Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01628g8.263ON53453428520.0
TDEL0F039008.263ON55952021070.0
YLR089C (ALT1)8.263ON59252820640.0
Skud_12.1578.263ON59248720630.0
Suva_10.1738.263ON59250420510.0
Smik_12.1488.263ON59250120430.0
NDAI0B019908.263ON58848620190.0
NCAS0B050208.263ON56848620170.0
KLLA0F19162g8.263ON52848919900.0
SAKL0H17006g8.263ON53148819730.0
KNAG0G020408.263ON59148819700.0
CAGL0L12254g8.263ON57450919430.0
KAFR0B027308.263ON53948418560.0
Kpol_392.58.263ON51248818410.0
NCAS0B038408.263ON49748618210.0
TPHA0J007508.263ON52248617780.0
Skud_4.3728.263ON50748617660.0
KLTH0G13662g8.263ON51948317530.0
KNAG0M012108.263ON52149617500.0
Smik_4.3578.263ON50748617470.0
Kwal_56.237918.263ON51848317380.0
YDR111C (ALT2)8.263ON50748617360.0
KAFR0B055308.263ON51448717360.0
KAFR0B05520singletonON51048717230.0
TBLA0E044408.263ON56248617190.0
Suva_2.2718.263ON50748617130.0
Ecym_43078.263ON53450217040.0
NDAI0J013608.263ON50148616930.0
Kpol_543.398.263ON49248716850.0
TPHA0A018008.263ON49848716400.0
AGR085W8.263ON52148616390.0
TBLA0F030608.263ON50049215920.0
TBLA0G01630singletonON50049415210.0
SAKL0F02156g3.511ON4981281312e-07
TDEL0D019001.321ON4431831286e-07
KLLA0F10021g3.511ON4973271286e-07
TPHA0O014501.321ON4431421269e-07
Skud_10.1561.321ON4601381223e-06
Kwal_34.160181.472ON3791811213e-06
Suva_6.1361.321ON4441381197e-06
YJL060W (BNA3)1.321ON4441381188e-06
KNAG0B053201.321ON4331731171e-05
NCAS0E006703.511ON4971441162e-05
NCAS0A092001.321ON4451821152e-05
Kpol_1035.231.321ON4443211152e-05
Kpol_278.23.511ON4981221143e-05
AEL170C1.321ON4583711143e-05
NDAI0G057601.321ON4481691134e-05
CAGL0J05126g1.321ON4331371124e-05
Kpol_1039.222.252ON3861801115e-05
KLTH0G02002g3.511ON4961591116e-05
Kwal_47.189823.511ON4961901116e-05
KLLA0F01617g1.321ON4441781107e-05
KAFR0D014203.511ON4921251117e-05
ZYRO0G20636g1.321ON4531651101e-04
TPHA0D033703.511ON4971551091e-04
KNAG0B006603.511ON4961251091e-04
KNAG0E018502.252ON3841251091e-04
KLTH0G09614g2.252ON3891271072e-04
KLLA0F03509g2.252ON3871721062e-04
Ecym_6319singletonON3542921053e-04
KLTH0H10648g1.321ON4433691053e-04
Kwal_14.25741.321ON4431451053e-04
Kwal_23.48882.252ON3891261035e-04
KLTH0G19646g1.472ON3791761036e-04
KAFR0A017101.321ON4351841036e-04
KNAG0G005501.472ON3871971036e-04
Smik_10.1801.321ON4441391036e-04
ADL249W2.252ON3871791028e-04
CAGL0G01254g3.511ON5041221028e-04
SAKL0D06886g1.321ON4471391010.001
KLTH0B06270g2.102ON5251601010.001
SAKL0H21824gna 1ON499128990.002
Ecym_32902.252ON386123980.002
KLTH0E07678gna 1ON492194980.002
SAKL0E08492g2.252ON384124970.003
ZYRO0C06028g3.511ON496128970.004
SAKL0D11528g1.472ON383155950.005
TBLA0B009902.102ON546159950.005
NCAS0B064402.252ON385126940.006
YGL202W (ARO8)3.511ON500122940.007
NDAI0I028303.511ON500122940.007
Kwal_33.145822.102ON525160940.007
Smik_7.693.511ON500127940.008
Kwal_47.17462na 1ON492128940.008
ZYRO0A01672g2.252ON386127930.010
AFR548C3.511ON497130910.018
AGR167Wna 1ON512140910.018
Ecym_7228na 1ON488125900.022
TPHA0F012602.252ON392175890.026
Ecym_62921.321ON430132880.039
KNAG0H037302.102ON523172880.039
Suva_7.613.511ON500127880.041
NDAI0B037302.252ON386127870.044
Kwal_8.5858.204ON446341860.063
TDEL0D057903.511ON49760860.075
KAFR0J015802.252ON383126850.081
KLLA0A04906gna 1ON480135850.082
Smik_9.532.252ON388125850.083
TDEL0F009002.102ON49344850.086
Smik_5.3198.204ON443182850.096
Skud_7.693.511ON500122850.10
Suva_9.782.252ON386125830.13
YIL116W (HIS5)2.252ON385123820.16
NCAS0G040501.472ON384166820.17
TBLA0B080808.204ON444179820.18
TDEL0C040902.252ON383125810.24
Kpol_480.11.472ON380154810.28
TDEL0A016008.204ON475187810.28
Suva_17.6singletonON40174790.39
KLTH0G19624gsingletonON46841780.54
KLTH0B00176g8.204ON44841780.62
TBLA0A103205.287ON62160780.69
Kwal_26.77682.475ON422226770.71
YFR055W (IRC7)na 2ON34067770.72
Skud_9.552.252ON385125760.98
KLTH0D05478g2.475ON421199751.2
Skud_19.6singletonON40167741.9
CAGL0G06028g2.102ON53744732.7
CAGL0C01243g2.252ON383127723.4
ZYRO0C02112g3.68ON54556723.6
KNAG0G016808.204ON45262714.1
SAKL0G02838g5.449ON243121694.9
TDEL0F046408.340ON123771706.0
TBLA0I011802.475ON443234706.2
Kpol_431.132.475ON443343697.5
NDAI0J00920singletonON610111697.7
CAGL0I06578g8.204ON43633688.8
KLLA0F13640g2.475ON418179688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01628g
         (534 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...  1103   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   816   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   799   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   799   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   794   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   791   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   782   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   781   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   771   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   764   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   763   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   753   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   719   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   713   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   706   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   689   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   684   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   679   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   678   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   677   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   674   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   673   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            673   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   668   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   666   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   664   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   660   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   656   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   653   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   636   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   635   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   617   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              590   0.0  
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    55   2e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    54   6e-07
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    54   6e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    53   9e-07
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    52   3e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    51   3e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   7e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    50   8e-06
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    50   1e-05
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     49   2e-05
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    49   2e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    49   2e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    49   3e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    49   3e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    48   4e-05
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    48   4e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    47   5e-05
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    47   6e-05
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    47   6e-05
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    47   7e-05
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    47   7e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    47   1e-04
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    47   1e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    47   1e-04
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    47   1e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    46   2e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    45   2e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    45   3e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    45   3e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    45   3e-04
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    44   5e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    44   6e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    44   6e-04
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       44   6e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    44   6e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    44   8e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    44   8e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    44   0.001
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    44   0.001
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    43   0.002
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    42   0.002
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    42   0.002
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.003
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    42   0.004
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    41   0.005
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    41   0.005
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    41   0.006
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    41   0.007
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    41   0.007
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    41   0.007
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.008
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    41   0.008
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.010
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    40   0.018
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    40   0.018
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    39   0.022
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    39   0.026
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.039
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    39   0.039
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    39   0.041
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    38   0.044
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    38   0.063
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    38   0.075
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.081
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    37   0.082
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    37   0.083
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    37   0.086
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.096
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.10 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    37   0.13 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    36   0.16 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    36   0.17 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    36   0.18 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    36   0.24 
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    36   0.28 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    36   0.28 
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    35   0.39 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    35   0.54 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    35   0.62 
TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON} Anc_5...    35   0.69 
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    34   0.71 
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    34   0.72 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    34   0.98 
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    33   1.2  
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    33   1.9  
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    33   2.7  
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    32   3.4  
ZYRO0C02112g Chr3 (166252..167889) [1638 bp, 545 aa] {ON} simila...    32   3.6  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    32   4.1  
SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {O...    31   4.9  
TDEL0F04640 Chr6 (870870..874583) [3714 bp, 1237 aa] {ON} Anc_8....    32   6.0  
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    32   6.2  
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    31   7.5  
NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {...    31   7.7  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    31   8.8  
KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]...    31   8.9  

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score = 1103 bits (2852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/534 (100%), Positives = 534/534 (100%)

Query: 1   MVLLARPRILLSSRRTLLQVAQRYKSAQTEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNE 60
           MVLLARPRILLSSRRTLLQVAQRYKSAQTEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNE
Sbjct: 1   MVLLARPRILLSSRRTLLQVAQRYKSAQTEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNE 60

Query: 61  NVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLS 120
           NVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLS
Sbjct: 61  NVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLS 120

Query: 121 LLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFI 180
           LLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFI
Sbjct: 121 LLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFI 180

Query: 181 TERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHP 240
           TERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHP
Sbjct: 181 TERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHP 240

Query: 241 LPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300
           LPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA
Sbjct: 241 LPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300

Query: 301 AKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGEC 360
           AKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGEC
Sbjct: 301 AKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGEC 360

Query: 361 GQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERK 420
           GQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERK
Sbjct: 361 GQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERK 420

Query: 421 SIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYC 480
           SIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYC
Sbjct: 421 SIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYC 480

Query: 481 KKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534
           KKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD
Sbjct: 481 KKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/520 (73%), Positives = 447/520 (85%), Gaps = 2/520 (0%)

Query: 15  RTLLQVAQRYKSAQTEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIP 74
           R+ + + +   ++ T A LHHI+ K  +     YPAE L + ++NENVLKAKYAVRG+IP
Sbjct: 42  RSYMNIKRARSTSSTAAGLHHIYHKKCH--QDFYPAESLTVRDLNENVLKAKYAVRGSIP 99

Query: 75  MLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQV 134
           M A EL  +LK+DP SLPFD IV+ANIGNPQ L QKPL+FYRQVLS+LQYP +LE+ E+ 
Sbjct: 100 MRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEE 159

Query: 135 LIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDI 194
           LI   ++++DAI RA+R+L D+G SVGAYS+SQG+ GIR+TVA FITERD GE AY EDI
Sbjct: 160 LISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDI 219

Query: 195 FLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTN 254
           FLTAGAS+AVSYLLSILC+GQETGVLIPIPQYPLYTA+LALNNSH LPYYLDE+SGWSTN
Sbjct: 220 FLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTN 279

Query: 255 PTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
             EIE VV  +IE  I+PSVLVVINPGNPTG+VLS E I +IF +AAKYGIVVIADEVYQ
Sbjct: 280 TAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQ 339

Query: 315 ENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNN 374
           EN+F G+EFHSMKK+LR+LQK +PG++DNVQL SLHSTSKGVSGECGQRGGYME+TGF +
Sbjct: 340 ENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTH 399

Query: 375 DIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLH 434
           +IRQV+LKLASISLCPVVTGQALVDLMV PPKPGDESYE D++ER+ IHE L  RAG LH
Sbjct: 400 EIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLH 459

Query: 435 ATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPG 494
            TFNSLEGIECQKP GAMYLFP++ LP+KAIQ+A+H   TPD FYC+KLLEATGICTVPG
Sbjct: 460 DTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPG 519

Query: 495 SGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534
           SGFGQEPGTYHLRTTFLAPGTEWI++WE+FHK FY++YRD
Sbjct: 520 SGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/528 (72%), Positives = 443/528 (83%), Gaps = 5/528 (0%)

Query: 12  SSRRTLLQVAQRYKSAQTEAH-LHHI----HSKVSNVLGAVYPAEKLGLSEVNENVLKAK 66
           SS   + Q  +R  S Q+  + L H+    H  +       YPAE+L L +VNENVLKAK
Sbjct: 65  SSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAK 124

Query: 67  YAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPG 126
           YAVRGAIPM A EL A+L+KDP SLPFD I++ANIGNPQ L+QKPLT+YRQVLSLLQYP 
Sbjct: 125 YAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPE 184

Query: 127 LLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGG 186
           LL +NEQ L+DSKL++ DAI RA+ L+ DIG SVGAYS+SQG++GIR++VA+FIT+RD G
Sbjct: 185 LLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEG 244

Query: 187 EKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLD 246
           E +Y EDIFLTAGAS+AV+YLLSI C+G ETGVLIPIPQYPLYTA+LALNNS  LPYYLD
Sbjct: 245 EISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLD 304

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306
           E SGWSTNP EIE VV  AI+  IKP+VLVVINPGNPTGAVLS E I+QIF +AAKYG V
Sbjct: 305 ENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTV 364

Query: 307 VIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGY 366
           VIADEVYQEN+F G +FHSMKKILR LQ+ +PG FDNVQLASLHSTSKGVSGECGQRGGY
Sbjct: 365 VIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGY 424

Query: 367 MEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEAL 426
           ME+TGF++++RQVILKLASISLCPVVTGQALVDLMV PP  G+ES+E DQ ER SIHE L
Sbjct: 425 MELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKL 484

Query: 427 AERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEA 486
             RA  L+ TFNSLEGIECQKP+GAMYLFP++ LPFKA+Q A H  +TPD FYCKKLLE+
Sbjct: 485 ITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLES 544

Query: 487 TGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEEYRD 534
           TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI++WE+FHK F+++YRD
Sbjct: 545 TGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/487 (76%), Positives = 428/487 (87%)

Query: 48  YPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHL 107
           YPAE+L L +VNENVLKAKYAVRGAIPM A EL A+L+KDP SLPFD I++ANIGNPQ L
Sbjct: 106 YPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQL 165

Query: 108 KQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167
           +QKPLT+YRQVLSLLQYP LL +NEQ L+DSKL++ DAI RA+ L+ DIG SVGAYS+SQ
Sbjct: 166 QQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQ 225

Query: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227
           G++GIR++VA+FIT+RD GE +Y EDIFLTAGAS+AV+YLLSI C+G ETGVLIPIPQYP
Sbjct: 226 GVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYP 285

Query: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287
           LYTA+LALNNS  LPYYLDE+SGWSTNP EIE VV  AI+  IKP+VLVVINPGNPTGAV
Sbjct: 286 LYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAV 345

Query: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA 347
           LS E +SQIF +AAKYG VVIADEVYQEN+F G +FHSMKKILR LQ+ +PG FDNVQLA
Sbjct: 346 LSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLA 405

Query: 348 SLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKP 407
           SLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCPVVTGQALVDLMV PP  
Sbjct: 406 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVE 465

Query: 408 GDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQS 467
           G+ES+ELDQ ER SIHE L  RA  L+ TFNSLEGIECQKP+GAMYLFP++ LPFKA+Q 
Sbjct: 466 GEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQE 525

Query: 468 AEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKA 527
           A H  +TPD FYCK LLE+TGICTVPGSGFGQEPGTYHLRTTFLAPG EWI++WE FHK 
Sbjct: 526 ARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKE 585

Query: 528 FYEEYRD 534
           F+++YRD
Sbjct: 586 FFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/504 (74%), Positives = 431/504 (85%), Gaps = 1/504 (0%)

Query: 32  HLHHI-HSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHS 90
           HL+   H  +       YPAE+L L +VNENVLKA+YAVRGAIPM A EL A+L+KDP S
Sbjct: 89  HLNRFPHHTLKTANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQS 148

Query: 91  LPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARAR 150
           LPF+ I++ANIGNPQ L+QKPLT+YRQVLSLLQYP LL  NEQ L+ SKL++ DAI RA+
Sbjct: 149 LPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAK 208

Query: 151 RLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSI 210
            L+ DIG SVGAYS+SQG++GIR++VA FIT+RDGGE AY EDIFLTAGAS+AV+YLLSI
Sbjct: 209 SLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSI 268

Query: 211 LCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNI 270
            C+G ETGVLIPIPQYPLYTA+LALNNS PLPYYLDE SGWSTNP EIE VV  AI+  I
Sbjct: 269 FCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEI 328

Query: 271 KPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKIL 330
           KP+VLVVINPGNPTGAVLS E I+QIF +AAKYG VVIADEVYQEN+F G EF+SMKK+L
Sbjct: 329 KPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVL 388

Query: 331 RKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCP 390
           R LQ+ +PG FDNVQLASLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCP
Sbjct: 389 RHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCP 448

Query: 391 VVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEG 450
           VVTGQALVDLMV PP  G+ES+E DQ ER SIHE L  RA  L+ TFNSLEGIECQKP+G
Sbjct: 449 VVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQG 508

Query: 451 AMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTF 510
           AMYLFP++ +PFKAIQ A H  +TPD FYCKKLLE+TGICTVPGSGFGQEPGTYHLRTTF
Sbjct: 509 AMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTF 568

Query: 511 LAPGTEWIERWENFHKAFYEEYRD 534
           LAPG EW+++WE FHK F+++YRD
Sbjct: 569 LAPGVEWMKKWEIFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/501 (75%), Positives = 429/501 (85%), Gaps = 3/501 (0%)

Query: 34  HHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPF 93
           HH   K SN     YPAE+L L +VNENVLKAKYAVRGAIPM A EL A+L+KDP SLPF
Sbjct: 95  HHT-LKTSN--NEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPF 151

Query: 94  DNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLL 153
           + I++ANIGNPQ L+QKPLT+YRQVLSLLQYP LL +NEQ L+DSKL++ DAI RA+ L+
Sbjct: 152 NKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLM 211

Query: 154 NDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCK 213
            +IG SVGAYS+SQG++GIR +VA+FIT+RD GE +Y EDIFLTAGAS+AV+YLLSI C+
Sbjct: 212 EEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCR 271

Query: 214 GQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPS 273
           G ETGVLIPIPQYPLYTA+LALNNS  LPYYLDE SGWSTNP EIE VV  AIE  IK +
Sbjct: 272 GPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKST 331

Query: 274 VLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKL 333
           VLVVINPGNPTGAVLS E I+QIF +AAKYG VVIADEVYQEN+F G +FHSMKKILR L
Sbjct: 332 VLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHL 391

Query: 334 QKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVT 393
           Q+ +PG FDNVQLASLHSTSKGVSGECGQRGGYME+TGF++++RQVILKLASISLCPVVT
Sbjct: 392 QREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVT 451

Query: 394 GQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMY 453
           GQALVDLMV PP  G+ES+E DQ ER SIHE L  RA  L+ TFNSLEGIECQKP+GAMY
Sbjct: 452 GQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMY 511

Query: 454 LFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAP 513
           LFP++ LPF+A+Q A H  +TPD FYCKKLLE+TGICTVPGSGFGQEPGTYHLRTTFLAP
Sbjct: 512 LFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAP 571

Query: 514 GTEWIERWENFHKAFYEEYRD 534
           G EWI++WE FHK F++ YRD
Sbjct: 572 GLEWIKKWETFHKEFFDHYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/486 (75%), Positives = 421/486 (86%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PAE+L L+++NENVLKAKYAVRG+IPM A EL  +L+ +P +LPF  IV+ANIGNPQ LK
Sbjct: 103 PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPL+FYRQVLS+LQYP +L+ENEQ LID+K+Y++DAI RA+ LL++IG SVGAYS SQG
Sbjct: 163 QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+TVA FITERDGGE AY EDIFLT        YLLSILC+G +TGVLIPIPQYPL
Sbjct: 223 VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTA+LALNNSH LPYYLDEKSGWSTNP EIE+VV +A+E+ I PSVLVVINPGNPTGAVL
Sbjct: 283 YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           +EE I  IF IAAKYGIVVIADEVYQEN+ DG +F+SMKK+LRKLQKS+PG FDNVQLAS
Sbjct: 343 TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHSTSKGVSGECGQRGGYME+ GF +++R+VILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 403 LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           D SYE DQ ER+ I   L+ RA +L+ TF  LEGIECQKP+GAMYLFP+L LPFKA+Q A
Sbjct: 463 DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           +H  MTPD FYCK LL+ATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI++WE FHK F
Sbjct: 523 QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582

Query: 529 YEEYRD 534
           Y+ YRD
Sbjct: 583 YDNYRD 588

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/486 (76%), Positives = 423/486 (87%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA++L L+E+N+NVLKAKYAVRGAIPM A EL  +L++DP SLPFD+IV+ANIGNPQ L 
Sbjct: 83  PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPL+FYRQVLSLLQYP +L+++E  L+ S L++KDA+ RA+ LL++IG +VGAYS SQG
Sbjct: 143 QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+TVA FIT+RD GE AY EDIFLTAGAS+AV YLLSILCKG ETGVLIPIPQYPL
Sbjct: 203 VYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPL 262

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTASLALNNSH LPYYLDEKSGWSTNP EIE+VV  A ++ I+PSVLVVINPGNPTGAVL
Sbjct: 263 YTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVL 322

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           SE+ I  IF IAAKYGIVVIADEVYQENVF+  +FHSMKK+LR LQK +PGV+D VQLAS
Sbjct: 323 SEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLAS 382

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHSTSKGVSGECGQRGGYME+TGF +++R VILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 383 LHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKG 442

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           DES+E DQ ERK I   L  RA +L+  FN+LEGIECQKP+GAMYLFPRL LPFKA+Q A
Sbjct: 443 DESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKA 502

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           +H  M+PD FYCK LLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIE+W+ FH+ F
Sbjct: 503 QHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDF 562

Query: 529 YEEYRD 534
           Y  YRD
Sbjct: 563 YNTYRD 568

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/489 (74%), Positives = 418/489 (85%), Gaps = 2/489 (0%)

Query: 46  AVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQ 105
            V PA KL L +VNENVLKAKYAVRG IPM A EL  +LKKDP SLPF  I+SANIGNPQ
Sbjct: 42  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 101

Query: 106 HLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYST 165
            L QKPLTFYR+VLSLLQ+P LLEE ++ L    LY+ D+I RA+RLL+++G SVGAYS 
Sbjct: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQ 159

Query: 166 SQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQ 225
           SQG+QGIRETVA FIT+RD GE +Y EDI+LTAGAS+AVSY+LSILCKG  TGVLIPIPQ
Sbjct: 160 SQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQ 219

Query: 226 YPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTG 285
           YPLYTASLALNNS PLPYYL E+  WST+P EIE VV +AI++ IKP+ LVVINPGNPTG
Sbjct: 220 YPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTG 279

Query: 286 AVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQ 345
           A+LSE+ I +IF +AAKYGIVVIADEVYQENVF G++F+SMKK+LR LQK+  G +DN+Q
Sbjct: 280 AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 339

Query: 346 LASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPP 405
           LASLHSTSKGVSGECGQRGGYME+ GFN+DIRQV LKLASISLCPVVTGQALVDLMVSPP
Sbjct: 340 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 399

Query: 406 KPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAI 465
           +PGDESYE DQQER+ IH+AL ERA KL  TF+ LEGIEC+KP+GAMYL+P+L LP+K I
Sbjct: 400 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 459

Query: 466 QSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFH 525
           Q A+H  M PD FYCK LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E WE FH
Sbjct: 460 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 519

Query: 526 KAFYEEYRD 534
           KAF+++YRD
Sbjct: 520 KAFFDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/488 (74%), Positives = 417/488 (85%), Gaps = 5/488 (1%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA+KL L ++NENVL+AKYAVRG IP  A EL  +L +DP SLPFD I++ANIGNPQ L 
Sbjct: 47  PADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLD 106

Query: 109 QKPLTFYRQVLSLLQYPGLLEE--NEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           QKPLTFYRQVLSLLQ P +LEE   EQ+   S++Y+ DAI RA RLL++IG SVGAYS S
Sbjct: 107 QKPLTFYRQVLSLLQNPDMLEEIPREQL---SQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226
           QG+ G R+TVA FIT+RDGGE+AYAEDIFLTAGAS+AVSY+LSILC+G +TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286
           PLYTASLALNNSH LPYYLDE+S WSTNP EIE VV N+I + ++P  LVVINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           +LS E I +IF +AAKYGIVVIADEVYQENVF+GAEFHSM+K+L+ LQ+ + G FDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKGVSGECGQRGGYME+ GF++D+RQV LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
           PGD SYE DQ+ER  IH+AL  RA  L+ TFN LEGIECQKP+GAMYLFPRL L +KA+Q
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            AEH  ++PD FYC++LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI+ WE FHK
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 527 AFYEEYRD 534
            FY EYRD
Sbjct: 524 KFYNEYRD 531

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/488 (74%), Positives = 417/488 (85%), Gaps = 2/488 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA ++ ++++NENVLKAKYAVRG+IPM A +L  +L++DP SLPFD I++ANIGNPQ L 
Sbjct: 104 PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163

Query: 109 QKPLTFYRQVLSLLQYPGLLEE-NEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167
           QKPL+FYRQVLSLLQ+P LL    E     + LY+ DA+ RA +LL DIG SVGAYSTSQ
Sbjct: 164 QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223

Query: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227
           G+ GIR+TVA FIT RD  E AY EDIFLTAGAS+AVSYLLSI CKG++TGVLIPIPQYP
Sbjct: 224 GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283

Query: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287
           LYTA+LALNNSH LPYYLDEKSGWSTN  EI+ VV +AI++NIKPSVLVVINPGNPTGAV
Sbjct: 284 LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343

Query: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFD-GAEFHSMKKILRKLQKSNPGVFDNVQL 346
           LSE+ I++IF IAAKYGIVVIADEVYQEN+FD   +FHSMKK+LRKLQ+ +PG FD VQL
Sbjct: 344 LSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKGVSGECGQRGG+ME+TGF+++IRQVILKLASISLCPVVTGQALVDLMV PP+
Sbjct: 404 ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
            G+ESYELDQ ER  IH  L +RA KL  TFN LEGI+CQKP+GAMYLFPRL LPFKA+Q
Sbjct: 464 EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            A+H  MT D FYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWI+ WE FHK
Sbjct: 524 KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583

Query: 527 AFYEEYRD 534
            FY +YRD
Sbjct: 584 EFYNKYRD 591

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/509 (70%), Positives = 424/509 (83%), Gaps = 14/509 (2%)

Query: 29  TEAHLHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDP 88
           TE H HH H+ +        PAE+  L +VNE VL AKYAVRGAIPM A EL  +L ++P
Sbjct: 77  TEIH-HHSHNNL-----PFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENP 130

Query: 89  HSLPFDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGL---LEENEQVLIDSKLYQKDA 145
           HSLPF++I++ANIGNPQ LKQKPL+FYRQVLSLLQYP L   LE N Q +I     ++DA
Sbjct: 131 HSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDA 185

Query: 146 IARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVS 205
           I RA+RLL+DIG SVGAYS+SQG+ GIR+TVA FIT RD G  AY EDIFLTAGASSAV 
Sbjct: 186 IDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVD 245

Query: 206 YLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNA 265
           YLLSI C+G+ETGVLIPIPQYPLYTA+LAL NSH LPYYL+E++GWST+P E+E ++ ++
Sbjct: 246 YLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDS 305

Query: 266 IEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHS 325
           IE NIKPSVLVVINPGNPTGAVLSEE I QIF +AAKYGI+VIADEVYQENVF+  +FHS
Sbjct: 306 IENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHS 365

Query: 326 MKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLAS 385
           MKK+LR+LQ   PG++DNVQLASLHSTSKGVSGECGQRGGYME+ GF +DIRQV+LKLAS
Sbjct: 366 MKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLAS 425

Query: 386 ISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIEC 445
           ISLCPVVTGQALVDLMV PP+ G+ESYE DQ+ER++IH+ L +RA  LH  F  L+GI C
Sbjct: 426 ISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISC 485

Query: 446 QKPEGAMYLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYH 505
           QKP+GAMYLFP+L LP+KAIQ A H+ M+PD FYCK LLE TGICTVPGSGFGQEPGTYH
Sbjct: 486 QKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYH 545

Query: 506 LRTTFLAPGTEWIERWENFHKAFYEEYRD 534
           LRTTFLAPGT+WIE W +FH+ FY ++++
Sbjct: 546 LRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/484 (72%), Positives = 407/484 (84%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA +L + ++NENVLKAKYAVRG IP  A EL  +L + P+SLPFD I++ANIGNPQ L+
Sbjct: 54  PAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQ 113

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           Q+PL+FYRQVLSLLQYP LL   E     S +Y+KDAI RA+++L DIG SVGAYS SQG
Sbjct: 114 QQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQG 173

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR TVA FITERDGGE AY EDIFLTAGAS+AV+YLLSILCKG++TGVLIPIPQYPL
Sbjct: 174 VYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPL 233

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTA+LALNNSH LPY+LDE +GWS NP EIE+V+  A++ NIKP VLVVINPGNPTGAVL
Sbjct: 234 YTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVL 293

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           S+E I  I  IAAKYGIVVIADEVYQEN+FDG +FHS+K +LR+LQ+  PG FDNVQLAS
Sbjct: 294 SKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLAS 353

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHSTSKGVSGECGQRGGYMEI GF +++RQVILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 354 LHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRG 413

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           +ES+ LDQ +RK+IH  L++RA  L  TFNSL+GIECQKP GAMYLFP+L LP++AIQ A
Sbjct: 414 EESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEA 473

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           +   ++PD FYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ W+ FH  F
Sbjct: 474 QRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEF 533

Query: 529 YEEY 532
            E+Y
Sbjct: 534 MEKY 537

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/488 (69%), Positives = 405/488 (82%), Gaps = 8/488 (1%)

Query: 47  VYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQH 106
           VYPA+KL + ++N+NVLKAKYAVRG+IP+ A EL   L+     LPFD +++ANIGNPQ 
Sbjct: 33  VYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQ 91

Query: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           LKQKPLTFYRQVLS+LQYP LLE        S +++KDAI RAR+LL +IGS VG+YS+S
Sbjct: 92  LKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIGS-VGSYSSS 144

Query: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226
           QGI  IR+TVA FIT+RD GE +   DIFLTAGASSAV YLLSILCK +++GVLIPIPQY
Sbjct: 145 QGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQY 204

Query: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286
           PLYTA+LALNN+H LPYYLDE  GWST+  EIE+V+N+++++ IKP+ LV+INPGNPTG+
Sbjct: 205 PLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGS 264

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           +LS E + +I  +AA +GIV+IADEVYQENVF+ A+FHSMKK+LR LQK+ PG +D VQL
Sbjct: 265 ILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQL 324

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKGVSGECGQRGGYME+TGFN +I+QVILKL SISLCPVVTGQALVDLMVSPP+
Sbjct: 325 ASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQ 384

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
            GDESYE DQ ER +I   L+ RA  L   FNS+EG+ CQKPEGAMYLFP++ LPFK +Q
Sbjct: 385 KGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQ 444

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            ++   +TPD FYCK LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI+RW  FH 
Sbjct: 445 KSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHA 504

Query: 527 AFYEEYRD 534
            FY++YRD
Sbjct: 505 EFYDKYRD 512

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/486 (67%), Positives = 400/486 (82%), Gaps = 1/486 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA KL L ++NENV+ AK+A+RG+I + A +L  +L K+PH LPFD I  ANIGNPQ L 
Sbjct: 13  PAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELN 72

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTF RQV+S+LQYP LL  N  VL   K++  D+  RA RLL DIG SVGAYS SQG
Sbjct: 73  QKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQG 131

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+T A++IT+RDGGE +Y EDIFLT GA+SA SYLLS+LC+G +TGVLIPIPQYPL
Sbjct: 132 VYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPL 191

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTA+LALN S  +PYYLDE+S WSTN TEIE +V ++I++ IKPSV+VVINPGNPTGAVL
Sbjct: 192 YTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVL 251

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           SE  I++IF IAAKYGIVV+ADEVYQEN+FDG +FHS KK+LR LQK  PG FDN+QLAS
Sbjct: 252 SELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLAS 311

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           +HSTSKGV GECGQRGGYME+ GF +++RQ++LKLA +++C VVTGQA+VDLM+ PPK G
Sbjct: 312 MHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKG 371

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           D SYELD++ER+ I +A+ ERA KL+A F+ L+GIECQKP+GAMYL+P L+L  KAI  A
Sbjct: 372 DASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKA 431

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           E   +TPD FYC +LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI +WE FHK F
Sbjct: 432 ESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHF 491

Query: 529 YEEYRD 534
           YE+Y+D
Sbjct: 492 YEKYQD 497

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/486 (69%), Positives = 404/486 (83%), Gaps = 1/486 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA+KL ++++NENVLKAKYAVRG IP  A  L  +L  +P SLPF  +++ANIGNPQ L 
Sbjct: 38  PADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLN 97

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTFYRQVLSLLQYP +L+E       + LY++DAI RA+R+LNDIGSSVG+YS+SQG
Sbjct: 98  QKPLTFYRQVLSLLQYPMVLDETFSGNTKT-LYKQDAIERAKRILNDIGSSVGSYSSSQG 156

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + G+R+TVA++I+ RDGGEKAYAEDIFLTAGASSAVSYLL+ILCKG+E+GVLIPIPQYPL
Sbjct: 157 VFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPL 216

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTA+LALNN++ LPYYL+E SGWSTN  EIE+VV+NAI + I P VLVVINPGNPTGA+L
Sbjct: 217 YTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAIL 276

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           S E I +IF +AA +GIVVIADEVYQEN+F G EFHSMKK+LR LQ+  PG ++NVQLAS
Sbjct: 277 SVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLAS 336

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHSTSKGVSGECGQRGGYME+TGF+ +I+  ILKL SISLCPVVTGQALVDLM  PPK G
Sbjct: 337 LHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKG 396

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           + SYE DQ ER +IH  L ERA  L   FN +EG+ CQKP+G+MYLFP++ +P KA++ A
Sbjct: 397 EASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKA 456

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           +   +TPD  YC +LLEATGICTVPGSGFGQ+PGT+HLRTTFLAPGT WI++W  FH+ F
Sbjct: 457 QELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIF 516

Query: 529 YEEYRD 534
             +YRD
Sbjct: 517 CNKYRD 522

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/486 (66%), Positives = 387/486 (79%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA K+   ++N +V KA+YAVRG+IP  A EL  +LKK+P  LPFD+I++ANIGNPQ L 
Sbjct: 22  PAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLD 81

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTF RQVLS+L+YP +L+ + + L    L+ KDA+ RA  LL DIG SVGAYS SQG
Sbjct: 82  QKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+TVA FIT RDGGE A  EDI+LT GASSA + LLS+LCK   TG+LIPIPQYPL
Sbjct: 142 VPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQYPL 201

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTAS +L N+  LPYYLDE+  WST   EIE VV +A+E+ I+PSVL+VINPGNPTGAVL
Sbjct: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           +EE I++I  IAAKYGI VI+DEVYQENVF+  +FHSMKK+LRKLQ   PG FDNVQLAS
Sbjct: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHS SKG  GECGQRGGYMEI GF+ DIR  + KL SIS+C VVTGQA+VDLMV+PP+PG
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           DESYE D+QER  I   +  RA  L+ TFN LEGIECQ P+GAMYLFPRL+LP KA + +
Sbjct: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W+NFH++F
Sbjct: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501

Query: 529 YEEYRD 534
           + EYRD
Sbjct: 502 FNEYRD 507

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/483 (66%), Positives = 389/483 (80%), Gaps = 2/483 (0%)

Query: 52  KLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKP 111
           K  L +VN+ VL AKYAVRG IP+ A EL  KL ++P SLPF+ I++ANIGNPQ L QKP
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 112 LTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQG 171
           LTFYRQVLSLLQ P L+E      +  KL++ DA+ RA+++L  +G SVGAYS SQG+ G
Sbjct: 99  LTFYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERAKKMLKQVGGSVGAYSASQGVAG 157

Query: 172 IRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTA 231
            R++VA+FI ERDG E A A DIFLTAGASSAVS +LS+ C G E G LIPIPQYPLYTA
Sbjct: 158 FRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTA 216

Query: 232 SLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEE 291
           +LALN++H LPYYLDE SGWS +  ++E VV +AI + ++P+ LVVINPGNPTGA+LS E
Sbjct: 217 TLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPE 276

Query: 292 DISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHS 351
            I +I  +AAKY +VVIADEVYQEN FD A+F SMKK+LR LQK+ PG +DNVQLASLHS
Sbjct: 277 AIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHS 336

Query: 352 TSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDES 411
           TSKGVSGECGQRGGYME+ GF+ +++QV LKLASISLCPVVTGQALVDLMV PPK GD S
Sbjct: 337 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDAS 396

Query: 412 YELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHE 471
           YELD+QER +IH +L +++  L+ TF SLEG+ CQKP+GAMYLFP+L L  KAI+ AE  
Sbjct: 397 YELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESL 456

Query: 472 GMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEE 531
           GM PD +YCK+LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW++ W+ FH+ F +E
Sbjct: 457 GMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDE 516

Query: 532 YRD 534
           +RD
Sbjct: 517 HRD 519

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 394/496 (79%), Gaps = 3/496 (0%)

Query: 41  SNVLGAVY-PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSA 99
           S V G  + PA KLG  ++N+N++ A+YAVRGAIPM A EL  +L + P  LPF+ I  A
Sbjct: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86

Query: 100 NIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSS 159
           NIGNPQ L QKPLTF RQV+S+LQYP LL+  EQ L+ S  Y++DA  RA  LL  IG S
Sbjct: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGS 145

Query: 160 VGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGV 219
           VGAYS +QG+ GIRE+VA FIT RD GE A  +DIFLT GAS A +YLLSILC+   TG+
Sbjct: 146 VGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGI 205

Query: 220 LIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVIN 279
           +IPIPQYPLYTAS+ + NS  LPYYLDE+SGWST   EIE  V ++I++ + P V+VVIN
Sbjct: 206 MIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVIN 265

Query: 280 PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNP- 338
           PGNPTGAVLS + I+QI  IAAKYGIVV+ADEVYQ N++ G +FHSMKK+LR LQ+ +P 
Sbjct: 266 PGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPN 325

Query: 339 GVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALV 398
           G +DNVQLAS+HSTSKGVSGECGQRGGYME+ GF+N++RQVILKLASIS+C VVTGQALV
Sbjct: 326 GEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALV 385

Query: 399 DLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRL 458
           DLM++PP+ GD+SYELD +ERK IH  +  R   L+ TF  LEGIECQ+P+GAMYLFP+L
Sbjct: 386 DLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKL 445

Query: 459 LLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI 518
           LL  KAI+ A+  G+ PD FYC +LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI
Sbjct: 446 LLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWI 505

Query: 519 ERWENFHKAFYEEYRD 534
           + WE FHKAFY++YRD
Sbjct: 506 KDWETFHKAFYDKYRD 521

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/486 (65%), Positives = 385/486 (79%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA K+   ++N  V KA+YAVRGAIP  A EL  +LK+ P  LPFD+I++ANIGNPQ L 
Sbjct: 22  PAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQLD 81

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTF RQVLS+L+YP +L      L    L++KDA+ RA  LL DIG S+GAYS SQG
Sbjct: 82  QKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHSQG 141

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR++VA+FIT+RD GE A  E+I+LT GASSA + LLS+LCK  +TG+LIPIPQYPL
Sbjct: 142 VPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQYPL 201

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTAS +L N+  LPYYLDE S WST   EIE VV +A+E+ IKPSVL+VINPGNPTGAVL
Sbjct: 202 YTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVL 261

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           SE+ I++I  IAAKYGI +I+DEVYQENVF+G +FHSMKK+LRKLQ+  PG FDNVQLAS
Sbjct: 262 SEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLAS 321

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHS SKG  GECGQRGGYME+ GF+ DIR  + KL SIS+C VVTGQA+VDLMV PP+PG
Sbjct: 322 LHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           DESY+ D  ER  I   +  RA  LH TFN LEGIECQKP+GAMYLFPRL+LP KA++ +
Sbjct: 382 DESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALRES 441

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W++FH+ F
Sbjct: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQDF 501

Query: 529 YEEYRD 534
           + +YRD
Sbjct: 502 FNKYRD 507

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/483 (66%), Positives = 388/483 (80%), Gaps = 2/483 (0%)

Query: 52  KLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKP 111
           K  L ++NE VL AKYAVRG IP+ A EL  KL ++P SLPFD I++ANIGNPQ L QKP
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 112 LTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQGIQG 171
           LTFYRQVL+LLQ P L+ +     +  K ++ DA+ RA+++L  +G SVGAYS SQG+ G
Sbjct: 98  LTFYRQVLALLQNPDLISDLSSGEL-HKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAG 156

Query: 172 IRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTA 231
            RE+VA+FI ERDG E A A+DIFLT GAS AVSY+LS+ C G E G LIPIPQYPLYTA
Sbjct: 157 FRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTA 215

Query: 232 SLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEE 291
           SLALNNSH LPYYLDE+SGWS +  +IE VV ++I++ I+P+ LVVINPGNPTGA+L+ +
Sbjct: 216 SLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTD 275

Query: 292 DISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHS 351
            I  +  +AAKY +V+IADEVYQEN F+ AEF SMKK+LR LQK+ PG +DNVQLASLHS
Sbjct: 276 TIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHS 335

Query: 352 TSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDES 411
           TSKGVSGECGQRGGYME+ GF+ +++QV LKLASISLCPVVTGQAL+DLMV PPK GD S
Sbjct: 336 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDAS 395

Query: 412 YELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSAEHE 471
           YE D+QER  IH+AL +R+G L+  F S+EG+ CQ+P+GAMYLFP+L L  KAI  AE  
Sbjct: 396 YEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESA 455

Query: 472 GMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAFYEE 531
           G+ PD +YCK+LLEATGICTVPGSGFGQ PGT+HLRTTFLAPGTEWI+ W+ FH+ F E+
Sbjct: 456 GLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTED 515

Query: 532 YRD 534
           +RD
Sbjct: 516 HRD 518

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/486 (65%), Positives = 381/486 (78%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA K+   ++N  V KA+YAVRGAIP  A EL  +LKK+P  LPFD+I++ANIGNPQ L 
Sbjct: 22  PAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLD 81

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTF RQVL++L+YP +L      L    L+ +DA+ RA RLLNDIG S+GAYS SQG
Sbjct: 82  QKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQG 141

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+TVA FIT RDGGE A  EDI+LT GASSA + LLS+LCK  +TG+LIPIPQYPL
Sbjct: 142 VPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPL 201

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTAS +L N+  LPYYLDE+S WSTN  EIE VV +A+++ I+PSVL+VINPGNPTGAVL
Sbjct: 202 YTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVL 261

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           SEE I++I  IAAKYGI +I+DEVYQEN+F+  +FHSMKK+LRKLQ   PG FDNVQLAS
Sbjct: 262 SEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLAS 321

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHS SKG   ECGQRGGYMEI GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP+PG
Sbjct: 322 LHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           DESYE D  ER  I   +  RA  L+ TF  LEGIECQKP+GAMYLFPRL+LP KA+  +
Sbjct: 382 DESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCES 441

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ W+ FH+ F
Sbjct: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDF 501

Query: 529 YEEYRD 534
           + +YR+
Sbjct: 502 FSKYRN 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/487 (66%), Positives = 389/487 (79%), Gaps = 4/487 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKL--KKDPHSLPFDNIVSANIGNPQH 106
           PA+K+ L ++N+NVLK++YAVRG+IP  A EL  +L       SL F+NIV ANIGNPQ 
Sbjct: 30  PAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQ 89

Query: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           L QKPLTF RQV+S+LQYP LL +   +L+ + +++ DA+ RA  LL  IG SVGAYS+S
Sbjct: 90  LDQKPLTFSRQVISILQYPELLNQ-RNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSS 148

Query: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226
           QG+ GIRETVA +IT RD GE A  +DIFLT GAS A SYLLS+LCK + TGVLIPIPQY
Sbjct: 149 QGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQY 208

Query: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286
           PLYTA++ L ++  LPYYL+E+SGWSTN  EIE VV +AI  N+KPSV+VVINPGNPTG+
Sbjct: 209 PLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGS 268

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           VLS++DI  I  I AKYGIV+IADEVYQEN+FDG EFHSMKK+LR LQK  PG +D VQL
Sbjct: 269 VLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQL 327

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKGVSGECGQRGGYME+ GF ++IRQ ILKLASISLC V+TGQALVDLMV+PPK
Sbjct: 328 ASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPK 387

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
            GDESYELD  ERK+IHE L ERA KL+  F  L+G+ECQKP+GAMYLFP+L  P   I 
Sbjct: 388 KGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLIT 447

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            A ++ M+PD FYC  LLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W E+W+ FH+
Sbjct: 448 EAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHE 507

Query: 527 AFYEEYR 533
            F+ +Y+
Sbjct: 508 EFFSKYQ 514

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 394/487 (80%), Gaps = 4/487 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKL--KKDPHSLPFDNIVSANIGNPQH 106
           PA K+ ++++N+ ++ A+YAVRG+I M A EL  +L  K  PHS PF+ I+ ANIGNPQ 
Sbjct: 26  PAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQQ 85

Query: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           L QKPLTF RQV+S+L+YPGLL+  + VL+   +Y+KDA+ RA  L + IG+SVGAYS +
Sbjct: 86  LDQKPLTFSRQVMSILEYPGLLKFKD-VLLSQGIYKKDALERAELLQSQIGASVGAYSLA 144

Query: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226
           QG+ GIRET A+FI++RD  E A A+DIFLT GAS AV+YL+  LC+ + TG+LIPIPQY
Sbjct: 145 QGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQY 204

Query: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286
           PLYTAS+ ++N+  LPYYLDE+SGWST   EIE+ V NAIE  IKPS +VVINPGNPTGA
Sbjct: 205 PLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGA 264

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           VLS + I +I  +AAKYGIV+IADEVYQ+N+F+G EFHSMKKILR+LQK  PG +DNVQL
Sbjct: 265 VLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQL 323

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKGVSGECGQRGGYMEI GF++++R ++LKLASI++C VVTGQALVDLMV PP 
Sbjct: 324 ASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPH 383

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
            GDESYE DQ+ER  IH  L +RA KL+ TF++LEGIECQKP+GAMYLFPRL+LP +AI+
Sbjct: 384 VGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIE 443

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            A+   M  D FYC KLLE TGICTVPGSGFGQ  GTYH+RTTFL+PGTEWI+ W+ FH+
Sbjct: 444 EAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHE 503

Query: 527 AFYEEYR 533
            F +EY+
Sbjct: 504 KFMKEYQ 510

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/486 (64%), Positives = 390/486 (80%), Gaps = 2/486 (0%)

Query: 48  YPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHL 107
           Y AE+L   ++N NV+KAKYAVRGAIP  A +L  +L K P +LPF++++++NIGNPQ L
Sbjct: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138

Query: 108 KQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167
            QKPL+F RQVLS+L+YP LL+ +E+ L+DS  Y  D+I RA+ LL DIGS +GAYS SQ
Sbjct: 139 GQKPLSFGRQVLSILEYPALLD-HERTLVDSMGYAPDSIERAKTLLTDIGS-IGAYSNSQ 196

Query: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227
           G+ GIR+TVA FIT RD GE AY +DIFLTAGASSAVS +LSILCKGQ+TGVLIPIPQYP
Sbjct: 197 GVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYP 256

Query: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAV 287
           LYTA+L LN++  LPYYLDE +GWST+  EI  V  +++E  IKP+ LVVINPGNPTG+V
Sbjct: 257 LYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSV 316

Query: 288 LSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA 347
           L+ E I  +F +AAKYG+VVIADEVYQ+N+F G+EFHSMKKILR LQK  P  +DN+QLA
Sbjct: 317 LTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLA 376

Query: 348 SLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKP 407
           SLHS SKG+ GECG RGGY E  GF  +++QVI KL+SISLC  V GQALVDLM  PPK 
Sbjct: 377 SLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKK 436

Query: 408 GDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQS 467
           G+ SYELDQ ER++I     +R+ KL+  FNSLEG+ CQKP+GAMY+FP + LPF AI+ 
Sbjct: 437 GEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKM 496

Query: 468 AEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKA 527
           A++  +TPD FYC++LL+ATGICTVPGSGFGQ+PGTYH+RTTFLAPG EW++RWE FH  
Sbjct: 497 AQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIE 556

Query: 528 FYEEYR 533
           F+E+YR
Sbjct: 557 FFEKYR 562

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/486 (64%), Positives = 383/486 (78%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA KL   ++N +V KA+YAVRGAIP  A EL  +LK+  +SLPF++I++ANIGNPQ L 
Sbjct: 22  PAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLD 81

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTF RQVLS+L+YP +L  +   L    L+ KDA+ RA+RLL+DIG SVGAYS SQG
Sbjct: 82  QKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           + GIR+TVA FITERDGGE A  EDI+LT GASSA + LLS+LCK  +TG+L+PIPQYPL
Sbjct: 142 VPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQYPL 201

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTAS +L N+  LPYYLDE++ WST   EIE VV +A+++ I+PSVLVVINPGNPTGAVL
Sbjct: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           +E  I++I  IAAKYGI +I+DEVYQEN+F   +FHSMKKILRKLQ  +PG FDNVQLAS
Sbjct: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHS SKG  GECGQRGGYMEI GF+ DIR  + KL SIS+C V TGQA++DLMV PP+PG
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           DESY+ D++ER  I+  +  RA  L+ TFN LEGI+CQKP+GAMYLFP+L LP KA++ +
Sbjct: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           E   + PD  YC  LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI+ W  FH+ F
Sbjct: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501

Query: 529 YEEYRD 534
           + +YRD
Sbjct: 502 FNKYRD 507

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/502 (62%), Positives = 392/502 (78%), Gaps = 5/502 (0%)

Query: 33  LHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLP 92
           L  I S  S +     P + L L ++N NVL+AKYAVRG IP  A EL  +L +DP SLP
Sbjct: 38  LRSISSGTSRI--RFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLP 95

Query: 93  FDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRL 152
           F  I+ ANIGNPQ L QKPL+F R+VLSLL+ P LL+   +VL  + +Y+ DA+ RA+R+
Sbjct: 96  FKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKRM 153

Query: 153 LNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILC 212
           + D+ +S+GAYS SQG+ G R+TVA++++ RDG E A AEDIFLT GAS+  S ++ +LC
Sbjct: 154 MRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLC 212

Query: 213 KGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKP 272
           KGQE+GVLIPIPQYPLYTA++ LNN+  LPYYLDE+SGWS N  ++E ++  +IE+ +KP
Sbjct: 213 KGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKP 272

Query: 273 SVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRK 332
           + LVVINPGNPTGA+L  E + +IF IAAKY IVVIADEVYQENVF+G +F+SMKK+LR 
Sbjct: 273 ACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRS 332

Query: 333 LQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVV 392
           LQ+    +F NVQL SLHSTSKG+SGECGQRGGYME+ GF++DIR+VILK+ASI LC  V
Sbjct: 333 LQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPV 392

Query: 393 TGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAM 452
            GQALVDLM+S PKPGDESYE D  ER SI  AL ER+  L  TFN+LEG+EC+KP+G+M
Sbjct: 393 GGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSM 452

Query: 453 YLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLA 512
           YLFPRL+LP KAI++AE   M PD FYC +LL +TGICTVPGSGFGQ P T HLRTTFL 
Sbjct: 453 YLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLC 512

Query: 513 PGTEWIERWENFHKAFYEEYRD 534
           PGTEWIE WE FHK+FY++YRD
Sbjct: 513 PGTEWIESWELFHKSFYDKYRD 534

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/486 (63%), Positives = 380/486 (78%), Gaps = 2/486 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA KL + ++N NV+KA++AVRG IPM A EL  +L K+PHSLPF+ I  ANIGNPQ L 
Sbjct: 15  PAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQELH 74

Query: 109 QKPLTFYRQVLSLLQYPGLL-EENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQ 167
           QKPLTF RQV+S+LQYP LL   NE       +Y  D+  RA +LLN+IG SVGAYS SQ
Sbjct: 75  QKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSASQ 134

Query: 168 GIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP 227
           G+ GIR+T+A +IT+RD GE A   DIF+T GA++A SYLLSIL  G +TGVL+PIPQYP
Sbjct: 135 GVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQYP 194

Query: 228 LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVN-NAIEQNIKPSVLVVINPGNPTGA 286
           LYTA LAL+N+  LPYYL+E+SGWS +  EIE  +  NA+ + I+P V+V+INPGNPTG+
Sbjct: 195 LYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTGS 254

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           +LSE+ + +IF IAAKYGIV+IADEVYQEN+F+G +FHS KK+LR LQK  P  ++NVQL
Sbjct: 255 ILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQL 314

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKG+ GECGQRGGYMEI GFNND+R +ILKLA I +CPVVTGQA++DLM+ PPK
Sbjct: 315 ASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPPK 374

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
            GD+SY+LD  ER+ IH  +  RA KL+  F+ +EGI+CQKP+GAMYLFPRLLL  K I 
Sbjct: 375 QGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVID 434

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            A+   M PD FYC +LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI +WE FHK
Sbjct: 435 EAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFHK 494

Query: 527 AFYEEY 532
           AF + Y
Sbjct: 495 AFLKRY 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 383/487 (78%), Gaps = 3/487 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PAEKL ++++N++ + A YAVRG+IPM A +L+A++  DP SLPFD I++ANIGNPQ + 
Sbjct: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64

Query: 109 QKPLTFYRQVLSLLQYPGLLEENE--QVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           QKPLTF RQVLS+L+YP +L + E  + L+   +YQ+D I RAR++L+ IG SVGAYS S
Sbjct: 65  QKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSAS 124

Query: 167 QGIQGIRETVAQFITERDGGEK-AYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQ 225
           QG+ G R+TVA FI +RDG ++ A   DIFLT GASSAV YLLSILC G E GVLIPIPQ
Sbjct: 125 QGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQ 184

Query: 226 YPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTG 285
           YPLYTA+L L+NS  +PYYL E + WSTN  EIE  +  ++   +KP  +V+INPGNPTG
Sbjct: 185 YPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244

Query: 286 AVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQ 345
           A+LSE D++ I  I+AKYGI +IADEVYQEN+F G EFHSM+K+L  LQ   PG +DNVQ
Sbjct: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304

Query: 346 LASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPP 405
           LASLHSTSKG  GECGQRGGYME+ GF +++  ++LKLASIS+C VVTGQAL+DL+  PP
Sbjct: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364

Query: 406 KPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAI 465
           +PGD SY+LDQ+ER  I + L  RA +L+  F SLEG+ECQ+P+GAMYLFP+L+LP KAI
Sbjct: 365 QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAI 424

Query: 466 QSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFH 525
           + A    + PD +YC++LL+ATGICTVPGSGFGQ+PGTYHLRTTFL PGTEWIERW  FH
Sbjct: 425 EKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFH 484

Query: 526 KAFYEEY 532
           + FYE +
Sbjct: 485 QQFYERF 491

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/487 (59%), Positives = 373/487 (76%), Gaps = 2/487 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           P  K+ L ++N  ++K +YAVRG IP  A EL  +L+KDP SLPF+ I++ANIGNPQ L 
Sbjct: 11  PVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLG 70

Query: 109 QKPLTFYRQVLSLLQYPGLLEENE--QVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166
           QKPL+F R+VLS+LQYP +LE+    Q LI+ ++YQKD + RAR+LL +IG SVGAYS S
Sbjct: 71  QKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLS 130

Query: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226
           QG+ GI++TVA +IT+RD GE AY EDIFLT GASSAVS++L + C G  TGVLIPIPQY
Sbjct: 131 QGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQY 190

Query: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286
           PLYTA++ L  +  + YYL+E+  WS N  E+E+ +  +I+  IKP+ +V+INPGNPTG+
Sbjct: 191 PLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGS 250

Query: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346
           +L+E+DI+ I  I+AKYG+++IADEVYQENVF G EFHS+KK+LRKLQ+   G ++ VQL
Sbjct: 251 ILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQL 310

Query: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406
           ASLHSTSKG+ GECGQRGGYME+ G  +D+R  ++KL SIS+C VVTGQAL+D++VSPP+
Sbjct: 311 ASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPR 370

Query: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466
           PGDESYE+DQ ER +I   L  R+ KLH  F SLEG+EC +P+GAMYLFP+ + P K I 
Sbjct: 371 PGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFID 430

Query: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526
            A+      D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W  FH 
Sbjct: 431 IAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHT 490

Query: 527 AFYEEYR 533
            F E YR
Sbjct: 491 EFCERYR 497

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/486 (63%), Positives = 378/486 (77%), Gaps = 3/486 (0%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PAE + L++VNENV+KAKYAVRG IP  A EL  +L++ P SLPF  I+ ANIGNPQ L 
Sbjct: 39  PAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLG 98

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           QKPLTFYRQV+SL+Q P LLE   + L   + ++ D + RARR+L D G SVGAYS SQG
Sbjct: 99  QKPLTFYRQVISLMQNPQLLEMPAEWL--QQAFKADVVVRARRMLQDAGGSVGAYSASQG 156

Query: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228
           ++G R TVAQFI  RDG   A  ++++LTAGASSAVS LLS  CKG ETGVLIPIPQYPL
Sbjct: 157 VKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPL 215

Query: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288
           YTA++  NN+  LPYYL+E  GWSTNP E+E V+ ++ ++NI P  LVVINPGNPTG+VL
Sbjct: 216 YTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVL 275

Query: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348
           S +D+  I  +AAKYGIVVIADEVYQ+NVF  A+FHSM+K+L+ LQ   P ++ NVQLAS
Sbjct: 276 SVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLAS 335

Query: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408
           LHS SKG+SGECGQRGGYME+ GF  ++R+V +KLASISLCPVVTGQALVDLMV PP  G
Sbjct: 336 LHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQG 395

Query: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468
           D SYE   QE +SI+  L ER+  L  TF SLEGIEC  P+GA+YLFP+L LP KAI++A
Sbjct: 396 DPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAA 455

Query: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528
           +  G+  D  YC +LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WIE W++FHK F
Sbjct: 456 QKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKF 515

Query: 529 YEEYRD 534
           Y++YRD
Sbjct: 516 YDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/492 (60%), Positives = 376/492 (76%), Gaps = 8/492 (1%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA K  L+++NE++LKA+YA+RG IP  A EL+ +L ++  SLPF  IV ANIGNPQ L 
Sbjct: 10  PAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLD 69

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           Q+PLTF RQV+SL+Q+P LL+  + +L+  K+Y KD+I RA +LLN IG SVGAYS+SQG
Sbjct: 70  QQPLTFQRQVMSLVQFPDLLKSKD-ILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQG 128

Query: 169 IQGIRETVAQFITERDGGEKAY-------AEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
           +  IR+ VA+FI +RD             A ++FLTAGAS+AV ++L +  K +  GVL+
Sbjct: 129 VLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLL 188

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG 281
           PIPQYPLYTA++ L  S  LPYYL+E + WST+P +IE +V +AI+QNIKP+ LVVINPG
Sbjct: 189 PIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPG 248

Query: 282 NPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVF 341
           NPTGA+L+++ I  I  IAA+YGIV+IADEVYQENV++  EFHS KK+L +L+K+ P  +
Sbjct: 249 NPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKY 308

Query: 342 DNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLM 401
           DNVQLASLHS SKGV+GECGQRGGYMEITGF+ND+++V+LK+ASIS+C VVTGQ LVDLM
Sbjct: 309 DNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLM 368

Query: 402 VSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLP 461
           V+PP+PGDESYELDQ ER  IH  L  ++  L+  F  L GI CQKP+GAMYLFPRL L 
Sbjct: 369 VNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLS 428

Query: 462 FKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERW 521
             AI +A    + PD FYC KLLE TGICTVPGSGFGQ PGTYHLRTTFL PG EWI  W
Sbjct: 429 ENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSW 488

Query: 522 ENFHKAFYEEYR 533
           E FH  F E+Y+
Sbjct: 489 EKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 361/494 (73%), Gaps = 10/494 (2%)

Query: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108
           PA K  L+++++++L  +YA+RG IP  A EL  +L   P+ LPF  I+ ANIGNPQ L+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168
           Q+PLTF RQVLSL++YP L+  ++ +L+++K+Y  DAI RA  +LN IG SVGAYS+SQG
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQG 126

Query: 169 IQGIRETVAQFITERDGGE---------KAYAEDIFLTAGASSAVSYLLSILCKGQETGV 219
           I  IR+ VA+ I +RD  E            A +IFLT GA++AVSY+L +  K +  GV
Sbjct: 127 ILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGV 186

Query: 220 LIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVIN 279
           L+PIPQYPLYTA++ L NS  LPYYL+E   WST+P EIE ++ +AI +NIKP+ LV+IN
Sbjct: 187 LLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIIN 246

Query: 280 PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPG 339
           PGNPTGA+LS E I+QI  IAAKYGIV+IADEVYQ N++   +FHS KKIL  L+   P 
Sbjct: 247 PGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK 306

Query: 340 VFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVD 399
            +DNVQLASLHS SKGV+GECGQRGGY E+ GF+++I+++ILKLASI +C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 400 LMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLL 459
           LM  PP+ GD SY+LDQ+ER +I   L  ++  L+  F+ L GI CQKP+GAMYLFPRL 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 460 LPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIE 519
           L    I  A+   + PD FYC KLLE TGICTVPGSGFGQ+ GTYH+RTTFL  G EWI+
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 520 RWENFHKAFYEEYR 533
            WE FH  F  +Y+
Sbjct: 487 LWEKFHLEFMNQYK 500

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 10/128 (7%)

Query: 190 YAE-DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYP--LYTASLALNNSHPLPYYLD 246
           YA+ D+  TAG ++A    L + C   +T +L     +   LY A     N  P+P  LD
Sbjct: 131 YADWDVLATAGNTNAWESTLRVFCNRGDT-ILAEAYSFSSSLYAAEAQGVNVFPVP--LD 187

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGI 305
           E   +   P ++E +++N   +  KP +L  I  G NPTG+ LS++  ++I+ IA K+  
Sbjct: 188 E---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNF 244

Query: 306 VVIADEVY 313
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 88/183 (48%), Gaps = 14/183 (7%)

Query: 143 KDAIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASS 202
           K AI  A++ + DI   V  YS ++G   + E++ +  +     E   AE++ +T GA+ 
Sbjct: 69  KFAITEAKKAV-DI-PLVNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANE 125

Query: 203 AV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPT 256
            + S L+ IL  G E  V  P     IP   L    +     +P P  +D++    T  T
Sbjct: 126 GILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINP-PKDMDQRVVKGTEWT 184

Query: 257 EIEDVVNNAIEQNIKPSVLVVIN-PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQE 315
              +   NAI    K    V+IN P NP G V + E++++I  I  K  +V+I+DEVY+ 
Sbjct: 185 VDYEQFANAITDKTKA---VIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEH 241

Query: 316 NVF 318
             F
Sbjct: 242 LYF 244

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 143/327 (43%), Gaps = 41/327 (12%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALN----NSHPLPYYLDEK 248
           D+  T G + A   +L I C   +T   I   Q+   ++  A      N  P+P  LDE 
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQFAFSSSISAAEAQGVNVFPIP--LDEH 188

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVV 307
                 P+++E +++N  E   KP +L  +  G NPTG+ LS +   +I+ IA K+  ++
Sbjct: 189 G---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFII 245

Query: 308 IADEVYQENVFDGAE----------FHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVS 357
           I DE Y     +  E          +   K+ ++ L+KS   +    ++  L S SK ++
Sbjct: 246 IEDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA 305

Query: 358 GECGQRGGYMEITGFNNDIRQVILKLASISL-CPVVTGQALVDLMVSPPKPGDESYELDQ 416
              G R G+  I G   DI   IL L  +++  P    Q+++   ++  + G E Y LD 
Sbjct: 306 --PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGY-LDW 357

Query: 417 QERKSIHEALAERAGKLHATFNSLEGIECQK--PEGAMYLFPRLLLPFKAIQSAEHEGMT 474
                 HE   +R   + A +  L  ++  K  P  A   F   +   K  + A   G  
Sbjct: 358 LIGLR-HEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFATKYGSD 416

Query: 475 PD----AFYCKKLLEATGICTVPGSGF 497
           P+    A + + +  A+G+  VPG+ F
Sbjct: 417 PEKVEKAIFDRSI--ASGVLVVPGNWF 441

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 18/142 (12%)

Query: 192 EDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYYL 245
           E++ +T GA+  + + L+ IL +  E  V  P     IP   L    +     +P P  L
Sbjct: 115 ENVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKDL 173

Query: 246 DEK----SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAA 301
           D++    + W+ +  + E+V+ N      K   +++  P NP G V + E++ +I  I  
Sbjct: 174 DKRVTKGTEWTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICV 227

Query: 302 KYGIVVIADEVYQENVFDGAEF 323
           K+ +++I+DEVY +N++   EF
Sbjct: 228 KHNVIIISDEVY-DNLYFVDEF 248

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 68/138 (49%), Gaps = 17/138 (12%)

Query: 191 AEDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYY 244
           AE++ +T GA+  + S L+ +L  G E  V  P     IP   L    +     +P P  
Sbjct: 131 AENVTVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKE 189

Query: 245 LDEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300
           LD+++     W+ +  + E+ + +      K   +++  P NP G V + E+++ +  I 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 301 AKYGIVVIADEVYQENVF 318
            K+ +V+I+DEVY+   F
Sbjct: 244 VKHNVVIISDEVYEHLFF 261

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
            Y   QG   +R+ +A+  +  D       E++ LT GA +A ++L      G+    + 
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFIC 110

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPS--VLVVIN 279
             P Y   ++   +  +     +L +++ +  N  E+E +        IKP+   +V+  
Sbjct: 111 ISPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNT 162

Query: 280 PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPG 339
           P NP  +V+  E + +I  +A K+GIVV  DEVY         FHS +K     Q S  G
Sbjct: 163 PNNPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEKPKSLCQLSANG 216

Query: 340 V 340
           +
Sbjct: 217 I 217

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 17/138 (12%)

Query: 191 AEDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYY 244
           AE++ +T GA+  + S L+ +L  G E  V  P     IP   L    +     +P P  
Sbjct: 115 AENVVVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKE 173

Query: 245 LDEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300
           LD+++     W+ +  + E  + +      K   +++  P NP G V + ++++ +  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 301 AKYGIVVIADEVYQENVF 318
            K+ +V+I+DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 17/138 (12%)

Query: 191 AEDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYY 244
           AE++ +T GA+  + S L+ +L  G E  V  P     IP   L    +     +P P  
Sbjct: 115 AENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKE 173

Query: 245 LDEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300
           LD+++     W+ +  + E  + +      K   +++  P NP G V + E+++ +  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 301 AKYGIVVIADEVYQENVF 318
            K+ +V+I+DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 23/173 (13%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV-SYLLSILCKGQETGVLI 221
           YS ++G   + + +A   T    G++  A++I +  GA+ A+ S L+ +L KG E  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVL------ 275
           P     +    LA      +P            P E++D V    E  I   +L      
Sbjct: 136 PFFDQYISNIELAGGVVRYVPI---------NPPRELDDRVTRGTEWEIDWDILEKTINS 186

Query: 276 ----VVIN-PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEF 323
               V+IN P NP G V + E++ ++  I     IV+I+DEVY E+++   EF
Sbjct: 187 RTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEF 238

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 63/144 (43%), Gaps = 13/144 (9%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+  TAG ++A    L + C   +  +L     +    A+         P  +D+K    
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPIDDKG--- 188

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++E +++N      KP +L  I  G NPTG  L++E   +IF IA K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 312 VYQENVFDGAEFHSMKKILRKLQK 335
            Y         F  M K  R LQK
Sbjct: 249 PYY--------FLQMDKYERDLQK 264

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 88/182 (48%), Gaps = 16/182 (8%)

Query: 145 AIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV 204
           AI  A++ L DI   V  YS ++G   +   + +  T   G E    E++ +T GA+  +
Sbjct: 73  AIKEAQKAL-DI-PLVNQYSPTRGRVSLLNALIKQYTPIYGSELK-QENVTITTGANEGI 129

Query: 205 -SYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH----PL--PYYLDEKSGWSTNPTE 257
            S L+ +L  G E  V++  P +  Y +++ L        P+  P  LD++    T  T 
Sbjct: 130 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTV 187

Query: 258 IEDVVNNAIEQNIKPSVLVVIN-PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQEN 316
             +   NAI    K    V+IN P NP G V + E++ QI  I  +  +++I+DEVY+  
Sbjct: 188 DMEQFKNAITSKTKA---VIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHL 244

Query: 317 VF 318
            F
Sbjct: 245 YF 246

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 129/321 (40%), Gaps = 45/321 (14%)

Query: 192 EDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYYL 245
           E++ +T GA+  + S L+ I+  G E  V  P     IP   L    +     +P P  L
Sbjct: 116 ENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-PKEL 174

Query: 246 DEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGI 305
           D +    T  T   D    AI    K   +++  P NP G V + E+++++  I  +  +
Sbjct: 175 DNRVTKGTEWTVDFDEFTRAITPKTK--AVIINTPHNPIGKVFTREELTKLGNICVENNV 232

Query: 306 VVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLA-SLHSTSKGVSGECGQRG 364
           ++IADEVY E+++   EF  +  +  ++           QL  S+ S  K  +   G R 
Sbjct: 233 IIIADEVY-EHLYFVDEFPRIATLSEEIG----------QLTLSVGSAGKSFAA-TGWRI 280

Query: 365 GYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDE--SYELDQQERKSI 422
           G+  +   N D+ Q   K A   +C             + P P  E  SY +D   +   
Sbjct: 281 GW--VVSQNPDLLQYASK-AHTRIC------------FASPSPIQEACSYSIDHALKIDY 325

Query: 423 HEALAERAGKLHATFNSLE---GIECQKPEGAMYL---FPRLLLPFKAIQSAEHEGMTPD 476
            E + +   K    F S+    G+    PEG+ ++   F ++ +P       E      D
Sbjct: 326 FENMRQEYVKKFKIFTSVFDELGLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKD 385

Query: 477 AFYCKKLLEATGICTVPGSGF 497
                 L+   G+  +P + F
Sbjct: 386 FRISNWLINELGVVAIPPTEF 406

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           DI LT G ++     L + C   +  +L     +    AS         P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHG--- 187

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++E++++N      KP +L  I  G NPTG  L++E   +I+ IA K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 312 VY 313
            Y
Sbjct: 248 PY 249

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 147/371 (39%), Gaps = 55/371 (14%)

Query: 145 AIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV 204
           AIA A+R L +  ++   Y+ ++G   + E + +      G     AE++ +T GA+  +
Sbjct: 87  AIAGAQRALENAMNN--QYAPTRGRPALVEALLKLYRPMYG--DLAAENVQVTTGANEGI 142

Query: 205 SYLLSILCK-GQETGVLIP-----IPQYPLYTASLALNNSHP---LPYYLDEKSGWSTNP 255
              L+ L   G E  V  P     IP   L    +      P   L   + E + W  + 
Sbjct: 143 FACLAGLVNPGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDY 202

Query: 256 TEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQE 315
             +   +N       K   +++ +P NP G V + E++ ++  I  + GI +I+DEVY E
Sbjct: 203 DMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVY-E 255

Query: 316 NVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNND 375
           +++   EF  +  +  ++              S H+ + G +G+     G+    G+   
Sbjct: 256 HLYFTDEFTRIATLSEEI--------------SQHTLTVGSAGKSFAATGWR--IGWVIS 299

Query: 376 IRQVILKLASISLCPVVTGQALVDLMVSPPKPGDES------YELDQQERKSIHEALAER 429
             + +L LAS         +A V +  S P P  E+      + L          A  ++
Sbjct: 300 RNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKK 350

Query: 430 AGKLHATFNSLEGIECQKPEGAMYL---FPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEA 486
             +    F+ L G+   + EG+ +L   F RL LP       E      D      L+  
Sbjct: 351 YERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVAYWLINE 409

Query: 487 TGICTVPGSGF 497
            G+  +P S F
Sbjct: 410 LGLVAIPCSSF 420

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 84/169 (49%), Gaps = 12/169 (7%)

Query: 160 VGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV-SYLLSILCKGQETG 218
           V  YS ++G   +  ++ +  +   G E    E+I +T GA+  + S L+ +L  G E  
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYGKELK-QENITITTGANEGILSCLMGLLNAGDE-- 145

Query: 219 VLIPIPQYPLYTASLALNNSHPL------PYYLDEKSGWSTNPTEIEDVVNNAIEQNIKP 272
           V++  P +  Y +++ L     +      P  LD++    T  T   +   NAI    K 
Sbjct: 146 VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITPKTK- 204

Query: 273 SVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGA 321
             ++V +P NP G V ++E+++++  I  +  +++I+DEVY+   F+ +
Sbjct: 205 -AVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFNDS 252

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 17/137 (12%)

Query: 192 EDIFLTAGASSAV-SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYYL 245
           +++ +T GA+  + S L+ IL  G E  V  P     IP   L    +     HP P  +
Sbjct: 105 QNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHP-PKEM 163

Query: 246 DEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAA 301
             ++     W  +   +E   NN      K   +++  P NP G V +E++++++  +  
Sbjct: 164 KTRNTTGDEWQIDWDALEKTFNN------KTKAVIINTPHNPIGKVFTEQELTKLAQLCV 217

Query: 302 KYGIVVIADEVYQENVF 318
           ++  VVI+DEVY+   F
Sbjct: 218 EHNTVVISDEVYEHLYF 234

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 83/180 (46%), Gaps = 25/180 (13%)

Query: 185 GGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH----P 240
           G E    +++ L  G+   +  L+   C+ +   +L   P Y +Y+    +N+      P
Sbjct: 78  GIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECP 137

Query: 241 LPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIA 300
           L   + E + +  N  E+   + N    + K  +L + +PGNPTG +++++DI   F + 
Sbjct: 138 L---ITEDNSFQMNVPEVLSTLKN----DPKIKLLFITSPGNPTGKLVNKKDIE--FILE 188

Query: 301 AKYGIVVIADEVYQENVFDGAE--FHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSG 358
                +V+ DE Y +  F  AE   +SM K++ K        + N+ +    S S G++G
Sbjct: 189 NWTNGLVVVDEAYID--FADAEGTTYSMAKLVTK--------YPNLTVLQTLSKSFGLAG 238

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 70/159 (44%), Gaps = 23/159 (14%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY----PLYTASLALNNSHPLPYYLDEK 248
           D+  T G + +    L I C   +T   I   +Y     +Y A     N  P+P   D  
Sbjct: 135 DVLATIGNTGSWESTLRIFCNRGDT---ILAEKYTFSSSVYAAEAQGVNVFPVPLDAD-- 189

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVV 307
                 P  +E +++N   +  KP +L  I  G NPTG+ LS++   +I+ IA K+  ++
Sbjct: 190 ---GLIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFII 246

Query: 308 IADEVY---QENVFD-------GAEFHSMKKILRKLQKS 336
           I DE Y   Q + ++         EF S  + +  L KS
Sbjct: 247 IEDEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKS 285

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 83/190 (43%), Gaps = 25/190 (13%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY----PLYTASLALNNSHPLPYYLDEK 248
           ++  T G + +    L I C   +T   I   QY     +Y A     N  P+P   D  
Sbjct: 135 NVLATTGNTGSWESTLRIFCNRGDT---ILAEQYTFSSSVYAAEAQGINVFPVPLDAD-- 189

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVV 307
                 P  +E +++N      KP +L  I  G NPTG+ LS++   +I+ IA K+ +++
Sbjct: 190 ---GLIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLI 246

Query: 308 IADE--------VYQENVFDGAEFH--SMKKILRKLQKSNPGVFDNVQLASLHSTSKGVS 357
           I DE         YQ++V    E H  S +  +  L KS   +    ++  L S SK + 
Sbjct: 247 IEDEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG 306

Query: 358 GECGQRGGYM 367
              G R G++
Sbjct: 307 --PGTRLGWI 314

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 87/178 (48%), Gaps = 13/178 (7%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV-SYLLSILCKGQETGVLI 221
           YS ++G   + +++  F +     E     ++ +T GA+  + + L+ +L  G E  V++
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPI-YNETLNESNVTITTGANEGILASLVGLLNPGDE--VIV 144

Query: 222 PIPQYPLYTASLALNNSH----PL--PYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVL 275
             P +  Y +++ +        PL  P  L E+           D++N  I +  K   +
Sbjct: 145 FEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTK--CI 202

Query: 276 VVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKL 333
           ++  P NP G V + E+++Q+  I  K  I +I+DEVY E+++ G EF  +  I +++
Sbjct: 203 ILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKEI 259

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH---PLPYYLDEKS 249
           ++ +TAG +SA    L I C   +T     + +   +++SL+   +      P  +D+K 
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 250 GWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVI 308
                P ++  +++N   +  KP +L  I  G NPTG+ L  E  SQ++ IA K+  +++
Sbjct: 188 ---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIV 244

Query: 309 ADEVY 313
            DE Y
Sbjct: 245 EDEPY 249

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 77/165 (46%), Gaps = 18/165 (10%)

Query: 160 VGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV-SYLLSILCKGQETG 218
           V  YS ++G   +  ++ +  +   G E    E++ +T GA+  + S L+ IL  G E  
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 219 VLIP-----IPQYPLYTASLALNNSHPLPYYLDEK----SGWSTNPTEIEDVVNNAIEQN 269
           V  P     IP   L    +     +P P  +D++      W+ +  E+     +     
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINP-PKDMDQRIVEGKDWTIDYEELAKAFTS----- 204

Query: 270 IKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
            K   L++  P NP G V ++E++++I  +  +  +V+I+DEVY+
Sbjct: 205 -KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYE 248

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 12/155 (7%)

Query: 163 YSTSQGIQGIRETVAQFITERDG--GEKAYAE-DIFLTAGASSAVSYLLSILCKGQETGV 219
           Y  +QG    +  + +F+ E +    E  Y++ D  LT G ++     L I C   +  +
Sbjct: 103 YGATQG----QPEILEFLREHNKLVHEFNYSDWDSILTTGNTNGWESTLRIFCNKGDV-I 157

Query: 220 LIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVIN 279
           L     +    AS         P  +D        P ++E +++N    + KP +L  I 
Sbjct: 158 LAEAHSFSSSLASAEAQGVITFPVPIDSDG---IIPEKLESILDNWTPGSPKPKLLYTIP 214

Query: 280 PG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
            G NPTG+ LS+E    I+ IA K+  ++I DE Y
Sbjct: 215 TGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 11/125 (8%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH---PLPYYLDEKS 249
           D+  T G ++A    L + C   + G +I + +   +++ LA   +      P  +DE  
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 250 GWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVI 308
                P ++E +++N  E   KP +L  I  G NPTG+ LS++   +I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 309 ADEVY 313
            DE Y
Sbjct: 245 EDEPY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 64/125 (51%), Gaps = 13/125 (10%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNN----SHPLPYYLDEK 248
           +I L  G+  ++  ++   C      +L+  P Y +Y+    +N+    + PL   + E 
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPL---ITED 145

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVI 308
           + +  +  ++ D++NN  +Q IK  +L + +PGNPTGA +    I ++     + G+VV+
Sbjct: 146 NSFQMDSDKVLDILNN--DQEIK--LLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV 200

Query: 309 ADEVY 313
            DE Y
Sbjct: 201 -DEAY 204

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH--PLPYYLDEK 248
           A+++ L  G+  ++  L+   C   +  +LI  P Y +Y+    +N+     +P  +++ 
Sbjct: 87  ADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDN 146

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKY--GIV 306
           S        IE +  ++   NIK  +  V +PGNPTGA++   DI+ I  I +++  GIV
Sbjct: 147 SFQMNTDKVIETLQGDS---NIK--IAFVTSPGNPTGALI---DIASIEKILSQWQSGIV 198

Query: 307 VIADEVY 313
            I DE Y
Sbjct: 199 AI-DEAY 204

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 88/172 (51%), Gaps = 21/172 (12%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH--PLPYYLDEK 248
           A+++ L  G+  ++  L+   C   +  +LI    Y +YT    +N+     +P  L E+
Sbjct: 87  ADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEE 146

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKY--GIV 306
             +  +  +I + + N  + +IK  ++ + +PGNPTG  +   D+++I  I +++  G+V
Sbjct: 147 DKFQIDEEKILETLQN--DPSIK--LVFITSPGNPTGTFI---DVNRIEKILSQWQTGLV 199

Query: 307 VIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSG 358
           V+ DE Y + V +G++  S+  +  K        ++N+ +    S S G++G
Sbjct: 200 VV-DEAYIDFV-EGSDKGSLAPLATK--------YENIAVLQTLSKSFGLAG 241

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 121/292 (41%), Gaps = 59/292 (20%)

Query: 192 EDIFLTAGASSAV-SYLLSILCKGQETGVLIPIPQYPLYTASL--ALNNSHPL--PYYLD 246
           E+I +T GA+  + + L+S+L  G E  VL P     +Y   +   +    PL  P  L 
Sbjct: 100 ENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDLK 159

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306
            +    +  T   D   +AI +  K   +++ +P NPTG V + E++  +  I  +  + 
Sbjct: 160 TRRTKGSEWTLDFDQFRSAISEKTK--AVIINSPHNPTGKVFTREELLTLGNICVEKNVY 217

Query: 307 VIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGY 366
           +I+DEVY EN++   E                     V+LASL      ++   G  G  
Sbjct: 218 IISDEVY-ENLYFTPE--------------------CVKLASLSPEISNITLTIGSAGKI 256

Query: 367 MEITGFNNDIRQVI------LKLASISLCPVVTGQALVDLMVSPPKPG--------DESY 412
             +TG+   I  +I      LKLAS          A + +  S P P         D + 
Sbjct: 257 FAVTGWR--IGWIISENVELLKLAS---------SAHIKICFSSPSPPQLACAHAIDIAL 305

Query: 413 ELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYL---FPRLLLP 461
             D  +R  + +   E+   L + F  L G+    PEG+ ++   F +L +P
Sbjct: 306 NSDYFDR--MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 84/369 (22%), Positives = 150/369 (40%), Gaps = 50/369 (13%)

Query: 145 AIARARRLLNDIGSSVGAYSTSQG-IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSA 203
            +  A++ L+D  + V  YS ++G +  I   + Q+    +   +  A +I +T GA+  
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYN--TQLQANNIQVTTGANEG 126

Query: 204 V-SYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTE-IEDV 261
           + + L+ +L  G E  V  P   +  Y +++ +         L      S  PTE  E  
Sbjct: 127 ILACLVGLLNPGDEVIVFEPF--FDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWT 184

Query: 262 VN-NAIEQNIKPSV--LVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVF 318
           V+ + +   I P    L++  P NP G V + E++ QI  I  +  +V+I+DEVY E+++
Sbjct: 185 VDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVY-EHLY 243

Query: 319 DGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVS-GECGQRGGYMEITGFNNDIR 377
              EF  +  +  ++ +            +L   S G S    G R G+  I   N +  
Sbjct: 244 FTPEFTRVATLSPEIGQ-----------ITLTIGSAGKSFAATGWRIGW--IVSLNPE-- 288

Query: 378 QVILKLASISLCPVVTGQALVDLMVSPPKPGDES------YELDQQERKSIHEALAERAG 431
             +L+ AS+         A   +  + P P  E+        LD    K + E    +  
Sbjct: 289 --LLEYASM---------AHTRICFASPSPLQEACANALPIALDNGYFKKMREEYIHKFN 337

Query: 432 KLHATFNSLEGIECQKPEGAMYL---FPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATG 488
                F+ L G+   KPEG  ++   F ++ +P       E      D      L+   G
Sbjct: 338 IFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYWLINELG 396

Query: 489 ICTVPGSGF 497
           +  +P + F
Sbjct: 397 VVAIPPTEF 405

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 73/145 (50%), Gaps = 22/145 (15%)

Query: 191 AEDIFLTAGASSAV-SYLLSILCKGQETGVLIPIPQYPLYTASLALNNS-------HPLP 242
           A ++ +T GA+  + S L+ +L  G E  V++  P +  Y +++ +          HP P
Sbjct: 114 ASNVQVTTGANEGILSCLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPMHP-P 170

Query: 243 YYLDEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFA 298
             ++ ++     W+ N  E+E  +        K   L++  P NP G V + E++ +I  
Sbjct: 171 KEMNVRNTKGTEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGE 224

Query: 299 IAAKYGIVVIADEVYQENVFDGAEF 323
           I  K+ +V+I+DEVY E+++   EF
Sbjct: 225 ICVKHNVVIISDEVY-EHLYFTPEF 248

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 192 EDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH--PLPYYLDEKS 249
           E++ L  G+   +  L+   C   +  +LI  P Y +Y+    +N+     +P  +++ S
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 250 GWSTNPTEIEDVVNNAIEQNIKPSV--LVVINPGNPTGAVLSEEDISQIFAIAAKYGIVV 307
                   IE + N+       PS+  + + +PGNPTGA++  E+I ++ +   + G VV
Sbjct: 148 FQMDTEKVIETLQND-------PSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVV 199

Query: 308 IADEVY 313
           + DE Y
Sbjct: 200 V-DEAY 204

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 84/176 (47%), Gaps = 15/176 (8%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
            Y +  G   +R+ VA+  +  +   +  A+++ +T GA  A ++L+     G    ++ 
Sbjct: 54  TYGSIWGTPVLRDLVAKIHSSDE--IQLTADNVLITNGAIGA-NFLVHYTAAGPGDHIIC 110

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG 281
             P Y   ++  ++  +     +L+ + G++ N  +++    + +  N K   +V+ NP 
Sbjct: 111 VDPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLK----SKVRANTK--YIVLNNPN 164

Query: 282 NPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSN 337
           NP G+V+S E +++I   A +  I ++ DEVY         FHS ++     Q SN
Sbjct: 165 NPLGSVISTEKMTEIIDYAERNEIFIVCDEVYS------PLFHSSEQPKSACQLSN 214

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 20/184 (10%)

Query: 145 AIARARRLLNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAV 204
           AI  A+R L      V  YS ++G   + +++ +F T      K  A +  +  GA+ A+
Sbjct: 63  AIKEAQRALEI--PLVNQYSPTRGRLSLIDSLVKFYTPF-YNTKLEAANFSVFTGANEAI 119

Query: 205 -SYLLSILCKGQETGVLIP-----IPQYPLYTASLALNNSHPLPYYLDEK----SGWSTN 254
            S L+ +L  G E  V  P     IP   L    +      P P  LD +      W  +
Sbjct: 120 FSILIGLLNPGDEVIVFEPFFDQYIPNIELSGGKVVYVPITP-PKNLDTRVTKGEEWQID 178

Query: 255 PTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
              ++  +N+      K   +++  P NP G V +E ++ ++  I  K  +V+I+DEVY+
Sbjct: 179 WDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYE 232

Query: 315 ENVF 318
              F
Sbjct: 233 HLYF 236

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 19/197 (9%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
            Y   +G + +R  +A        G +  A+++ +T GA  A ++LL     G+   V+ 
Sbjct: 55  TYGAIKGSKDLRTLIAGLY-----GVQFSADNVLVTNGAIGA-NFLLYYTLVGKGDHVIC 108

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG 281
             P Y    +   +  +      L EK  +  N     D +  AI+ N K  ++++ NP 
Sbjct: 109 VHPTYSQLYSVPKMFGAEVTLLELSEKDSFLPNL----DTLKKAIKSNTK--LIIINNPN 162

Query: 282 NPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVF 341
           NP G V+S+E ++ I  +  +  + +  DEVY+        FHS+   +    +S   ++
Sbjct: 163 NPLGCVISDELLTSICELCKEKNVYLHCDEVYR------PIFHSLPSGVTT-PRSAAQIY 215

Query: 342 DNVQLASLHSTSKGVSG 358
           DN  ++   S +  ++G
Sbjct: 216 DNAVVSGSMSKAFSLAG 232

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 67/139 (48%), Gaps = 19/139 (13%)

Query: 191 AEDIFLTAGASSAV-SYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL------PY 243
            E++ +T GA+  + S L+ +L  G E  V++  P +  Y +++ L     +      P 
Sbjct: 115 TENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPK 172

Query: 244 YLDEKSG----WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAI 299
            LD ++     W+ +  + E  +        K   +++  P NP G V + E+++ +  I
Sbjct: 173 ELDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNI 226

Query: 300 AAKYGIVVIADEVYQENVF 318
             K+ +++I+DEVY+   F
Sbjct: 227 CVKHNVIIISDEVYEHLYF 245

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 25/179 (13%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSG 250
           A++I L  G+  ++  ++   C  +E  V++  P Y +Y     +N+      Y++    
Sbjct: 87  AKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVG----YVEVPLI 142

Query: 251 WSTNPTEIEDVVNNAIEQ-NIKPSVLVVI--NPGNPTGAVLSEEDISQIFAIAAKYGIVV 307
            S N  +I++  +  +EQ N+  S+ VV   +PGNPTGA +    + ++       GIVV
Sbjct: 143 SSDNSFQIDE--DRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVV 199

Query: 308 IADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGY 366
           + DE Y        +F + K  L  L   +P       L  L + SK  SG  G R G+
Sbjct: 200 V-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+  T G ++A    L + C   +    + + +   +++SLA   +  +  +        
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGD----VILAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++E +++N  E   KP +L  I  G NPTG+ L+ E   +I+ IA K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 312 VY 313
            Y
Sbjct: 248 PY 249

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 72/139 (51%), Gaps = 14/139 (10%)

Query: 193 DIFLTAGASSAV-SYLLSILCKGQETGVLIPIPQYPLYTASLALNNS-------HPLPYY 244
           ++ +T GA+ A+ S L+ +L +G E  V++  P +  Y +++ +          HP P  
Sbjct: 120 NVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHP-PKE 176

Query: 245 LDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYG 304
           L+ +    T  T   D +  AI    K   L++  P NP G V + E++ +I  I  +  
Sbjct: 177 LENRVTHGTEWTVDYDELRAAITPKTK--ALILNTPHNPIGKVFTREELLEIGNICVENN 234

Query: 305 IVVIADEVYQENVFDGAEF 323
           +V+I+DEVY E+++  +EF
Sbjct: 235 VVIISDEVY-EHLYFTSEF 252

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 72/160 (45%), Gaps = 12/160 (7%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAYAE-DIFLTAGASSAVSYLLSILCKGQETGVLI 221
           Y+ + G++ + +    F++       AY E D+ L  G+S A   ++  LC    T VL+
Sbjct: 126 YTETAGMKQLLDFCRGFVSY--AHPPAYNEWDVTLANGSSDATFKIIETLCDSSVT-VLV 182

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIE---DVVNNAIE----QNIKPSV 274
               +    A +       +P  LD  +        +E   D+++N  +       KP +
Sbjct: 183 EEFTFSPTLAIITAAGGTTVPLKLDITADPDVQGINVEYLTDLLDNWSQGPNAHLSKPKL 242

Query: 275 LVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
           L  I  G NPTG  LS E   QI+A+A K+  ++I D+ Y
Sbjct: 243 LYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFIIIEDDPY 282

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 14/128 (10%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL---PYYLDEKS 249
           DI  T G++ A    L I C   +T +L    +   Y++S+   ++  L   P  +D + 
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 250 GWSTNPTEIEDVVNNAIEQNI---KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGI 305
                P ++E++++N  ++      P +L  I  G NPTG  LSE     I+ +A KY I
Sbjct: 189 ---IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDI 245

Query: 306 VVIADEVY 313
           +++ D+ Y
Sbjct: 246 LIVEDDPY 253

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 192 EDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPY-YLDEKSG 250
           ++I L  G+   V  L+   C  +   VL+  P Y +Y+    +N++  +    + E + 
Sbjct: 88  KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNS 147

Query: 251 WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIAD 310
           +  +   + + ++N  + +IK  +L +  PGNPTGA +S + I  +    +  GIVV+ D
Sbjct: 148 FDMDLDNVLETLSN--DDSIK--LLFITTPGNPTGASISTQKIEMLLNNWSA-GIVVV-D 201

Query: 311 EVY 313
           E Y
Sbjct: 202 EAY 204

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 87/194 (44%), Gaps = 28/194 (14%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL---PYYLDEKS 249
           DI  T G++      L I C   +T +L    +   Y++S+   ++  L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLD--- 184

Query: 250 GWSTNPTEIEDVVNNAIE---QNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGI 305
           G    P+++E+++ N      +   P +L  I  G NPTG  LS+     I+ +A +Y I
Sbjct: 185 GEGIVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDI 244

Query: 306 VVIADEVY----------QENVFDGAEFHSMKK--ILRKLQKSNPGVFDNVQLASLHSTS 353
           ++I D+ Y          ++   + AE  +M +   +  L +S   +  + ++  L S S
Sbjct: 245 IIIEDDPYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDGRVVRLESVS 304

Query: 354 KGVSGECGQRGGYM 367
           K  +  C  R G++
Sbjct: 305 KTFAPGC--RMGWL 316

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 64/124 (51%), Gaps = 7/124 (5%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYL-DEKS 249
           AE+I L  G+  ++  L+ + C   +  ++I  P Y +Y+    +N+   +   L  E +
Sbjct: 87  AENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDN 146

Query: 250 GWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIA 309
            +  + +++ + +  A +  IK  ++ + +PGNPT A++   +I ++  +    G +V+ 
Sbjct: 147 SFQMDTSKVLETL--AQDPTIK--LIFITSPGNPTAALIDTAEIEKV--LNNWTGGLVVV 200

Query: 310 DEVY 313
           DE Y
Sbjct: 201 DEAY 204

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 10/128 (7%)

Query: 190 YAE-DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYT--ASLALNNSHPLPYYLD 246
           YA+ ++  + G ++A    L I C   + G ++   +Y   +  A+        +P  +D
Sbjct: 127 YADWEVIASVGNTNAWESTLRIFC---DRGDVVLFEEYSFSSCLAACEAQGVTTIPIPID 183

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGI 305
               +   P ++ED+++N      KP +L  I  G NPTG  L  +    I+ IA K+  
Sbjct: 184 ---AFGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDF 240

Query: 306 VVIADEVY 313
           +++ DE Y
Sbjct: 241 LIVEDEPY 248

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 74/155 (47%), Gaps = 13/155 (8%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
            Y   +G   +R  VA   ++++   K   +++ +T GA  A ++L+S    G    V+ 
Sbjct: 54  TYGAIKGSDELRSLVASLYSDKE--VKLDKDNVLITNGAIGA-NFLVSYTLAGPGDHVIC 110

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDV--VNNAIEQNIKPSVLVVIN 279
             P Y   ++   +  +      L+ ++ +      I D+  + + I+ N K   +V+ N
Sbjct: 111 VDPTYQQLSSVPKMFGAEVELLELNRENDF------IPDIGKLKSMIKGNTK--CIVLNN 162

Query: 280 PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
           P NP G+V+    + +I A+A K  I VI DEVY+
Sbjct: 163 PNNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 75/159 (47%), Gaps = 10/159 (6%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIP 222
           YS +QG+  I + + + I            D+ L  G+S ++  L   L   + T VL+ 
Sbjct: 112 YSQTQGLAPILDFL-KLIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLT-DETTTVLVE 169

Query: 223 IPQYPLYTASLALNNSHPLPYYLDEKSGWST---NPTEIEDVVNN----AIEQNIKPSVL 275
              +    +++    +  +P  L+  S  S    N T ++ ++ N      +   +PS+L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 276 VVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
             I+ G NPTG  +S E+ ++I+ +A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 62/126 (49%), Gaps = 13/126 (10%)

Query: 192 EDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNN----SHPLPYYLDE 247
           E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+      PL Y   E
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIY---E 144

Query: 248 KSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVV 307
            + +  N  ++ D++ N  +  IK  ++ + +PGNPTG  +  + I ++       G+VV
Sbjct: 145 DNSFQLNSDKVLDILKN--DPLIK--LVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVV 199

Query: 308 IADEVY 313
           + DE Y
Sbjct: 200 V-DEAY 204

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+  TAG ++A    L + C   +  +L+    +    AS         P  +D      
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPIDADG--- 189

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++  V+ N      KP +L  I  G NPTG  +++     I+ IA KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 312 VY 313
            Y
Sbjct: 250 PY 251

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           DI  TAG ++A    L + C   +  +L     +    A+         P  +D+     
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPIPIDDNG--- 188

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++E +++N      KP +L  I  G NPTG  L    + +I+ IA K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 312 VY 313
            Y
Sbjct: 249 PY 250

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 75/160 (46%), Gaps = 12/160 (7%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAYAE-DIFLTAGASSAVSYLLSILCKGQETGVLI 221
           Y+ ++G+  + +    FI+  +    AYA+ D+ L  G S ++  +   LC  Q   VL+
Sbjct: 126 YTATRGMPPLIDFCKDFISYVN--PPAYADWDLTLANGTSDSLFKIFETLCD-QGEAVLV 182

Query: 222 PIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEI---EDVVNNAIE----QNIKPSV 274
               +    +++      P+P  L+  +       +I    ++++N ++       +P +
Sbjct: 183 EEFTFAPTLSNIRAAGGVPVPVKLNISADPQVQGIDIGHLTELLDNWVQGPYAHLSRPKL 242

Query: 275 LVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
           L  I  G NPTG  LS E   QI+ +A K+  +++ D+ Y
Sbjct: 243 LYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPY 282

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH-----PLPYYLDE 247
           D+F TAG ++A    L + C     G +I + +   +++SLA   +      P+P   D 
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDAD- 188

Query: 248 KSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIV 306
                  P ++  +++N      KP +L  I  G NPTG  ++      I+ IA K+  +
Sbjct: 189 ----GIIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFL 244

Query: 307 VIADEVY 313
           ++ DE Y
Sbjct: 245 IVEDEPY 251

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 63/128 (49%), Gaps = 14/128 (10%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL---PYYLDEKS 249
           DI  T G++      L I C   +T +L    +Y  Y++S+   ++  L   P  LD   
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL---EEY-TYSSSVEAADAQGLNCIPMPLD--- 184

Query: 250 GWSTNPTEIEDVVNNA--IEQNI-KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGI 305
           G    P ++E+++ N   +  +I  P +L  I  G NPTG  LS+     I+ +A KY +
Sbjct: 185 GEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDM 244

Query: 306 VVIADEVY 313
           ++I DE Y
Sbjct: 245 IIIEDEPY 252

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 13/127 (10%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH----PLPYYLD 246
           AE++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+      PL   + 
Sbjct: 86  AENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPL---IT 142

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306
             + +  N  E+     N  + +IK  ++ + +PGNPTGA +    I +I     + G+V
Sbjct: 143 SDNSFQANTDEVIKTAQN--DPSIK--LIFITSPGNPTGAKVETSRIEKILQNWDR-GMV 197

Query: 307 VIADEVY 313
           V+ DE Y
Sbjct: 198 VV-DEAY 203

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 190 YAE-DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALN----NSHPLPYY 244
           YA+ D+  T G +SA    L + C   +T   I   +Y   ++ +A       ++P+P  
Sbjct: 128 YADWDVLATVGNTSAWESTLRVFCNRGDT---ILAEEYTFSSSLVAAEAQGVRAYPVP-- 182

Query: 245 LDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKY 303
           LDE         E+ D      +   +P +L  +  G NPTG  LS +    ++ +A ++
Sbjct: 183 LDENGMVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQH 242

Query: 304 GIVVIADEVY 313
            ++++ DE Y
Sbjct: 243 DLLIVEDEPY 252

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 190 YAE-DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEK 248
           YA+ D+ +TAG++ A    + + C   ++ V+        Y++S+    +  L     E 
Sbjct: 123 YADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAF----TYSSSVEAAEAQGLYCVGMEV 178

Query: 249 SGWSTNPTEIEDVVNNAIEQNI---KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYG 304
                 P  + +++     Q+    +P VL  I  G NP G+ L +   +QI+ +A +Y 
Sbjct: 179 DSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYD 238

Query: 305 IVVIADEVY---QENVFDGA 321
           ++++ D+ Y   Q + +D A
Sbjct: 239 MLIVEDDPYYFLQMDAYDAA 258

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 8/125 (6%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+ +TAG++ A    L + C   ++ +L    +   Y++S+    +  +     E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 253 TNPTEIEDVVNNAIEQNIK---PSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVI 308
             P ++E ++ N  + +     P +L VI  G NP G  L++E    I+ I  KY +V+I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 309 ADEVY 313
            D+ Y
Sbjct: 245 EDDPY 249

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 81/175 (46%), Gaps = 23/175 (13%)

Query: 192 EDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL--PYYLDEKS 249
           +++ L  G+   +  L+   CK     +++  P Y +Y+    +N+   +  P  +++ S
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 250 GWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIA 309
                   +E      ++++    +L + +PGNPTG +++ +DI  +     K G+VV+ 
Sbjct: 145 FQMDVKRTLE-----TLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV- 197

Query: 310 DEVYQE--NVFD----GAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSG 358
           DE Y +    F+      E+ S+ K++ K        + N+ +    S S G++G
Sbjct: 198 DEAYVDFSTYFNEETKKTEYFSVAKLVTK--------YPNLTVLQTLSKSFGLAG 244

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 60/132 (45%), Gaps = 15/132 (11%)

Query: 192 EDIFLTAGASSAV-SYLLSILCKGQETGVLIPIPQYPLYTASLA--------LNNSHPLP 242
           E+I +T GA  A+   L++++  G E  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 243 YYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAK 302
             + E + W  +   +     +      K  ++++ NP NP G V + +++ ++  +   
Sbjct: 159 KRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 303 YGIVVIADEVYQ 314
            G  +IADEVY+
Sbjct: 213 NGAYIIADEVYE 224

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 74/172 (43%), Gaps = 23/172 (13%)

Query: 163 YSTSQGIQGIRETVAQFITERDGGEKAY-AEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
           YS ++G+  +      F+ +R G    Y   D  L  G+S ++  +  IL   + T VL+
Sbjct: 115 YSATEGLDPLLNFTKSFL-QRIGNTPLYNGWDTILANGSSDSLYKVFDILAD-RNTTVLV 172

Query: 222 PIPQYPLYTASLALNNSH--PLPYYLDEKSGWSTNPTEIEDVVNNAIEQNI--------- 270
               +     ++    +H  P+   LDE +  + N  +  D  +  I+            
Sbjct: 173 EEFTFVPVVGTILGTGAHIVPMKLNLDEVTSDNFNNDKQFDPNHEGIDVEYLADLLENWA 232

Query: 271 --------KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
                   KP+++  +  G NPTG  LS E   QI+A+A ++  +++ D+ Y
Sbjct: 233 VGPHKHLPKPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSH-----PLPYYLDE 247
           D+  TAG ++A    L + C     G +I + +   +++SLA   +      P+P   D 
Sbjct: 134 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDAD- 188

Query: 248 KSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIV 306
                  P ++  +++N      KP +L  I  G NPTG  +++     I+ IA K+  +
Sbjct: 189 ----GIIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFL 244

Query: 307 VIADEVY 313
           ++ DE Y
Sbjct: 245 IVEDEPY 251

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 13/127 (10%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNN----SHPLPYYLD 246
           +E++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+      PL Y   
Sbjct: 88  SENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY--- 144

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306
           + + +  +   +  V+ N  +  IK  +L + +PGNPTGA +  E I  +       G+V
Sbjct: 145 KNNSFQMDTESVLTVLQN--DPLIK--LLFITSPGNPTGARIETERIETVLQNWTD-GLV 199

Query: 307 VIADEVY 313
           V+ DE Y
Sbjct: 200 VV-DEAY 205

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 79/341 (23%), Positives = 135/341 (39%), Gaps = 57/341 (16%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEK-----AYAEDIFLTAGASSAVSYLL---SILCK 213
            Y T +G   +RET+A+   +  G EK       AE + LTAGAS  +  +L   ++   
Sbjct: 47  GYGTDKGAAWVRETIAELTNQVFGLEKQERMATDAEFLNLTAGASYGILNILLQTTLPHT 106

Query: 214 GQETGVLIPIPQYPL---------YTASLAL--NNSHPLPY-YLDEKSGW---------- 251
                  I  P Y L         ++  L       H +   +L+EK  +          
Sbjct: 107 NYTRQAFIITPTYYLINKVFLDAGFSGKLTAVEETRHGIDLGFLEEKIKYFESSSHSTEK 166

Query: 252 -STNPTEIEDVVNNAIEQNIKPSVLVVINP--GNPTGAVLSEEDISQIFAIAAKYGIVVI 308
            +++ ++   ++N A ++      ++ + P   NP+GA  S+E   ++  +A +Y I++I
Sbjct: 167 STSSSSQSLSIINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILII 226

Query: 309 ADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGEC-------- 360
           +D+VY    F G    S    +RK         D + + + ++    +S  C        
Sbjct: 227 SDDVYDLLGFHGQRTDSG---IRKPSHFRFPQLDRITVPAGNTHGNTIS-NCTFSKIIAP 282

Query: 361 GQRGGYMEITGFNNDIRQVILKLASIS-LCPVVTGQALVDLMVSPPKPGDESYELDQQER 419
           G R GY E T   N   Q+ L  A+IS   P      ++  M+     G     L     
Sbjct: 283 GLRTGYQE-TANENLANQLSLGGANISGGTPAQLNSMIIATMIKSGAVGRIVARLT---- 337

Query: 420 KSIHEALAERAGKLHATFNSL--EGIECQKPEGAMYLFPRL 458
               +  AERA  L A+  +    G +C   EG  + +  L
Sbjct: 338 ----DVYAERARVLEASIKAYLPPGTQCTPCEGGYFSWCTL 374

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 255 PTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
           P ++E +++       +P +L  I  G NPTG  L+++   +I+ IA K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query: 192 EDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNN----SHPLPYYLDE 247
           E+  L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+    + PL   + E
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPL---ITE 143

Query: 248 KSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVV 307
            + +  + TEI +++ N  +  IK  ++ + +PGNPTGA +  + I  +       G+V+
Sbjct: 144 DNSFQIDATEILNILAN--DPLIK--LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVI 198

Query: 308 IADEVY 313
           + DE Y
Sbjct: 199 V-DEAY 203

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 58/135 (42%), Gaps = 4/135 (2%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+  TAG++ A    L + C   ET VL+    Y     +      + +   +D+     
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKV 186

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEV 312
              +E+    + A++      +  + N  NPTG  L EE   ++  +A++Y  ++I D+ 
Sbjct: 187 DKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDP 246

Query: 313 Y---QENVFDGAEFH 324
           Y   Q N F   E +
Sbjct: 247 YYFLQMNEFGAPELN 261

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL--PYYLDEK 248
           A+++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVI 308
           S +  N   +  ++NN  +  IK  ++   +PGNPTGA +    I ++       GIVV+
Sbjct: 147 S-FQMNTEAVLTILNN--DPLIK--IMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV 200

Query: 309 ADEVY 313
            DE Y
Sbjct: 201 -DEAY 204

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 271 KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
           KP ++  I  G NPTG  LS E   QI+A+A K+ ++++ D+ Y
Sbjct: 204 KPKMIYTIATGQNPTGMTLSMEKRRQIYALAQKHDLLILEDDPY 247

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 74/182 (40%), Gaps = 33/182 (18%)

Query: 163 YSTSQGIQGIRETVAQFITER-----DGGE-KAYAEDIFLTAGASSAVSYLLSILCK--- 213
           Y + +G   +RE +  F+ ++     DG   +   + + L +GAS     +L+IL +   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYG---MLNILLQTTL 106

Query: 214 ---GQETGVLIPIPQYPLYTASL----------ALN-NSH------PLPYYLDEKSGWST 253
              G      I  P Y L               A+N  SH       L   LD   G S 
Sbjct: 107 PHNGYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQ 166

Query: 254 NPTEIEDVVNNAIEQNIKPSVLVVI-NPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEV 312
             +  E +   A+ + I   VL  I    NP+G   S E   ++  IA KY ++VI+D+V
Sbjct: 167 PDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDV 226

Query: 313 YQ 314
           Y 
Sbjct: 227 YD 228

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 193 DIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWS 252
           D+  TAG ++     L + C   +    + + +   +++SLA   +  +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFCNRGD----VILAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADE 311
             P ++  +++N      KP +L  I  G NPTG  +++     I+ IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 312 VY 313
            Y
Sbjct: 250 PY 251

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL--PYYLDEK 248
           A+++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDN 146

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVI 308
           S       ++E V+   +E +    ++ V +PGNPTGA +    I Q+     + G+VV+
Sbjct: 147 SFQ----MDVEAVLT-ILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV 200

Query: 309 ADEVY 313
            DE Y
Sbjct: 201 -DEAY 204

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 56/123 (45%), Gaps = 5/123 (4%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSG 250
           A+++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +   L    G
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDG 146

Query: 251 WSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIAD 310
                TE    V   ++ +    ++ V +PGNPTGA +    I ++       G+VV+ D
Sbjct: 147 SFQMDTE---AVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV-D 201

Query: 311 EVY 313
           E Y
Sbjct: 202 EAY 204

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 20/166 (12%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
            Y + +G   +R  +A        G +   +++ +T GA +A ++L+     G    V+ 
Sbjct: 54  TYGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVIC 107

Query: 222 PIPQYP-LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINP 280
             P Y  LY+          L   L ++ G+  N     + +   I+ N K  ++++ NP
Sbjct: 108 VDPTYAQLYSVPKMFGAEVSL-LKLQKEDGFIPNI----ETLKKMIKSNTK--LIIINNP 160

Query: 281 GNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSM 326
            NP G+ +S E ++ I  +  +  I +  DEVY+        FHSM
Sbjct: 161 NNPLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 66/179 (36%), Gaps = 30/179 (16%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCK------GQ 215
            Y + +G   +R+ V   I +      +  E I LT+GAS  +   L+IL +      G 
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGI---LNILLQTTLPHTGY 106

Query: 216 ETGVLIPIPQYPL---------------------YTASLALNNSHPLPYYLDEKSGWSTN 254
                I  P Y L                     YT+         L Y+  E      N
Sbjct: 107 TKQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQN 166

Query: 255 PTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
            T+I    NN  ++  K     +    NP+G     E   Q+  IA KY +++I D+VY
Sbjct: 167 STDIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 64/125 (51%), Gaps = 9/125 (7%)

Query: 191 AEDIFLTAGASSAVSYLLSILC-KGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKS 249
           AE++ L  G+  ++  ++   C  G+E  + +P P Y +Y+   ++N+   +   L    
Sbjct: 84  AENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYGMYSVCASVNDVEIVKCPL---- 138

Query: 250 GWSTNPTEIE-DVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVI 308
             S N  +++ + V + ++++    ++ + +PGNPTGA +    I +I       GI+V+
Sbjct: 139 VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGILVV 197

Query: 309 ADEVY 313
            DE Y
Sbjct: 198 -DEAY 201

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 69/154 (44%), Gaps = 14/154 (9%)

Query: 162 AYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLI 221
           +Y   +G   +R ++A        G     +DI LT GA  A ++L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 222 PIPQYP-LYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINP 280
             P Y  LY+          L   L ++  +  N   ++ ++ N    N K  ++++ NP
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDL-LTLKKEDDFLPNLQTLKSMIKN----NTK--LIIINNP 160

Query: 281 GNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
            NP G+V+ ++ + QI  +  +  I + +DEVY+
Sbjct: 161 NNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 72/187 (38%), Gaps = 38/187 (20%)

Query: 163 YSTSQGIQGIRETVAQFITE------RDGGEKAYAEDIFLTAGASSAVSYLLSILCK--- 213
           Y + +G   +RE + +F  +      RD   ++  E + L++GAS  V   LSIL +   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGV---LSILLQATL 107

Query: 214 ---GQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTN----PTEIEDVVNNAI 266
              G      I  P Y L                +DE    S +      ++++  +   
Sbjct: 108 AHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFT 167

Query: 267 EQNIKPSVLVVINPG-------------------NPTGAVLSEEDISQIFAIAAKYGIVV 307
           E+  +  +  + +P                    NPTG   S E   ++  IA KY +++
Sbjct: 168 EEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLI 227

Query: 308 IADEVYQ 314
           IAD+VY 
Sbjct: 228 IADDVYD 234

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 256 TEIED-VVNNAIEQNIKP--SVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEV 312
           TE  D  V   IE+ +KP  SV+ + +PG+ T  +   +DI  + +IA K+GI  I D  
Sbjct: 130 TEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEI---QDIPALVSIAKKHGIRTILDNT 186

Query: 313 YQENVFDGAEFHSM 326
           +   +F  A  H +
Sbjct: 187 WATPLFFDAHGHGI 200

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 274 VLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
           + +V    NPTGA+ S     ++  +A KY I++I+D+VY 
Sbjct: 190 IYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVYD 230

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 274 VLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
           + +V    NPTGA+ S     ++  +A KY I++I+D+VY 
Sbjct: 191 IYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVYD 231

>TBLA0A10320 Chr1 (2542498..2544363) [1866 bp, 621 aa] {ON}
           Anc_5.287 YHR045W
          Length = 621

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 8/60 (13%)

Query: 325 SMKKILRKLQKSNPGVFDNVQL--ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILK 382
           +MKKI+  +QKS+  +FDN +L  A+L   S G+  +CG+R      + F +++R + L+
Sbjct: 403 NMKKIIDHIQKSHTNIFDNFRLNWATLL-FSYGIFSKCGERQ-----SRFTDNLRCIYLE 456

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 91/226 (40%), Gaps = 20/226 (8%)

Query: 198 AGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTE 257
            GA +  S LLS+        V IP P +P +      N    + YY   K G       
Sbjct: 122 TGALAVASKLLSLF---MSRSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIEGW 178

Query: 258 IEDVVNNAIEQNIKPSVLVV-INPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQEN 316
           I+D+  +A ++   P  +V+     NPTG   S+E   +I     +  ++ I D  YQ  
Sbjct: 179 IQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQG- 237

Query: 317 VFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEI------- 369
             D  + +    +L      N   + N  L    S +K + G  G+R G + +       
Sbjct: 238 -LDSGDLYKDAYLLNMSLDENRYQWKN-GLFLCQSFAKNM-GLYGERVGSLSVVTPPDSK 294

Query: 370 --TGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYE 413
                ++ +++++  + S    P   G  + +L++S P   +E +E
Sbjct: 295 LKVNVDSQLKKIVRGMYS---SPPGYGSRVANLVLSTPHLKEEWFE 337

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 262 VNNAIEQNIKPSVLVVI--NPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFD 319
           +   IE+ +KP+  V+   +PG+ T  V   +DI  + ++A K+GI  I D  +   +F 
Sbjct: 136 IGKDIEKLVKPNTTVIFLESPGSGTMEV---QDIPALVSVAKKHGIKTILDNTWATPLFF 192

Query: 320 GAEFHSM 326
            A  H +
Sbjct: 193 DAHAHGI 199

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 59/125 (47%), Gaps = 9/125 (7%)

Query: 191 AEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPL--PYYLDEK 248
           A+++ L  G+  ++  ++   C   +  +L+  P Y +Y+    +N+   +  P  + + 
Sbjct: 87  ADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN 146

Query: 249 SGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVI 308
           S        +  + N+ + +     ++ V +PGNPTGA +    I +I     + G+VV+
Sbjct: 147 SFQMDTEAALTILKNDPLIK-----LIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV 200

Query: 309 ADEVY 313
            DE Y
Sbjct: 201 -DEAY 204

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 79/199 (39%), Gaps = 18/199 (9%)

Query: 145 AIARARRLLN---DIGSSVGAYSTSQGIQGIRETVAQFITER---DGGEKAYAEDIFLT- 197
           ++ARA+ +L+   ++ + + +Y   +G    +  V QF+ +    +G E      I    
Sbjct: 59  SVARAQMVLDQSFEMNTDL-SYLPIEGCPDFQSNVLQFLYKESCPEGAEFLSKNRISFVQ 117

Query: 198 ----AGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWST 253
                GA +  S LLS+        V IP P +P +      N    + YY   + G   
Sbjct: 118 TLSGTGALAVASKLLSLF---MSKAVWIPNPSWPNHANVFQNNGFKRINYYTYYRDGGLD 174

Query: 254 NPTEIEDVVNNAIEQNIKPSVLVV-INPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEV 312
             + ++D+     + +  P  +V+     NPTG   S E    I     +  ++ I D  
Sbjct: 175 VDSWLQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPIIDMA 234

Query: 313 YQENVFDGAEFHSMKKILR 331
           YQ    D  + H    +LR
Sbjct: 235 YQG--LDTGDLHKDAYLLR 251

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 262 VNNAIEQNIKPSVLVVI--NPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFD 319
           V   I++ IKP+  V+   +PG+ T  +   +DI  + ++A K+GI  I D  +   +F 
Sbjct: 137 VGEDIKKLIKPNTTVIFLESPGSGTMEI---QDIPALVSVAKKHGIKTILDNTWATPLFF 193

Query: 320 GAEFHSM 326
            A  H +
Sbjct: 194 DAHGHGI 200

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 271 KPSVLVVINPG-NPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
           KP +L  I  G NPTG  +  E+  +I+ +A K+  +++ D+ Y
Sbjct: 240 KPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 192 EDIFLTAGASSAVSYLLSILC-KGQETGVLIPIPQYPLYTASLALNNSH----PLPYYLD 246
           +++ L  G+  ++  ++   C  G+E  + +P P Y +Y+    +N+      PL Y   
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLP-PTYSMYSVCANINDVEVLECPLIY--- 142

Query: 247 EKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIV 306
           E + +  +  ++  ++++  +  IK  ++ + +PGNPTGA +    I +I  + +  G  
Sbjct: 143 EDNSFQPDSQKVISILSS--DPLIK--LVFLTSPGNPTGAKIDSNIIIKI--LESWDGGF 196

Query: 307 VIADEVY 313
           V+ DE Y
Sbjct: 197 VVVDEAY 203

>ZYRO0C02112g Chr3 (166252..167889) [1638 bp, 545 aa] {ON} similar
           to uniprot|P41821 Saccharomyces cerevisiae YNL291C MID1
           N-glycosylated integral plasma membrane protein
          Length = 545

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 382 KLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATF 437
           K  +ISLC ++ G  LV    SPPK   + + L++ E  ++  ++A+R+G +   F
Sbjct: 265 KSTNISLCAMIQGNYLVSSAQSPPK---DVHPLERTEL-AVSRSMADRSGSVREQF 316

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 253 TNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEV 312
           TNPT+      N  ++  +  +  V    NP+G   S E   ++  +A KY +++IAD+V
Sbjct: 183 TNPTK------NPNKKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDMLIIADDV 236

Query: 313 YQ 314
           Y 
Sbjct: 237 YD 238

>SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {ON}
           similar to uniprot|P41734 Saccharomyces cerevisiae
           YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase
           required in balance with alcohol acetyltransferase to
           maintain optimal amounts of isoamyl acetate which is
           particularly important in sake brewing
          Length = 243

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 14/121 (11%)

Query: 325 SMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGY--MEITGFNNDIRQVILK 382
           ++K + R L+  +PG+     +++L+    G +  C   GG+  +E+  F +++ +++  
Sbjct: 61  ALKLLPRILENESPGIV----MSTLYF---GSNDAC--HGGHQKVELPEFKDNVERLLDI 111

Query: 383 LASISLCPVVTGQALVDLMVSPPKPGDE---SYELDQQERKSIHEALAERAGKLHATFNS 439
             S  + P++ G AL D     P+  DE    Y    +  K   +AL E A K    F +
Sbjct: 112 FKSKGIKPILVGPALFDKDNWNPRKADEVAQGYVRSNENNKLYSDALQEIADKEQIPFVN 171

Query: 440 L 440
           L
Sbjct: 172 L 172

>TDEL0F04640 Chr6 (870870..874583) [3714 bp, 1237 aa] {ON} Anc_8.340
            YDR159W
          Length = 1237

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 5/71 (7%)

Query: 55   LSEVNENVLK---AKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLKQKP 111
            LS+  EN  K   AK  +  + P + + L  K ++DPHS  +   ++   G P H    P
Sbjct: 1098 LSKAKENNFKTPLAKRCISSSSPAITSHLATKFRRDPHSTRYQRSLAP--GTPTHCNNVP 1155

Query: 112  LTFYRQVLSLL 122
                    SLL
Sbjct: 1156 EQSATATTSLL 1166

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 95/234 (40%), Gaps = 34/234 (14%)

Query: 242 PYYLDEK---SGWSTNPTEIEDVVNNAIEQNIKPS-VLVVINPGNPTGAVLSEEDISQIF 297
           PYY +EK     W  +   I+   +  +  N KPS +L+     NPTG   ++E   QI 
Sbjct: 177 PYYSNEKIVLKDWLNHLINIQKT-DREVTSNSKPSCILLHACCHNPTGLDPTKEQWDQIL 235

Query: 298 AIAAKYGIVVIADEVYQ--ENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLASLHSTSKG 355
                  ++ I D  YQ  E+     + + ++K+L K +  N    + + L    + + G
Sbjct: 236 DTIYDLNLIPIIDMAYQGLESGDVLKDSYLLRKVLNKKRYKNWK--NGIYLCQSFAKNMG 293

Query: 356 VSGECGQRGGYMEIT---------------GFNNDIRQVILKLASISLCPVVTGQALVDL 400
           + GE   R G + I                  ++ ++Q+I  + S    P   G  +V L
Sbjct: 294 LYGE---RVGSLSIILPETNSGNKSTSIRENIDSQLKQIIRSMYS---SPPGYGARIVSL 347

Query: 401 MVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYL 454
           ++S     D+ + LD +E   + + L +   KL    N    I+  +  G  Y 
Sbjct: 348 ILSDKDLKDQWF-LDVKE---MVDRLNDVRYKLSQKLNWNSIIDLNQQHGMFYF 397

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 71/343 (20%), Positives = 131/343 (38%), Gaps = 49/343 (14%)

Query: 145 AIARARRL--LNDIGSSVGAYSTSQGIQGIRETVAQFITERDG----GEKAYAED---IF 195
           AI +A+ +  L+D  +   +Y    G    R+ V  F+  RD     G+K  A++     
Sbjct: 74  AITKAQEIIDLDDALNKNLSYLPISGCPNYRDNVLNFLF-RDSVPKYGDKLIADNRVSFI 132

Query: 196 LTAGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNP 255
            +   + A++    +L       V IP P +P +     +N    L YY     G  T  
Sbjct: 133 QSLSGTGAIAVASKLLSSFISDTVWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITID 192

Query: 256 TEIEDVVNNAIEQNIK--PSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVY 313
             +E         N K   S+++     NPTG   + +  ++I     +  ++ I D  Y
Sbjct: 193 RWLESTETEVRSSNSKLPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAY 252

Query: 314 Q----ENVFDGAEF--HSMKKILRKLQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYM 367
           Q     +++D A    H + +   K  K   G+F    L    + + G+ GE   R G +
Sbjct: 253 QGLESGSLYDDAYLLRHCLDESRYKGWKH--GLF----LCQSFAKNMGLYGE---RVGSL 303

Query: 368 EIT----------GFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPGDESYELDQQ 417
            I             ++ +++++  + S    P   G  + +L++S P       EL  Q
Sbjct: 304 SIVVPPNLEKAKLSIDSQLKKIVRGIYS---SPPGYGCRIANLVLSQP-------ELRNQ 353

Query: 418 ERKSIHEALAERAGKLHATFNSL--EGIECQKPEGAMYLFPRL 458
             + +H  +          ++ L   G+     +  M+ F RL
Sbjct: 354 WHQDVHSIVGRLTNVRKQMYDKLGWSGLVDSSQQHGMFYFTRL 396

>NDAI0J00920 Chr10 complement(203498..205330) [1833 bp, 610 aa] {ON}
           
          Length = 610

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 18/111 (16%)

Query: 50  AEKLGLSEVNENVLK---AKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQH 106
           ++KL  S ++E VL     KY ++  +P +  E   K  KD            N  N  H
Sbjct: 86  SQKLNKSPLSEKVLNQYYEKYKIKAIVPNIDLEKVGKKYKD-----------NNGKNKLH 134

Query: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIG 157
             Q  LT+ +   S  +Y G +E ++ V+      + D I   R++L D G
Sbjct: 135 NDQPSLTYEKLPCSEFEYEGTIEYSKDVI----ELKDDLIDMRRKILKDGG 181

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 282 NPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
           NP+G   S E  +++  IA +Y +++I D+VY 
Sbjct: 194 NPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 418

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 72/179 (40%), Gaps = 10/179 (5%)

Query: 145 AIARARRLLN---DIGSSVGAYSTSQGIQGIRETVAQFITER--DGGEKAYAEDIFL--T 197
           ++A A+ LL    D+ + + +Y    G Q  +  V  F+     DG E      I    T
Sbjct: 58  SVASAQSLLETSLDLNNDL-SYLPITGSQDYQNNVLNFLYRESSDGSELLENNRITFVQT 116

Query: 198 AGASSAVSYLLSILCKGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTE 257
              + A++    +L       V IP P +  ++     N  + + YY   + G  +    
Sbjct: 117 LSGTGALAVASKLLATFVSKTVWIPNPSWANHSNVFQWNGFNQIKYYTYYEDGKLSIDKW 176

Query: 258 IEDVVNNAIEQN--IKPSVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQ 314
           ++++  +   ++    PS+++     NPTG   + E   QI  +    GI  I D  YQ
Sbjct: 177 LKELKESCSSRDPDWPPSIVLHACCHNPTGVDPTLEQWQQILPVIHDLGITPIIDMAYQ 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,689,521
Number of extensions: 2404911
Number of successful extensions: 6598
Number of sequences better than 10.0: 134
Number of HSP's gapped: 6720
Number of HSP's successfully gapped: 134
Length of query: 534
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 420
Effective length of database: 40,409,475
Effective search space: 16971979500
Effective search space used: 16971979500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)