKR D  V EP S+F ++M +HL N+H+    +++++   YAN+TR+  
Sbjct: 110 VA--KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELT 167

Query: 179 VTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGE---KIQGRFSHL 235
                YCS CN D   + F + +H NV+ +L+PLER H+EVF PFD E   KIQG++SH 
Sbjct: 168 NMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHF 227

Query: 236 LYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIA 295
           LY RDY SR++W+LPL+    ++++ A++  L  + R+PIFLE+ T+DR+ +FD+C  IA
Sbjct: 228 LYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIA 287

Query: 296 EHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSD 355
             Y  K+GLG+ +   F  NGIK +K+LL  +KEEC  DWN+CL+     +NQ       
Sbjct: 288 RRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVR 347

Query: 356 GRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLEN 401
           G P DLL   +P+ + KF +K+  +I    +  VVH  E  G+++LE+
Sbjct: 348 GIPSDLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLED 395

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  268 bits (685), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 127/350 (36%), Positives = 205/350 (58%), Gaps = 1/350 (0%)

Query: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97
           F  P +       +    ++  LE G   + ++  ++ G L+Q +YELIR D L +  L 
Sbjct: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLS 102

Query: 98  RCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHV 157
              +W   ++  +  YL+ RY ++++ G V D  R+++IV EP   +  ++ +H+ N H+
Sbjct: 103 EKTRWSRINANAKCLYLKRRYKLTKK-GTVIDLTRENKIVYEPDLRYDYIISTHILNRHL 161

Query: 158 TSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHI 217
               IH+ L   Y+N++RDYI   + +CS CNPD      +K  H N+Y + LPLERV +
Sbjct: 162 GYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQL 221

Query: 218 EVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFL 277
           ++FEPF+ EKIQ R+SH++Y RDY SR+VWI PL+N K K +   +   LL LPRIPI++
Sbjct: 222 DIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYI 281

Query: 278 ESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNL 337
           ++TTI+R  +  +C +IAE Y + LG+G      F++ G+  +K LL  +K++CL+DWN+
Sbjct: 282 DTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNM 341

Query: 338 CLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQ 387
           CLK G ++ N+    ++ G P +L    +      F  KR ++I   P Q
Sbjct: 342 CLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQ 391

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  265 bits (677), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 149/403 (36%), Positives = 223/403 (55%), Gaps = 26/403 (6%)

Query: 17  EHEIEGEPKRKKVNKKSRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGA--EESLQFQ--- 71
           E E+   P          + +F++P      V    LG     L+Q    E  LQ +   
Sbjct: 36  EGEVALYPASASTESTEPDFKFVLP------VKGFDLGSFCGELDQDMLIEGRLQLEKEI 89

Query: 72  GTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDR 130
            TV GQLTQ IY+L+ SD L+  NL R   K    + E ++  L+ RY+V E   ++ D 
Sbjct: 90  NTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQE--NLLHDV 147

Query: 131 KRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNP 190
           KR D +V EP  +F L+M  H+ N+HV+S  I+  L   YAN+T+ +     S+CSKCN 
Sbjct: 148 KRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNE 207

Query: 191 DLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGE----------KIQGRFSHLLYFRD 240
                 ++K +H+N++  L+PL R H+E+F PFD            KI+G++  +LY RD
Sbjct: 208 SGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRD 267

Query: 241 YFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSL 300
           Y+SRYVW+ PL++     ++  M+  L  + R+PIF+++ T+DR+ +FD+C  IA  Y +
Sbjct: 268 YYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKI 327

Query: 301 KLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGD 360
           K+GLG+ +S  F   GIK MK L   HKEECL DWN+CLK     +NQN +    G P D
Sbjct: 328 KIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSD 387

Query: 361 LLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLEN 401
           LL ++  D ++KF   + +VI       VV   E  G+++LE+
Sbjct: 388 LLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLED 430

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  256 bits (655), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/404 (35%), Positives = 238/404 (58%), Gaps = 24/404 (5%)

Query: 37  EFIVPPMNQKFVSCL---QLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSI 93
           +F++P +++ +   L      ++++ L++G ++  +F   +AG+LTQ+ Y L+ ++ L++
Sbjct: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118

Query: 94  ANLERCHK-WKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHL 152
             + +    W   ++E +Y  L  R++  +E G + D K D+ IV EP  +F+L++ +HL
Sbjct: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKE-GNIRDAKVDNNIVLEPDKLFNLILTAHL 177

Query: 153 QNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPL 212
           +N H+ +  + + L + YAN TRD++ TA+ YC++CNPD   KP +K RH+N+  ELLPL
Sbjct: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237

Query: 213 ERVHIEVFEPFDGE--------------KIQGRFSHLLYFRDYFSRYVWILPLQNDKRKH 258
           ERVHIEVF PF+ E              KI+G++SH+ Y RD+ +RYVW  PL+N K K 
Sbjct: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297

Query: 259 MIRAMSSFLLG-LPRIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGI 317
           ++  +++F +  L   PIF+ES+TIDR+ L ++   +A  Y LKLGLG  N  +FH  GI
Sbjct: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357

Query: 318 KDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSV-PDCNRKFVKK 376
           K  K  L   K EC  DW +CLK G +  N+ I     G+  ++LFT +     R   KK
Sbjct: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIE-RQLGKASNILFTELMGQFERDMRKK 416

Query: 377 RNDVILDTPSQQVVHLGE--GVLFLENNKEEHKTVEAVKENITH 418
           +   I  + S+ +    +  G +F+E+ ++  KT+E++    T+
Sbjct: 417 KLKYIEQSFSENIKTYPKSGGCIFIEHVQDYEKTMESIDRTGTY 460

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  226 bits (577), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 129/414 (31%), Positives = 215/414 (51%), Gaps = 8/414 (1%)

Query: 39  IVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLER 98
           +VP +  K+ +     +++   ++G  +   +  T  G+++Q++Y L ++D ++  N+ R
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 99  CHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVT 158
            +       E       +R +  + NGM+ D   ++RIV +P   F ++M  HL N H+ 
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 159 SYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKP-FQKKRHKNVYWELLPLERVHI 217
           S  ++R L + YAN     I   + YCS CNP LK  P  Q K +  ++ + LPLER+ I
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY--LFEKALPLERITI 212

Query: 218 EVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFL 277
           E+ EPF  EK++G++S+++  +D+  R+ W+ PL+N K K+++  ++  +L  PR+PI++
Sbjct: 213 EIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWV 272

Query: 278 ESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNL 337
           ES T+D   LFD+   I   Y +K+GLG   ++         +   L  H +ECL D+N 
Sbjct: 273 ESNTLDWSDLFDIFEMIVTKYGIKIGLGC-TTRSSAAQATARINRDLNDHHDECLFDFNN 331

Query: 338 CLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGVL 397
           CLKYGP   NQ   +     P D++  S      KF  KR  ++  +PS  V++ G G L
Sbjct: 332 CLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTL 391

Query: 398 FLENNKEEHKTVEAVKENITHSDPDEERAENDNTNDTQVRIDEGDVSPSKTEPV 451
           +LE+     +   A   +   S  D E  E DN+     R   G+   S TEP 
Sbjct: 392 YLESPNGIQEDAAASSADELSSAKDAEDEERDNS----TREGSGNGEESDTEPA 441

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  211 bits (538), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 203/368 (55%), Gaps = 28/368 (7%)

Query: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYY 112
            +N+ LLE+G ++  ++    A  LTQ+  +++ + TLS  N+ +   K    S  +E Y
Sbjct: 49  NVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKY 108

Query: 113 YLRSR-YFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYA 171
              SR Y+++E+N ++ D+++  RI+CEP  M+ +V+  HL+ +  +SY +   L K ++
Sbjct: 109 NFTSRRYYLNEDNNII-DKRKPGRIICEPKYMYDIVIAYHLKLH--SSYAVSERLKKFFS 165

Query: 172 NITRDYIVTAISYCSKCNPD--------LKAKPFQKKRHKNVYWELLPLERVHIEVFEPF 223
           N+ R YI     YCSKC PD             F+  R+  +   L P+ER+HIE+F PF
Sbjct: 166 NVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPF 225

Query: 224 DGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLP-RIPIFLESTTI 282
           D  KI+ ++  +LY RDY +RY+W   L+  K KH+   ++ F L +   +PIFL+S+TI
Sbjct: 226 DDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTI 285

Query: 283 DREHLFDLCGQIAEHYSLKLGLGVKNSQ-RFHNNGIKDMKELLGSHKEECLQDWNLCLKY 341
           D   LFD+C +I+  Y + LGLG  N    FH +GI+  K+L+  +K +CL+ W+  L +
Sbjct: 286 DNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVF 345

Query: 342 GPFHINQNINVSSDGRPGDLLFTSVPDCN------RKFVKKRNDVILDTPSQQVVHLG-- 393
           G    N   N     +P D++     +CN      +KF  +R  +I  T +   V LG  
Sbjct: 346 GSVLHNNKFNSRILSKPIDII-----NCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNV 400

Query: 394 EGVLFLEN 401
             ++F+E+
Sbjct: 401 ASIIFIED 408

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  207 bits (528), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 120/409 (29%), Positives = 228/409 (55%), Gaps = 18/409 (4%)

Query: 35  NGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIA 94
           N ++I+P + QK+ S +   ++  LL++G    +    +    L++++Y+L+++D L+  
Sbjct: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKG---EIAVANSKTNYLSKELYDLVKNDDLTRK 84

Query: 95  NLERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQN 154
           N+        +++      L+ RY+  +   MV DR + ++IV +PA  F +VM +HL N
Sbjct: 85  NVAVALNLDEKNAITRLIPLKHRYY-RDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143

Query: 155 NHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLER 214
           +H+T   I+R L K +AN++  +I T+I YCS CN + K    +K+   +   ++L  ER
Sbjct: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203

Query: 215 VHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIP 274
           + ++V  PF  +KIQ R++H+L   D+ ++++W  PL+N K + +I  ++ F++ LP  P
Sbjct: 204 LILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263

Query: 275 IFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQD 334
           +F+ S T+    +F+LC  +A  Y++ +GLG +N Q+ ++     +  +L SHK ECL+ 
Sbjct: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKS 322

Query: 335 WNLCLKYGPFHINQNINVSSDGRPGDL---LFTSVPDCNRKFVKKRNDVILDTPSQQVVH 391
           W +CLK+     ++  N   D RP +    LF+ + D  +K+ ++   +I   PS+  ++
Sbjct: 323 WFMCLKWLA---DRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379

Query: 392 LGEGVLFLENNKE-------EHKTVEAVKENITHSDPDEERAENDNTND 433
           + EG  F+ +  E       E +T + + E++ +S  D +    DN  D
Sbjct: 380 IDEGSHFIYSEDEFSFDNLVEKETPKKLSESVVNSSEDSDDNYEDNQED 428

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  187 bits (475), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 111/360 (30%), Positives = 190/360 (52%), Gaps = 22/360 (6%)

Query: 51  LQLGMNLNL--LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE---RCH----- 100
           ++LG ++++  +  G  + LQ +   +  LTQ++Y LIR    +    E   + H     
Sbjct: 33  IELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSG 92

Query: 101 KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSY 160
           K+ G +++ ++  +  RY ++E  G + D++ D +++  P  ++ L+M  H  N+H+ S 
Sbjct: 93  KYMGTANK-KFMLMEDRYQLNEL-GQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGST 150

Query: 161 NIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRH----KNVYWELLPLERVH 216
            IH +L + Y+NI+R  +  ++  CS CNP    K  +  RH    KN        E++H
Sbjct: 151 KIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKN-----FAFEKIH 205

Query: 217 IEVFEPF-DGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPI 275
           +E+F+PF D +    +FSH++Y RDYF+RYVW+ PL+    K +   +++ LL   RIPI
Sbjct: 206 VEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPI 265

Query: 276 FLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDW 335
           ++ES T+D  +L  +  +I++  +L LG+G      F  +GI  MKEL   ++E C  +W
Sbjct: 266 YIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNW 325

Query: 336 NLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEG 395
           N  +     H N   N    G P +L+       N+ + KKR   IL T S+  + L  G
Sbjct: 326 NKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNG 385

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  167 bits (422), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 195/375 (52%), Gaps = 13/375 (3%)

Query: 37  EFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL 96
           +F  PP+           ++ ++L++G +E+++F+ T+   +T  +Y  +R ++L   + 
Sbjct: 27  DFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDA 86

Query: 97  ERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156
                 K ++S+    YL+ RY  + +  ++    + ++++CEP  ++ L M +H  NNH
Sbjct: 87  PIPASLKIKTSK--KMYLQIRYSKNSDGDLI--ETKTNKLLCEPKYIYKLTMKAHFMNNH 142

Query: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKR-HKNVYWELLPLERV 215
           + S  ++RNL   Y NI    +V  + YCS CN   K +  +     +N Y + LPLER+
Sbjct: 143 MRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERL 202

Query: 216 HIEVFEPFDGE--KIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRI 273
            I++ +PF+    KI  ++SH+L  RDY SRY WI PL++   K++   +  FL+ LPR 
Sbjct: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262

Query: 274 PIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQR--FHNNGIKDMKELLG--SHKE 329
           PIFL S  I    L  +  +I   Y +K+ +G+   +   F   GI  +  LL    +KE
Sbjct: 263 PIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKE 322

Query: 330 ECLQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQV 389
           +C  DW  C++   F  N+  + ++      L+     + N+ F  KR+ ++ D   + V
Sbjct: 323 KCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENV 382

Query: 390 VHLGE--GVLFLENN 402
           + +GE   +++ +NN
Sbjct: 383 LKIGECGSIIYFDNN 397

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 15/129 (11%)

Query: 136 IVCEPASMFHLVMCSHLQNNHVTSYNI--HRN-------LVKTYANITRDYIVTAISYCS 186
           I C P  + +++ C H +N     Y +  HR+       L   Y NI++  I   ++ C 
Sbjct: 154 IWCPPTLLHYVIACVH-ENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACP 212

Query: 187 KCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEKIQGR----FSHLLYFRDYF 242
            C P L +K F   R   +       +R+ +++    D   +  +     + +LY  DY 
Sbjct: 213 DCKP-LSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYIGDYH 271

Query: 243 SRYVWILPL 251
           S  VW+  L
Sbjct: 272 SGAVWLFAL 280

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 211 PLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMI 260
           P E +H ++F P  G  I     + + F D  +R+ W+ PL+     H++
Sbjct: 375 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHIL 423

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 211 PLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGL 270
           P + +H +VF P   +K     S  + F D  +R+ W+ PL+N     M+  +++ +  +
Sbjct: 411 PFQYIHTDVFGPVSVDKPYP--SWFVAFTDEATRFRWVFPLENKTADLMLHVITALVNTI 468

Query: 271 PR 272
            R
Sbjct: 469 KR 470

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 206 YWELLPLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMI 260
           Y+E  P E +H ++F P  G  I     + + F D  +R+ W+ PL+     H++
Sbjct: 287 YYE--PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHIL 338

>NDAI0D00680 Chr4 (145699..146403) [705 bp, 234 aa] {ON} 
          Length = 234

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 211 PLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGL 270
           P + +H +VF P   +K     S  + F D  +R+ W+ PL+N     M+  +++ +  +
Sbjct: 28  PFQYIHTDVFGPVSVDKPYP--SWFVAFTDEATRFRWVFPLENKTADLMLHVITALVNTI 85

Query: 271 PR 272
            R
Sbjct: 86  KR 87

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 201 RHKNVYWELL----PLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKR 256
           +HK++    L    P+  +H ++F P  G  I     + + F D  +R+ W+ PL+    
Sbjct: 171 KHKHIVGSRLNIKSPMSYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDA 229

Query: 257 KHMI 260
            H++
Sbjct: 230 DHIL 233

>YBR115C Chr2 complement(469748..473926) [4179 bp, 1392 aa] {ON}
            LYS2Alpha aminoadipate reductase, catalyzes the reduction
            of alpha-aminoadipate to alpha-aminoadipate
            6-semialdehyde, which is the fifth step in biosynthesis
            of lysine; activation requires posttranslational
            phosphopantetheinylation by Lys5p
          Length = 1392

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 498  AEVMVA---NIPNDNHVNTVQM--QPAIVRDDYIYDSDELADYNLEVEQKRYKRMRKSND 552
            A V+VA   N P +N +   Q+   P I+  DY+Y    L DY  +VE + Y + +KS +
Sbjct: 1223 ARVVVATSLNPPKENELAVAQVTGHPRILFKDYLY---TLHDYGYDVEIESYSKWKKSLE 1279

Query: 553  A 553
            A
Sbjct: 1280 A 1280

>Kwal_26.9078 s26 complement(1063916..1067224) [3309 bp, 1102 aa]
           {ON} YMR218C (TRS130) - Component of targeting complex
           (TRAPP) involved in ER to Golgi membrane traffic; 130 kD
           subunit [contig 69] FULL
          Length = 1102

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 350 INVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTP-SQQVVHLGEGVLFLENNKEEHKT 408
           ++V S   P D+LFT++    R  +K +ND +L    S  ++H GE  +FLE +K    +
Sbjct: 569 VDVRSTKVPQDILFTTM----RLLLKNQNDDLLTFQLSDCLIHPGENEIFLEASKITFGS 624

Query: 409 VEAVKENIT 417
            E +    T
Sbjct: 625 FELINIEFT 633

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 211 PLERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFL 267
           P + +H ++F P      +   S+ + F D  +R+ W+ PL + + + ++   +S L
Sbjct: 236 PFQYLHTDIFGPVH-HLPKSAPSYFISFTDEKTRFQWVYPLHDRREESILNVFTSLL 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,840,717
Number of extensions: 3097790
Number of successful extensions: 13637
Number of sequences better than 10.0: 68
Number of HSP's gapped: 14063
Number of HSP's successfully gapped: 68
Length of query: 586
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 471
Effective length of database: 40,294,809
Effective search space: 18978855039
Effective search space used: 18978855039
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)