Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01606g8.264ON43243220860.0
TDEL0F039108.264ON42941111891e-161
NDAI0B020008.264ON43345610651e-142
NCAS0B050308.264ON43344210451e-139
SAKL0H16984g8.264ON43544210011e-132
KLTH0G13640g8.264ON4144459521e-125
Kwal_56.237828.264ON4144449141e-119
AGR084C8.264ON4274408921e-116
TPHA0A017908.264ON4394598921e-116
Ecym_43068.264ON4344268661e-112
Kpol_543.408.264ON4144328491e-110
KLLA0F19184g8.264ON5124488461e-108
YLR090W (XDJ1)8.264ON4594267798e-99
Smik_12.1498.264ON4604497668e-97
Suva_10.1748.264ON4564247659e-97
Skud_12.1588.264ON4554217362e-92
CAGL0L12276g8.264ON4524597162e-89
KNAG0G020508.264ON4324326907e-86
KAFR0J009402.243ON4113724631e-52
ADL257C2.243ON4104384622e-52
TBLA0E038102.243ON4104314588e-52
CAGL0J09966g2.243ON4074424543e-51
YNL064C (YDJ1)2.243ON4093724525e-51
Smik_14.2632.243ON4093724517e-51
KLLA0F03333g2.243ON4093964492e-50
Skud_14.2682.243ON4103734473e-50
TPHA0C031102.243ON4073724464e-50
Suva_14.2772.243ON4093754465e-50
Kpol_1003.122.243ON4084094449e-50
KNAG0I019002.243ON4094314412e-49
Kwal_23.48302.243ON4113714403e-49
Ecym_32812.243ON4094384394e-49
ZYRO0A01496g2.243ON4123724386e-49
NDAI0D010302.243ON4113784308e-48
TDEL0C046002.243ON4113734273e-47
KLTH0G09394g2.243ON4113744185e-46
SAKL0E08734g2.243ON4113964124e-45
KLTH0G08756g2.218ON4624314092e-44
NCAS0G030002.243ON4103733984e-43
Kwal_23.30612.218ON4583843943e-42
TDEL0C043502.218ON4623843822e-40
SAKL0E09306g2.218ON4613793752e-39
KAFR0A041608.730ON3783683387e-35
KNAG0M020202.218ON4603543383e-34
TPHA0G006308.730ON3933723343e-34
KNAG0G028808.730ON3783623301e-33
AER427W2.218ON4703783252e-32
ZYRO0A06226g8.730ON3773703184e-32
NDAI0E008708.730ON3763623114e-31
SAKL0H05258g8.730ON3683583096e-31
TDEL0B037908.730ON3733723081e-30
CAGL0J10296g2.218ON4794633121e-30
NCAS0B005308.730ON3753653071e-30
CAGL0F03729g8.730ON3613553034e-30
YMR214W (SCJ1)8.730ON3773752982e-29
Suva_13.3978.730ON3753592983e-29
Ecym_62368.730ON3743602983e-29
Kwal_26.90248.730ON3753572931e-28
ZYRO0C15048g2.218ON4912492952e-28
KLLA0C07260g8.730ON3683542878e-28
Kpol_1064.408.730ON3873702871e-27
Smik_13.4228.730ON3783612852e-27
KLTH0D12496g8.730ON3753592781e-26
KLLA0E07899g2.218ON4952472714e-25
Ecym_53842.218ON5032882714e-25
Skud_13.3838.730ON3753592675e-25
TBLA0B034908.730ON3843692641e-24
YNL077W (APJ1)2.218ON5282732583e-23
AER346W8.730ON3673532515e-23
Kpol_1002.1222.218ON5033102451e-21
Smik_14.2492.218ON5332782451e-21
Skud_14.2532.218ON5322742432e-21
NCAS0G028502.218ON4942532404e-21
Suva_14.2622.218ON5362762362e-20
TPHA0C029802.218ON5543222212e-18
NDAI0F024502.218ON5302952042e-16
TBLA0E036602.218ON4482812004e-16
TBLA0C014801.398ON353791923e-15
KNAG0I007407.157ON425791907e-15
KLLA0D04818g1.398ON354681888e-15
TDEL0H022907.217ON387791871e-14
AAL008W1.398ON349681842e-14
TPHA0D005508.61ON4863921854e-14
CAGL0H03707g1.398ON349681826e-14
Kwal_0.2071.398ON353681816e-14
Kpol_457.151.398ON357791817e-14
Smik_9.2037.157ON432791827e-14
NDAI0C026101.398ON340681808e-14
NDAI0G042501.398ON363681818e-14
KLTH0H12100g1.398ON350681809e-14
KAFR0H031501.398ON359681801e-13
TDEL0B059601.398ON369791801e-13
KLLA0D13464g7.157ON433811811e-13
ZYRO0E04598g1.398ON357791782e-13
SAKL0F04444g7.157ON429811792e-13
CAGL0J01936g7.157ON425811792e-13
TPHA0L007907.157ON446791792e-13
SAKL0D08778g1.398ON348681772e-13
YNL007C (SIS1)1.398ON352681772e-13
Smik_14.3211.398ON366681772e-13
KNAG0H016801.398ON363681763e-13
TBLA0E024907.217ON366701763e-13
Suva_14.3411.398ON359681763e-13
ADR015W7.157ON436811773e-13
TBLA0J018707.157ON470811783e-13
YIR004W (DJP1)7.157ON432791773e-13
Skud_14.3201.398ON368681764e-13
ZYRO0D16390g7.217ON398791755e-13
Ecym_43727.217ON579671775e-13
NCAS0A132107.157ON414811755e-13
Skud_9.1817.157ON421791756e-13
Ecym_44697.157ON433811756e-13
TPHA0B037601.398ON355681737e-13
Suva_9.2137.157ON431791748e-13
Ecym_12921.398ON347681729e-13
TBLA0D042407.217ON389821721e-12
NCAS0E029307.217ON387791721e-12
KLTH0A03740g7.217ON395791721e-12
TPHA0C012607.217ON380791721e-12
NDAI0A028207.157ON482791731e-12
KLTH0F13398g7.157ON419811712e-12
NCAS0G036101.398ON327681692e-12
KAFR0B047807.157ON423811712e-12
CAGL0J07370g2.15ON623861703e-12
NDAI0E045607.217ON394791684e-12
NCAS0C048901.398ON367681684e-12
Skud_5.1587.217ON391811684e-12
KLLA0E04423g7.217ON428691675e-12
Kwal_55.209657.157ON421811676e-12
Suva_5.1507.217ON391811667e-12
YMR161W (HLJ1)2.350ON224721591e-11
KNAG0F008602.15ON626861661e-11
Skud_13.3232.350ON224721591e-11
CAGL0J02750g7.217ON382801631e-11
TPHA0C045902.350ON233731591e-11
Kpol_1070.227.217ON380791632e-11
Smik_5.1737.217ON391811632e-11
Kwal_47.181337.217ON393791622e-11
AFR507W8.61ON474661622e-11
Suva_14.1162.15ON600851633e-11
Skud_14.1102.15ON596661633e-11
YER048C (CAJ1)7.217ON391811613e-11
Smik_14.1062.15ON593841624e-11
ZYRO0F15400g2.15ON525861614e-11
KAFR0L007407.217ON364791594e-11
Smik_13.3612.350ON224721554e-11
SAKL0F08052g7.217ON393791604e-11
Kpol_1072.48.698ON661761615e-11
YNL227C (JJJ1)2.15ON590661615e-11
Kpol_529.212.15ON622661615e-11
KNAG0L013307.217ON396791595e-11
KLLA0D19602g2.15ON620681615e-11
CAGL0L00957g7.217ON373731595e-11
TDEL0H032107.157ON411791596e-11
ZYRO0G03850g7.157ON418791596e-11
TBLA0G001702.15ON659661606e-11
NCAS0G013602.15ON616751571e-10
ABL194C2.15ON552781571e-10
KLTH0F09944g2.350ON233731511e-10
KNAG0J018408.698ON650791572e-10
Kpol_499.307.157ON408791552e-10
Suva_13.3402.350ON225721492e-10
TBLA0A011007.157ON434791533e-10
Suva_12.1851.113ON168671453e-10
KAFR0H023108.698ON655761534e-10
TDEL0G028002.350ON225731474e-10
KAFR0A079502.15ON551841525e-10
CAGL0H04499g2.350ON232731475e-10
NDAI0H031802.350ON229731466e-10
Kwal_23.3578singletonOFF85621377e-10
Ecym_56262.350ON243691451e-09
SAKL0B01276gna 1ON292671461e-09
NDAI0F038002.15ON638661491e-09
TBLA0B037308.698ON693761491e-09
SAKL0E06050g2.350ON232721432e-09
Smik_15.4378.698ON663791482e-09
TDEL0A064308.698ON666761482e-09
NCAS0C012208.698ON669761482e-09
TBLA0B093802.350ON227731422e-09
AFL190C2.350ON235691422e-09
KLLA0E01629g2.350ON231721413e-09
NCAS0D009602.350ON224731413e-09
Kwal_23.44202.15ON592861463e-09
ZYRO0D10934g8.698ON663761463e-09
KLTH0B08338g2.15ON590751463e-09
Kpol_526.62.350ON228721404e-09
KNAG0G011308.61ON500661445e-09
Suva_8.3038.698ON664761445e-09
SAKL0E14234g2.15ON678661446e-09
YOR254C (SEC63)8.698ON663791446e-09
ZYRO0A07502g2.350ON238721396e-09
Smik_10.3851.113ON172671341e-08
CAGL0J04224g8.61ON5222541411e-08
Skud_15.4208.698ON665761411e-08
TDEL0C058801.113ON159661321e-08
KNAG0I008602.350ON219721352e-08
Ecym_23748.698ON661761402e-08
TDEL0E005002.15ON581661392e-08
TPHA0O019402.15ON598821392e-08
KAFR0C024507.217ON373831382e-08
TDEL0C036801.185ON556661383e-08
SAKL0H05984g8.698ON658761383e-08
TPHA0G014808.698ON660761383e-08
KAFR0A016201.297ON665671374e-08
KLLA0C09823g8.698ON669761374e-08
Ecym_14508.61ON492701364e-08
KLLA0D06402g1.297ON631671374e-08
KAFR0B048902.350ON220731314e-08
Kwal_26.88798.698ON656761365e-08
NCAS0I028301.185ON491671356e-08
KAFR0C031608.61ON498761356e-08
CAGL0G07469g8.698ON668761357e-08
NDAI0G032808.61ON5522371357e-08
Smik_6.638.61ON5102641347e-08
KLLA0C02981g1.113ON162691278e-08
KLTH0D11770g8.698ON652761349e-08
YFL016C (MDJ1)8.61ON5112621331e-07
CAGL0C04565g1.113ON175711261e-07
Kwal_33.135331.113ON161661251e-07
ADR124C1.297ON611661321e-07
YJR097W (JJJ3)1.113ON172671252e-07
Skud_10.3191.113ON168671252e-07
KNAG0C024501.185ON544641322e-07
TBLA0A055601.92ON312751302e-07
NCAS0A093201.297ON635661303e-07
NDAI0K012308.698ON680761303e-07
Skud_10.1691.297ON644661303e-07
Smik_10.1681.297ON649661293e-07
Kwal_33.138601.185ON578641294e-07
Suva_6.448.61ON5072271294e-07
ZYRO0F15972g1.113ON162671224e-07
AGL339C5.4ON430751275e-07
Suva_6.1481.297ON642661285e-07
KNAG0A056502.350ON175721207e-07
KLLA0B07271g1.185ON653671267e-07
Kwal_26.94955.4ON428751258e-07
SAKL0H00858g5.4ON432751259e-07
NDAI0D005001.113ON190701209e-07
YJL073W (JEM1)1.297ON645661251e-06
Kwal_14.24521.297ON607661251e-06
ZYRO0G18436g1.185ON503661251e-06
Kpol_1027.131.297ON641671251e-06
Skud_6.568.61ON5172271241e-06
AAL103W8.698ON669761251e-06
SAKL0C05456g1.185ON583661241e-06
AFR639W1.113ON156661162e-06
TDEL0G002705.4ON433751232e-06
SAKL0C02904g1.92ON281761212e-06
Ecym_11101.113ON156681162e-06
AEL112C1.185ON535661232e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01606g
         (432 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   808   0.0  
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   462   e-161
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    414   e-142
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    407   e-139
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   390   e-132
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   371   e-125
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   356   e-119
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   348   e-116
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   348   e-116
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   338   e-112
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   331   e-110
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   330   e-108
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   304   8e-99
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   299   8e-97
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   299   9e-97
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   288   2e-92
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   280   2e-89
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   270   7e-86
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   182   1e-52
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   182   2e-52
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   181   8e-52
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   179   3e-51
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   178   5e-51
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   178   7e-51
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   177   2e-50
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   176   3e-50
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   176   4e-50
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   176   5e-50
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   175   9e-50
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   174   2e-49
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   174   3e-49
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   173   4e-49
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   173   6e-49
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   170   8e-48
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   169   3e-47
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   165   5e-46
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   163   4e-45
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   162   2e-44
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   157   4e-43
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   156   3e-42
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   151   2e-40
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   149   2e-39
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   134   7e-35
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   134   3e-34
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   133   3e-34
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   131   1e-33
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   129   2e-32
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   127   4e-32
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   124   4e-31
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   123   6e-31
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   123   1e-30
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   124   1e-30
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      122   1e-30
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   121   4e-30
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   119   2e-29
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   119   3e-29
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   119   3e-29
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   117   1e-28
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   118   2e-28
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   115   8e-28
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   115   1e-27
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   114   2e-27
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   111   1e-26
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   108   4e-25
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   108   4e-25
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   107   5e-25
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   106   1e-24
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   103   3e-23
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   101   5e-23
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    99   1e-21
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    99   1e-21
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    98   2e-21
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     97   4e-21
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    96   2e-20
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    90   2e-18
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    83   2e-16
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    82   4e-16
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    79   3e-15
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    78   7e-15
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    77   8e-15
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    77   1e-14
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    75   2e-14
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    76   4e-14
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    75   6e-14
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    74   6e-14
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    74   7e-14
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    75   7e-14
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               74   8e-14
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    74   8e-14
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    74   9e-14
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    74   1e-13
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    74   1e-13
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    74   1e-13
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    73   2e-13
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    74   2e-13
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    74   2e-13
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    74   2e-13
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    73   2e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    73   2e-13
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    73   2e-13
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    72   3e-13
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    72   3e-13
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    72   3e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    73   3e-13
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    73   3e-13
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    73   3e-13
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    72   4e-13
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    72   5e-13
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    73   5e-13
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    72   5e-13
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    72   6e-13
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    72   6e-13
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    71   7e-13
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    72   8e-13
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    71   9e-13
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    71   1e-12
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     71   1e-12
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    71   1e-12
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    71   1e-12
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    71   1e-12
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    70   2e-12
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      70   2e-12
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               70   2e-12
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    70   3e-12
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             69   4e-12
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     69   4e-12
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    69   4e-12
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    69   5e-12
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    69   6e-12
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    69   7e-12
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    66   1e-11
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    69   1e-11
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    66   1e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    67   1e-11
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    66   1e-11
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    67   2e-11
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    67   2e-11
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    67   2e-11
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    67   2e-11
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    67   3e-11
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    67   3e-11
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    67   3e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    67   4e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    67   4e-11
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    66   4e-11
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    64   4e-11
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    66   4e-11
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    67   5e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    67   5e-11
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    67   5e-11
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    66   5e-11
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    67   5e-11
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    66   5e-11
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    66   6e-11
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    66   6e-11
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    66   6e-11
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    65   1e-10
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    65   1e-10
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    63   1e-10
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    65   2e-10
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    64   2e-10
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    62   2e-10
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    64   3e-10
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    60   3e-10
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    64   4e-10
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    61   4e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    63   5e-10
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    61   5e-10
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      61   6e-10
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    57   7e-10
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    60   1e-09
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    61   1e-09
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      62   1e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    62   1e-09
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    60   2e-09
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    62   2e-09
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    62   2e-09
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     62   2e-09
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    59   2e-09
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    59   2e-09
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    59   3e-09
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    59   3e-09
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    61   3e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    61   3e-09
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    61   3e-09
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    59   4e-09
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    60   5e-09
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    60   5e-09
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    60   6e-09
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    60   6e-09
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    58   6e-09
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    56   1e-08
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    59   1e-08
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    59   1e-08
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    55   1e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    57   2e-08
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    59   2e-08
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    58   2e-08
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    58   2e-08
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    58   2e-08
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    58   3e-08
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    58   3e-08
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    58   3e-08
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    57   4e-08
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    57   4e-08
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    57   4e-08
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    57   4e-08
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    55   4e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    57   5e-08
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    57   6e-08
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    57   6e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    57   7e-08
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    57   7e-08
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    56   7e-08
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    54   8e-08
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    56   9e-08
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    56   1e-07
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    53   1e-07
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    53   1e-07
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    55   1e-07
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    53   2e-07
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    53   2e-07
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    55   2e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    55   2e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    55   3e-07
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    55   3e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    55   3e-07
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    54   3e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    54   4e-07
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    54   4e-07
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    52   4e-07
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    54   5e-07
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    54   5e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    51   7e-07
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    53   7e-07
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    53   8e-07
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    53   9e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    51   9e-07
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    53   1e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    53   1e-06
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    53   1e-06
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    53   1e-06
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    52   1e-06
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    53   1e-06
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    52   1e-06
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    49   2e-06
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    52   2e-06
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    51   2e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    49   2e-06
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    52   2e-06
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    52   2e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    52   2e-06
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    52   2e-06
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    52   2e-06
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    52   3e-06
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    51   3e-06
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    51   3e-06
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    51   4e-06
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    51   4e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    51   4e-06
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    50   4e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    50   4e-06
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    51   5e-06
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    50   5e-06
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    50   5e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    50   6e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    50   7e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    50   8e-06
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    50   8e-06
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    50   8e-06
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    50   8e-06
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    49   1e-05
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    47   1e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    50   1e-05
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    49   1e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    49   1e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    49   1e-05
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    49   1e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    49   1e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    49   1e-05
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    47   2e-05
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    48   2e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    48   2e-05
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    48   2e-05
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    48   2e-05
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    48   3e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    49   3e-05
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    48   3e-05
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    48   3e-05
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    48   3e-05
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    48   4e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    46   4e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    48   5e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    45   5e-05
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    47   5e-05
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    47   5e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    46   1e-04
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    46   1e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    46   1e-04
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    45   2e-04
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    45   2e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       45   2e-04
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         44   3e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    43   3e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   4e-04
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    44   5e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    44   6e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    44   7e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    43   8e-04
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    42   0.001
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    42   0.001
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    42   0.002
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    41   0.002
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    42   0.002
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    42   0.002
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    41   0.004
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    40   0.005
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    40   0.005
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    40   0.006
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    40   0.008
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    40   0.008
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    40   0.009
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    39   0.014
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    38   0.015
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    38   0.017
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    39   0.022
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    38   0.024
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    38   0.033
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    38   0.038
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    37   0.049
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    37   0.062
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    37   0.073
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    36   0.083
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    37   0.088
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    37   0.089
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    37   0.095
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    36   0.11 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    36   0.11 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    36   0.12 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    36   0.15 
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    36   0.15 
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    36   0.23 
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    35   0.24 
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    35   0.26 
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    35   0.26 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    35   0.26 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    35   0.27 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    35   0.27 
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    34   0.30 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    34   0.47 
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    33   0.57 
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    34   0.66 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    33   0.70 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    34   0.72 
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    33   0.79 
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    33   1.1  
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    33   1.1  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    33   1.3  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    33   1.6  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    32   1.7  
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    33   1.8  
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    32   2.0  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    32   2.4  
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    32   3.0  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    31   3.6  
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    31   4.3  
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    32   4.7  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    31   4.8  
KLLA0F17501g Chr6 (1605244..1606224) [981 bp, 326 aa] {ON} simil...    31   5.7  
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    31   6.9  
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    30   9.2  

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/432 (91%), Positives = 397/432 (91%)

Query: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
           MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE
Sbjct: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60

Query: 61  EKRSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVP 120
           EKRSKYDTYGDTADGPDFEDESFM                      AQPGDDRSDDVQVP
Sbjct: 61  EKRSKYDTYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRSDDVQVP 120

Query: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
           LKVSMADCYNGKVFKFQSKRKIVCEKCE             QTNCKSCQGRGYKEQLRRV
Sbjct: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRGYKEQLRRV 180

Query: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240
           APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR
Sbjct: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240

Query: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRT 300
           IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRT
Sbjct: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRT 300

Query: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFA 360
           LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFA
Sbjct: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFA 360

Query: 361 EKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQYAHEGHASGA 420
           EKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQYAHEGHASGA
Sbjct: 361 EKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQYAHEGHASGA 420

Query: 421 FPDDGTPQCAQQ 432
           FPDDGTPQCAQQ
Sbjct: 421 FPDDGTPQCAQQ 432

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  462 bits (1189), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 232/411 (56%), Positives = 293/411 (71%), Gaps = 18/411 (4%)

Query: 2   SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
           +LY+ LGV  DATQ+EIKKAYRK ALQHHPDKV D+S+REESEVRFKEI AAYEVL DEE
Sbjct: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62

Query: 62  KRSKYDTYGDTADGPDF-------EDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRS 114
           KR++YD YGD ADG DF       ED +FM                           DRS
Sbjct: 63  KRARYDKYGD-ADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKV-----DRS 116

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKC--EXXXXXXXXXXXXXQTNCKSCQGRG 172
            DVQVPL VSMADCYNGK FKFQSKR +VC++C                Q  CK C G+G
Sbjct: 117 ADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQG 176

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
           +K+++RR+APG    + ++C  C GKGK  SKP ++KN+CKKC G G+  E+K LTVS+P
Sbjct: 177 FKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLP 236

Query: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292
           RGSR  D+IV +GEADQEVGKS+TG+L+F + EGTE PEGV L+R G+DLIT++++SLAE
Sbjct: 237 RGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAE 296

Query: 293 AITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352
           AITG  +TLTKTLDGR+L+L  P GKVI PG II++  EGWP+++  T  GDLYV+V I 
Sbjct: 297 AITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDT--TTSGDLYVVVHIE 354

Query: 353 FPRDNWFAEKSDLLKIRNILPSEAANN-DVKADPGNTEQVSDMKLVDQLPD 402
           FP DNWF+E+SDL +++N+LP E  NN  V+ DPGNTE V+++ +V+++PD
Sbjct: 355 FPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIVEEIPD 405

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  414 bits (1065), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 288/456 (63%), Gaps = 52/456 (11%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LY  LGV+  AT  EIKKAYRKLALQ+HPDKV D + REE+E++FKEIT+AYE+LSDEEK
Sbjct: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 63  RSKYDTYGDT-----------------ADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXX 105
           R+ YD YGD                   D PD++  +F                      
Sbjct: 64  RAHYDLYGDANENEYNNQNANDFFNFETDQPDYDSYAF---------------------- 101

Query: 106 XAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCE---XXXXXXXXXXXXXQ 162
                +D+S DV++PLK+S+ + YNGK FKFQSKR I+C +CE                +
Sbjct: 102 ----DNDKSKDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHE 157

Query: 163 TNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIE 222
             CK C G GYKE+ R + PG V    + C  CHGKG+  +KP SEKN+CK C G+G++ 
Sbjct: 158 IECKKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLS 217

Query: 223 EAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDL 282
           E K L VS+PRG ++ D I  E EADQE+GKSKTGD+I +++E T  P  V   R+G D 
Sbjct: 218 ENKQLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDF 277

Query: 283 ITNISISLAEAITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATK 341
           +  +S+SLAEA+TG  D+ L+K+LDGR+L LS P+GKVI PG IIK++QEGWP+N  A+K
Sbjct: 278 VMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASK 337

Query: 342 FGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPS--EAANNDVKA-DPGNTEQVSDMKLVD 398
           FGDLYV++ I FP DNWF+EKSD+  +RN+LPS      N  K  DP NTE V+   +++
Sbjct: 338 FGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDILE 397

Query: 399 QLPDYMGSNGDQYAHE-GHASGAFPD-DGTPQCAQQ 432
           +LPD +  + ++ A++ G  S A  D +G PQC+QQ
Sbjct: 398 ELPDTLNESNNRSAYDTGDQSDANYDREGPPQCSQQ 433

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  407 bits (1045), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 211/442 (47%), Positives = 282/442 (63%), Gaps = 24/442 (5%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSV--REESEVRFKEITAAYEVLSDE 60
           LY  LGV+ +AT  +IKKAYRKLALQHHPDKV + +   RE SE++FKEI+AAYE+LSDE
Sbjct: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63

Query: 61  EKRSKYDTYGDTADGPDFED-----ESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSD 115
           +KR+ YD YG   +    +      ESF                             RS 
Sbjct: 64  DKRAHYDLYGSEEEQQRQQRQYDPFESFFNFEQDEEPSRHYEDPK------------RSP 111

Query: 116 DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCE---XXXXXXXXXXXXXQTNCKSCQGRG 172
           DV++PLK+++ + YNGK FKF+ KR ++C+ CE                +  CK C+G+G
Sbjct: 112 DVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQG 171

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
           + E++R +APG   ++   C  C GKGK+ +K  SEKN+CKKC G+G+  E+K LTVS+P
Sbjct: 172 FTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVP 231

Query: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292
           RG R GD I    EADQE+GK KTGDLIF ++E    P+ V+LER+G + +T ++ISLAE
Sbjct: 232 RGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISLAE 291

Query: 293 AITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDI 351
           A+TG  D+ +TKT DGR+L LS P GKVI PG IIK+EQEGWPLN  ATKFGDLY+ V+I
Sbjct: 292 ALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNI 351

Query: 352 VFPRDNWFAEKSDLLKIRNILP-SEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQ 410
            FP DNWF EKSDL +I+NILP S +    +  DP NTE +   ++++ LPD +    DQ
Sbjct: 352 EFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLETLPDTLKEGQDQ 411

Query: 411 YAHEGHASGAFPDDGTPQCAQQ 432
             +   + G +  +G+PQCAQQ
Sbjct: 412 GENNAESHGEYRGEGSPQCAQQ 433

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/442 (48%), Positives = 277/442 (62%), Gaps = 22/442 (4%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LY+ LGV+ DA+Q EIKKAYRKLALQHHPDKV D+ +REESE++FKEITAAYE+LSDE+ 
Sbjct: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDD------RSDD 116
           R KYD YGD A G                                QP  +      R+ D
Sbjct: 64  RKKYDVYGDDAPGASGGGGD-PFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSVRTSD 122

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQ-TNCKSCQGRGYKE 175
            ++PLK+SM + YNGK FKF+SKR ++C++C+             +   C+SC+G G+KE
Sbjct: 123 ARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHGHKE 182

Query: 176 QLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235
           +++RVA G V ++TV C  C+GKG+  + PT  ++ CKKC G+ +I E K LTV IPRGS
Sbjct: 183 RIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTVYIPRGS 240

Query: 236 RHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT 295
           R+GD +  EGEADQE  K  TGDL+F+++E   P     LERRG DL T + ISL+EAIT
Sbjct: 241 RNGDIVKLEGEADQEPDKV-TGDLLFVIEEN--PETSTNLERRGDDLHTRLKISLSEAIT 297

Query: 296 GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
           G ++ +T TLD R+LKL  P GKVI PG  I++E EGWPL+    KFGD+YV V I FP 
Sbjct: 298 GFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPP 357

Query: 356 DNWFAEKSDLLKIRNILPSEAANNDV--KADPGNTEQVSDMKLV---DQLPDYMGSNGDQ 410
           DNWF+EKSD+  +R +LP E  N  V    D  NTE V D  +V   D+LPDY+     +
Sbjct: 358 DNWFSEKSDVEVLRTLLP-EVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSYEKGE 416

Query: 411 YAHEGHASGAFPDDGTPQCAQQ 432
           Y  +    GAF +   PQCAQQ
Sbjct: 417 YQGQEQEYGAFEE---PQCAQQ 435

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  371 bits (952), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 196/445 (44%), Positives = 271/445 (60%), Gaps = 44/445 (9%)

Query: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
           M  Y+TLGV+ DATQ EIKKAYR+LALQHHPDKV+D+S+R+ESE++FKE+ AAYE+LS+E
Sbjct: 1   MDPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNE 60

Query: 61  EKRSKYDTYGDT----ADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD 116
           EKR  YDTYGDT     D   F+D  F                         P   R+DD
Sbjct: 61  EKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQS-----PPSPRTDD 115

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
             VP++++M + YNGK  +FQ+KR +VC +CE              + C  C+G G K++
Sbjct: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA---SACSQCEGHGVKQR 172

Query: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236
           LRR+ PG V ++ V C  C G GK +      ++ CKKC G+ +  E+K L V IPRGSR
Sbjct: 173 LRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRGSR 228

Query: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG 296
           HGDR+V +GEAD+E GK   GDL+F + E +       LERRG DL   I+ISL++A+TG
Sbjct: 229 HGDRVVLKGEADEEPGKI-PGDLVFDIAENSA---SSSLERRGSDLYAKITISLSDALTG 284

Query: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356
            ++ +  TLDGR+LKL  P G+V+ PG  ++++ EGWPL+   +KFGD+YV +DI FP D
Sbjct: 285 FEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPD 344

Query: 357 NWFAEKSDLLKIRNILP---SEAANNDVKA---DPGNTE---QVSDMKLVDQLPDYMGSN 407
           +WF+E+SD+  ++N+LP   S +A +D  A   DP NTE   + S +K  ++LP Y+   
Sbjct: 345 HWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEE 404

Query: 408 GDQYAHEGHASGAFPDDGTPQCAQQ 432
            +                 PQCAQQ
Sbjct: 405 SEP---------------GPQCAQQ 414

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  356 bits (914), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 197/444 (44%), Positives = 268/444 (60%), Gaps = 42/444 (9%)

Query: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
           M  YDTLGV+ DATQ EIKKAYR+LALQHHPDKV+D+S+REESE++FKE+ AAYE+LS+E
Sbjct: 1   MDPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNE 60

Query: 61  EKRSKYDTYGDTADGPD----FEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD 116
           EKR  YDTYGDT    D    F+D  F                       A+P   R+DD
Sbjct: 61  EKRRNYDTYGDTNGYSDSYGGFQDGDFA--SFFGNFASGRYEDEEDFRAHARP---RTDD 115

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
             V L+++M D YNGK  +FQS R +VC +CE              + C  C+G G K++
Sbjct: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA---SACTHCEGHGVKQR 172

Query: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236
           LRR+ PG V ++TV C  C G GK +      ++ CKKC G+ +  E K L V IPRGSR
Sbjct: 173 LRRLGPGFVTRETVQCTKCRGLGKNLRS----EDLCKKCHGKRVTPETKNLNVYIPRGSR 228

Query: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG 296
           H DRIV EGEAD+E GK  TGDL+F + E +       LERRG DL T I ISL++A+TG
Sbjct: 229 HNDRIVLEGEADEEPGKL-TGDLVFDISEDSTTSN---LERRGSDLHTKIIISLSDALTG 284

Query: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356
            ++ +  TLDGR L+L  P G+VI PG  I ++ EGWPL+    KFG++YV ++I FP D
Sbjct: 285 FEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPD 344

Query: 357 NWFAEKSDLLKIRNILP------SEAANNDVKADPGNTEQ--VSDMKLVDQLPDYMGSNG 408
           +W++E+ ++  +RNI+P      + +++   + DP NTE      +K  ++LP+Y+  + 
Sbjct: 345 HWYSERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTEMPTFDILKSAEELPNYLPDDA 404

Query: 409 DQYAHEGHASGAFPDDGTPQCAQQ 432
           +Q              G PQC+QQ
Sbjct: 405 EQ--------------GGPQCSQQ 414

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  348 bits (892), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 186/440 (42%), Positives = 269/440 (61%), Gaps = 27/440 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LY+ LG++  A++ E+K+AYR+LAL++HPDK++D+S RE SE +FKEI+AAY VLSDE+K
Sbjct: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 63  RSKYDTYGDTADGPDFEDE------SFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD 116
           R++YD +G T DG    DE       FM                            R+ D
Sbjct: 65  RAEYDQFG-TVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVG-----RTAD 118

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
             VPLK++    Y GK F+F+++RK++C +C                 C+ C+G+GYKE+
Sbjct: 119 STVPLKLTTKQLYLGKTFQFKARRKVLCPRC-GGSGLRKRAAARPMIRCEGCEGQGYKER 177

Query: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236
           + R+ PG+++++ VSC  C GKGK +  PT+  + CKKC G+ +++E   ++V +PRGS+
Sbjct: 178 ISRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235

Query: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG 296
           HGDR+ + G++D E GK +TGDL+F++DE T+      LER+G DL   + ISLAEA+TG
Sbjct: 236 HGDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSS--LERKGTDLYCTMKISLAEALTG 292

Query: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356
             R +T+T D RVL+++ P GKV+ PG  +K   EGWP+   A +FGD+YV V I FP+D
Sbjct: 293 FTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-RFGDMYVQVLIEFPKD 351

Query: 357 NWFAEKSDLLKIRNILPSEAANNDVKA-DPGNTEQVSDMKLVDQ---LPDYMGSNGDQYA 412
           NWF EK++L  IRNILP  A     K  DP NTE+V    ++     LPDY+      Y+
Sbjct: 352 NWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYS 411

Query: 413 HEGHASGAFPDDGTPQCAQQ 432
            + H S A    GTP+C  Q
Sbjct: 412 RQQHESTA----GTPECPMQ 427

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  348 bits (892), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/459 (43%), Positives = 273/459 (59%), Gaps = 60/459 (13%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEVRFKEITAAYEVL 57
           LY  L V +  TQ E+KK YRKLAL++HPDKV      +D V+ E E++FKEI +AYE+L
Sbjct: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 58  SDEEKRSKYD---TYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRS 114
           SDEEKR +YD    + D   G D+ D                             G+  S
Sbjct: 72  SDEEKRKQYDLQKNFRDANQGSDYGD-----------------------GINTAFGNQTS 108

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXX---QTNCKSCQGR 171
            D+ +PLKV++ D YNGK+ ++  KR ++CEKC                  T CK+C G 
Sbjct: 109 KDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           GYK+  +++APG   +Q + C  C GKG+Y  KP S KN C KC G+G+IE ++ +TV+I
Sbjct: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228

Query: 232 PRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRG-YDLITNISISL 290
           PRGS   D I+ + +ADQE+GK KTGDLIF+++E  +  E   L+R G  DLIT ++ISL
Sbjct: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD--EQTALKRYGDKDLITELTISL 286

Query: 291 AEAITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLV 349
           A+AITG  ++ + KTLDGR+L+LS P GKVI  G I+KVE EGWPLN +AT+ GDLY+  
Sbjct: 287 ADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKF 346

Query: 350 DIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKAD-------------PGNTEQVSDMKL 396
           +I FP DNW +E +D++KIRN+LP   A +D KAD               N+E +S+   
Sbjct: 347 NIEFPADNWNSEMNDIIKIRNLLP---AISDAKADILGDMPKDDIFNITMNSEDISNYDF 403

Query: 397 VDQLPDYMGS---NGDQYAHEGHASGAFPDDGTPQCAQQ 432
           V  LPD + +   NG +Y H G  S  F +   P+C+QQ
Sbjct: 404 VKDLPDIIDTSHNNGAEYGHNGD-SANFTE--MPECSQQ 439

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  338 bits (866), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 259/426 (60%), Gaps = 18/426 (4%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LY  LG+  +AT+ E+K+AYR LAL +HPDK++D+S R ESE +FKEI+AAY++LSDE+K
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 63  RSKYDTYGDTADGP----DFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQ 118
           RS+YD YG   +G     DF+D+                          Q    ++ D  
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFV 124

Query: 119 VPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLR 178
           VPLK+S    Y GK F+F+ KR ++C KCE                C  C GRG+KE++ 
Sbjct: 125 VPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP-MKCGICDGRGFKERVS 183

Query: 179 RVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHG 238
           R++PG ++++ V C  C GKG  VS+  S+   CKKC G+ +I E   LT+ +PRG RH 
Sbjct: 184 RISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLYVPRGHRHA 241

Query: 239 DRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLD 298
           D I  +G+AD E GK +TGDL+F +DE T+P     LER+G DL  +I+ISLAEA+TG  
Sbjct: 242 DTIRIDGQADMEAGK-ETGDLVFEIDEITDPD--AELERKGTDLHCSITISLAEALTGFT 298

Query: 299 RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNW 358
           R + +T D R+L+++ P+GKV+ PG  +K   EGWP+N + ++FGDLYV V+I FP+DNW
Sbjct: 299 RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKVNIEFPKDNW 357

Query: 359 FAEKSDLLKIRNILP----SEAANNDVKADPGNTEQVSDMKLV---DQLPDYMGSNGDQY 411
             EKS+L  I++ILP    S  ++     DP NTE ++   ++    +LPDY+   G Q 
Sbjct: 358 LNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQR 417

Query: 412 AHEGHA 417
           +++ + 
Sbjct: 418 SNQQYG 423

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 182/432 (42%), Positives = 247/432 (57%), Gaps = 36/432 (8%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y+ LGV++DAT  EIKK YRKLALQ+HPDK  D+  +  +E++FK+ITAAY+ LSDE+KR
Sbjct: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLKV 123
           ++YD   +    P FE + F                             RS D++V L +
Sbjct: 74  NEYDNKKNFE--PYFESD-FANNHDGNYNSRYRS---------------RSKDIKVELSL 115

Query: 124 SMADCYNGKVFKFQSKRKIVCEKCE---XXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
             ++ YNGK  KF + R  +C+ C                 +  C+ C G+GYK    ++
Sbjct: 116 KTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQL 175

Query: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240
           APG    Q V C  C G GKY  KP S KN CK C G+ +I+   P+ VSIPRGS +GD 
Sbjct: 176 APGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDN 235

Query: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGL-DR 299
           I+ +GEAD+E+GK   GDLIF ++E  +      LER G  LI +  ISLAEAITG  ++
Sbjct: 236 IILKGEADEELGKKNAGDLIFEINEIIDSNND--LERYGNHLINHTHISLAEAITGFENK 293

Query: 300 TLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWF 359
            + KT D R L LSTP GKVI PG I++V+ EGWP++ +   FG+LYV+++I FP DNW 
Sbjct: 294 FIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWI 353

Query: 360 AEKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQYAHEGHASG 419
            EK+D++KIRNILP+E    +   DP N+E +S  ++V  LP   G   +Q  H      
Sbjct: 354 NEKNDIIKIRNILPNEKTKRNNIVDPINSEYISTFEIVKSLPQEEGE--EQTEH------ 405

Query: 420 AFPDDGTPQCAQ 431
               D  P CAQ
Sbjct: 406 ----DTNPSCAQ 413

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  330 bits (846), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/448 (41%), Positives = 256/448 (57%), Gaps = 28/448 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YD LGV +DAT+VEI+KAYRKLAL++HPDK+ D++ RE SE  FKE+TAAYE+LSD E +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 64  SKYDTYGDTADGP--------DFEDESFMXXXXXXXXXXXX-XXXXXXXXXXAQPGDDRS 114
           S+YD YGD+A G         D E + FM                        +P   R+
Sbjct: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYK 174
            D ++  K++    Y GK   FQ KRK +C  C              + +C SC G+G+K
Sbjct: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHC-SGTGLRKKHFQKPEISCTSCNGQGFK 252

Query: 175 EQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRG 234
           E++ R+A G + +    C  C GKG+Y  K  S+   CK C G+G+I E K  TV IPRG
Sbjct: 253 ERITRLAGGYMVKDHTVCDACKGKGRYRKKSASD--TCKHCSGKGLINEEKSQTVYIPRG 310

Query: 235 SRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAI 294
           SRHGD       AD E GK +TGD+I ++DE +       LER+  DL T ++ISL +A+
Sbjct: 311 SRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDSSKS---HLERKSNDLHTTLNISLVDAL 366

Query: 295 TGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFP 354
           TG    + +T D R L+++ PAGKVI PG   K + EGWPL S+   FGD+YV ++I FP
Sbjct: 367 TGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL-SNGDSFGDMYVQINIEFP 425

Query: 355 RDNWFAEKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLV---DQLPDYMGSNGDQY 411
           +DNWF EKS++  +RNILP   + +    DP NTE V    ++   D+LPDY+    ++Y
Sbjct: 426 KDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKY 485

Query: 412 ----AHEGHASGAFPDDGT---PQCAQQ 432
                 E HAS AF +D T    +CA Q
Sbjct: 486 NRKQQEEPHAS-AFDNDYTQMPSECATQ 512

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  304 bits (779), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 171/426 (40%), Positives = 240/426 (56%), Gaps = 27/426 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGV++DAT  EIK AYRKLAL+HHPDK  D   +E +E++FKEITAAYE+LSD EK
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEK 69

Query: 63  RSKYDTYGDT--------ADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRS 114
           +S YD YGD         A+G   ED                           +     S
Sbjct: 70  KSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEGNSTSS 129

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQ-TNCKSCQGRGY 173
            D+ + + +++ D Y GK  KF  KR+++C KC                  C+SC G+G 
Sbjct: 130 KDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVECESCAGKGS 189

Query: 174 KEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPR 233
           KE+L+R  PG+VA Q V C  C+GKGKY  +P + KN C  C G G++ + + +TV++  
Sbjct: 190 KERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEIITVNVAP 249

Query: 234 GSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNIS 287
           G    D I  +G AD+E+ K+  GDL F + E  E  E  ++  + +      DL T+I+
Sbjct: 250 GHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGEDLYTSIT 309

Query: 288 ISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL--NSHATKFGDL 345
           ISL+EA+TG ++ LTKT D R+L LS   G+V+ PG  IK+  EGWP+  N H  + GDL
Sbjct: 310 ISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNPHG-RCGDL 368

Query: 346 YVLVDIVFPRDNWFAEKSDLLKIRNILPSEAA-------NNDVKADPGNTEQVSDMKLV- 397
           YV V I FP DNWF EKS+LL I+  LPS ++       N +  ++  N E +S+ +++ 
Sbjct: 369 YVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNETISNFRIIH 428

Query: 398 -DQLPD 402
            D LP+
Sbjct: 429 TDDLPE 434

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  299 bits (766), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 248/449 (55%), Gaps = 29/449 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGV+ DA+  EIK AYRKLAL+HHPDK  D + +E +E++FKEITAAYE+LSD EK
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69

Query: 63  RSKYDTYGDT--------ADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRS 114
           +S YD YGD         ADG   +D                           +     S
Sbjct: 70  KSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYEEDKCKSS 129

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXX-XXXXXXXXXXXQTNCKSCQGRGY 173
            D+ + + +++ D Y GK  KF+ KR+IVC  C               +  C+SC G+G 
Sbjct: 130 KDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGS 189

Query: 174 KEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPR 233
           KE+L+R  PG+VA Q V+C  CHGKGKYV +P + KN C  C G G+  + + +TV++  
Sbjct: 190 KERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAP 249

Query: 234 GSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNIS 287
           G    D I  +G AD+E+ KS  GDL F + E  E  E  ++  + +      DL T+ +
Sbjct: 250 GHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSAT 309

Query: 288 ISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP-LNSHATKFGDLY 346
           ISL+EA+TG ++ LT+T D R+L LS   G+VI PG +IK+  EGWP ++    + GDLY
Sbjct: 310 ISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLY 369

Query: 347 VLVDIVFPRDNWFAEKSDLLKIRNILPSE--------AANNDVKADPGNTEQVSDMKLVD 398
           V + I FP DNWF EKS+LL I+ +LPS         A   +   +P N E +S+ ++++
Sbjct: 370 VFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQIIN 429

Query: 399 --QLPDYM---GSNGDQYAHEGHASGAFP 422
             +LP+ M    S     AH+   S   P
Sbjct: 430 MEELPEGMKIFNSESQNSAHQKAKSSYCP 458

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  299 bits (765), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 239/424 (56%), Gaps = 22/424 (5%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGV+++A+  EIK AYRKLAL+HHPDK  D   +E +E +FKEITAAYE+LSD EK
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXX---XXXXAQPGDD--RSDDV 117
           +S YD YGD       ++                                G++   S D+
Sbjct: 70  KSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDI 129

Query: 118 QVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXX-XXXXXXXXXXXQTNCKSCQGRGYKEQ 176
            + L  +M D Y GK  KF+ KR+I+C KC+              +  C+SC G+G KE+
Sbjct: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKER 189

Query: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236
           L+R  PG+VA Q V C  CHGKGKY  +P + KN C  C   G+  + + +TV++P G  
Sbjct: 190 LKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249

Query: 237 HGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNISISL 290
             D +  +G AD+E+ K+  GDLIF + E  E  +  ++  + +      DL  +I++SL
Sbjct: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSL 309

Query: 291 AEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHAT-KFGDLYVLV 349
           +EA+TG ++ LT+T D R+L LS   GKVI PG IIK+  EGWP+  H   + GDLYV V
Sbjct: 310 SEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFV 369

Query: 350 DIVFPRDNWFAEKSDLLKIRNILPSEAA-------NNDVKADPGNTEQVSDMKLV--DQL 400
           DI FP DNWF EKS+LL I+  LPS  +       N      P N+E VS+ +++  D L
Sbjct: 370 DIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIHSDDL 429

Query: 401 PDYM 404
           P+ M
Sbjct: 430 PEGM 433

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  288 bits (736), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 170/421 (40%), Positives = 239/421 (56%), Gaps = 21/421 (4%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LY  LGV++DA   EIK AYRKLAL+HHPDK  D   ++ +E++FKEITAAYE+LSD EK
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69

Query: 63  RSKYDTYGD---TADG---PDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDR--S 114
           +S YD YGD   TA+G     F ++ FM                          +D   S
Sbjct: 70  KSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSASS 129

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXX-XXXXXXXXXXXQTNCKSCQGRGY 173
            D+ + + ++M D Y GK  +F  KR++VC KC               +  C+SC G+G 
Sbjct: 130 KDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKGS 189

Query: 174 KEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPR 233
           KE+L+R  PG+VA Q V C  CHGKGKY   P + KN C  C G G+  + + +TV +  
Sbjct: 190 KERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVAP 249

Query: 234 GSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNIS 287
           G    D I  EG AD+E+GK+  GDL F ++E  E     ++  + +      D   +++
Sbjct: 250 GHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMEDSYVSVT 309

Query: 288 ISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP-LNSHATKFGDLY 346
           ISL+EA+TG ++ LTKT D R+L LS   G+VI PG ++K+  EGWP L+    + GDLY
Sbjct: 310 ISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGRCGDLY 369

Query: 347 VLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPG---NTEQVSDMKLV--DQLP 401
           V + I FP DNWF EKS+LL I+  LPS ++++    D     N E VS+ +++  D LP
Sbjct: 370 VFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQIIHTDDLP 429

Query: 402 D 402
           +
Sbjct: 430 E 430

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  280 bits (716), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/459 (38%), Positives = 251/459 (54%), Gaps = 34/459 (7%)

Query: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEVRFKEITAAYE 55
           M  Y  LGV QDA+Q EIK+AYRKLAL+HHPDK       +DS  +  +V FKE+TAAY+
Sbjct: 1   MDYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQ 60

Query: 56  VLSDEEKRSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSD 115
           VLSD   R++YD        P + D+ FM                            +SD
Sbjct: 61  VLSDASLRAEYDQKLAFEAQP-YGDDDFMNFFSGFNGGSHPGHRSGFDSGRGAR-RYKSD 118

Query: 116 DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTN------CKSCQ 169
           D+++ LKV  ++ Y GK   F  KRK  C++C+             +T       C+ C+
Sbjct: 119 DIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWNVCEGCE 178

Query: 170 GRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQ---GMIEEAKP 226
           G+G +++LR++APG V  + + C  C GKGK  + P SEKN+C  C      GM+EE K 
Sbjct: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238

Query: 227 LTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNI 286
           +T++I +G+  GD+IV +GEAD+++  ++ GDL+  + E  EP     + R GYDLI   
Sbjct: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQ--YDIVRNGYDLIIKK 296

Query: 287 SISLAEAITGLD-RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL------NSHA 339
            I LA+AI G D + L +T DGRVLK S+  GKVI P  I++++ EGWP       N+  
Sbjct: 297 QIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTL 356

Query: 340 TKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPG----NTEQVSDMK 395
            K GDLYV+VDIVFP DNW  E +D   +RNI+PS   N    +  G    N E ++  +
Sbjct: 357 LKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPS-TINKRESSTSGESILNVENINVSE 415

Query: 396 LVDQLP--DYMGSNGDQYAHEGHASGAFPDDGTPQCAQQ 432
           +V ++P  D +    D Y +  +  G  P   TP C+QQ
Sbjct: 416 IVKEIPNCDELPKFQDTYDNT-NDKGESP-FWTPNCSQQ 452

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  270 bits (690), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 159/432 (36%), Positives = 243/432 (56%), Gaps = 19/432 (4%)

Query: 1   MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSD- 59
           ++ YD LGV +D+T  EI+KAYRKLAL+ HPDKV D   +  +E++FKEIT AYE+LS+ 
Sbjct: 4   LNPYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNG 63

Query: 60  EEKRSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD-VQ 118
           E      + Y     G +F D+ FM                       Q  D+ +++  Q
Sbjct: 64  EYVEEMEEEYEGQGYGFNFGDD-FMNFFNEGRNAHPMGGH-------PQREDESTNEATQ 115

Query: 119 VPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQ---TNCKSCQGRGYKE 175
           + ++V++ D YNGK  KFQ  R ++C  C+                  +C  C+G GY E
Sbjct: 116 IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVE 175

Query: 176 QLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235
           +L   +P     Q +SC  C GKG+Y +KPTS+KN+CK C G+G+I+E + L V+IPRGS
Sbjct: 176 RLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGS 235

Query: 236 RHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEG---VRLERRGYDLITNISISLAE 292
            + + I+F+ + D+++   + GD++F +    EP  G   + + + G DL  NI I L E
Sbjct: 236 ENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIE 295

Query: 293 AITGLD-RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDI 351
           AI+G   R LTKT D RVLKL+ P GKV+ PG  I ++ EGWP   + T+FGD++V V++
Sbjct: 296 AISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNV 355

Query: 352 VFPRDNWFAEKSDLLKIRNILPSEAANND--VKADPGNTEQVSDMKLVDQLPDYMGSNGD 409
            FP DNW +E++D+  + N+LP+  +++      D  N E V D +++    +   S+  
Sbjct: 356 EFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDEGTRSSNT 415

Query: 410 QYAHEGHASGAF 421
           + A    A G +
Sbjct: 416 KTASRPPAQGLY 427

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  182 bits (463), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 185/372 (49%), Gaps = 24/372 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS  A+  EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYEVLSD EK
Sbjct: 7   LYDILGVSPTASDSEIKKAYRKQALKYHPDK----NPSEEAAEKFKEASSAYEVLSDSEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G   DG                                  G  R  D++  + 
Sbjct: 63  RDIYDQFGQ--DGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRDIKHEIS 120

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
           VS+ + Y GK  K    ++I+C+ CE                C SC G+G K   R++ P
Sbjct: 121 VSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAV-----KKCSSCNGQGIKFVTRQMGP 175

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C +CHG G  +      K++CK C G+ +  E K L V++  G ++G ++V
Sbjct: 176 -MIQRFQTECDVCHGTGDIIDA----KDRCKDCHGKKIANERKILQVNVDPGMKNGQKVV 230

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ       GD+IF++ E          +R G DLI    I L  A+ G +  L 
Sbjct: 231 FKGEADQ-APDIIPGDVIFVISEKPHK----HFQRVGDDLIYEAEIDLLTAVAGGEFAL- 284

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+S   G+VI+P     VE +G P+  +   +G+L +   I FP +N FA++
Sbjct: 285 EHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGG-YGNLIIKFSIKFP-ENHFADE 342

Query: 363 SDLLKIRNILPS 374
             L K+  ILP+
Sbjct: 343 DTLKKLEEILPA 354

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  182 bits (462), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 139/438 (31%), Positives = 212/438 (48%), Gaps = 42/438 (9%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS DA   +IKKAYRK AL++HPDK    +  EE+  +FK+IT AYE+LSD +K
Sbjct: 7   LYDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G+       +                              G  +  D++  + 
Sbjct: 63  REMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIRHDIS 122

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++ + Y G+  K    + ++C++CE                C SC G+G K   R + P
Sbjct: 123 CTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSV-----KKCTSCNGQGVKFVTRHMGP 177

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +   +C +C+G+G  +  P +++  CK C G+ +  E K L V+I  G +HG +IV
Sbjct: 178 -MIQRFQTTCEVCNGEGDVI--PAADR--CKDCDGKKIASERKILEVNIQPGMKHGQKIV 232

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ+ G+   GD++F+V+E   P    R  R G +L     I L  AI G    L 
Sbjct: 233 FQGEADQQPGQI-PGDVVFVVNEQEHP----RFVRNGDNLHYEAEIDLLTAIAGGQFAL- 286

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+    G+VI+PG +  +E +G P+  + + +GDL +  ++ FP+ + FA++
Sbjct: 287 EHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKFPKSH-FADE 344

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLP---DYMGSNG-----DQYAHE 414
             L K+  ILP +     +   P N E V +  L D  P   D    NG     D    E
Sbjct: 345 EALKKLEAILPPKT----LPRIPPNAE-VEECVLADFEPAKHDSRSGNGRGQSYDSDEEE 399

Query: 415 GHASGAFPDDGTPQCAQQ 432
            H  G        QCA Q
Sbjct: 400 AHTEGV-------QCASQ 410

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  181 bits (458), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 203/431 (47%), Gaps = 28/431 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  A++ EIKK YRK AL++HPDK    +   E+  +FKE +AAYEVLSD EK
Sbjct: 7   FYDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDPEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD YG+                                      G  +  D++  + 
Sbjct: 63  RDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDIKHEIA 122

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++ + Y G+  K    ++I+C+ CE                C SC G+G K   +++ P
Sbjct: 123 ATLEELYKGRTAKLALNKQILCKSCEGRGGKADAV-----KKCSSCGGQGIKFVTKQMGP 177

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C +CHG G  +      K +CK C G+ +  E K L V I  G + G RIV
Sbjct: 178 -MIQRFQTECDVCHGTGDIIDP----KGRCKSCHGKKIANERKILEVKIEPGMKDGQRIV 232

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GE+DQ       GD++F+V+E          +R G DL+    I L  AI G +  L 
Sbjct: 233 FKGESDQ-APDIIPGDVVFVVNEKPHK----HFQRSGNDLVYLAEIDLLTAIAGGEFAL- 286

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK++  AG+VI+PG    +E +G P+  +   +G+L +  +I FP +N F ++
Sbjct: 287 EHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGG-YGNLIIQFNIKFP-ENHFTDE 344

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLP-DYMGSNGDQYAHEGHASGAF 421
           S+L K+  ILP     N V   P   E V +  L D  P  Y  SNG   +++     A 
Sbjct: 345 SNLKKLEEILPP---RNKVTI-PAKAE-VEECVLADYDPAKYRTSNGRGQSYDSDDEDAH 399

Query: 422 PDDGTPQCAQQ 432
                 QCA Q
Sbjct: 400 GGAEGVQCASQ 410

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  179 bits (454), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 143/442 (32%), Positives = 205/442 (46%), Gaps = 53/442 (11%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYDTLGVS  A+  EIKKAYRK AL++HPDK    +  EE+  +FKE+++AYE+LSD +K
Sbjct: 7   LYDTLGVSPGASDAEIKKAYRKSALKYHPDK----NPSEEAAEKFKEVSSAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD +G+                                    +P G  R  D++  +
Sbjct: 63  REVYDQFGEEG----LSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHEM 118

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
             S+ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ 
Sbjct: 119 AASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAV-----KKCSSCNGQGIKFVTRQMG 173

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C +CHG G  +      K++CK C G+ +  E K L V I  G + G +I
Sbjct: 174 P-MIQRFQTECDVCHGTGDIIDA----KDRCKSCNGKKVDNERKILEVRIEPGMKDGQKI 228

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD++F++ E          +R G DLI    I L  A+ G    L
Sbjct: 229 VFKGEADQ-APDVIPGDVVFVISEKPHK----HFQRAGDDLIYEAEIDLLTALAGGQFAL 283

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK+    G+VI+PG    VE +G P+  +   +G+L +  +I FP +N F  
Sbjct: 284 -EHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKFNIKFP-ENHFTS 340

Query: 362 KSDLLKIRNIL-PSEAANNDVKADPGNTEQVSDMKLVDQLPDYMG-SNG---------DQ 410
           + +L K+  IL P    N   KA      QV D  L +  P   G SNG         D+
Sbjct: 341 EENLKKLEEILPPRRQINIPAKA------QVDDCVLSEFDPSKFGQSNGRSGANYDSDDE 394

Query: 411 YAHEGHASGAFPDDGTPQCAQQ 432
            AH G            QCA Q
Sbjct: 395 DAHGGEGV---------QCASQ 407

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  178 bits (452), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 184/372 (49%), Gaps = 25/372 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGV   AT VEIKKAYRK AL++HPDK    +  EE+  +FKE +AAYE+LSD EK
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASAAYEILSDPEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD +G+  DG      +                         +P G  R  D++  +
Sbjct: 63  RDIYDQFGE--DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEI 120

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
             S+ + Y G+  K    ++I+C++CE                C SC G+G K   R++ 
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGGKKGAV-----KKCTSCNGQGIKFVTRQMG 175

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C +CHG G  +      K++CK C G+ +  E K L V +  G + G RI
Sbjct: 176 P-MIQRFQTECDVCHGTGDIIDP----KDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 230

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD++FIV E          +R G DL+    I L  AI G +  L
Sbjct: 231 VFKGEADQ-APDVIPGDVVFIVSERPHK----SFKRDGDDLVYEAEIDLLTAIAGGEFAL 285

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK+    G+VI+PG    +E +G P+  +   +G+L +   I FP +N F  
Sbjct: 286 -EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFP-ENHFTS 342

Query: 362 KSDLLKIRNILP 373
           + +L K+  ILP
Sbjct: 343 EENLKKLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  178 bits (451), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 184/372 (49%), Gaps = 25/372 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  AT VEIKKAYRK AL++HPDK    +  EE+  +FKE ++AYE+LSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD +G+  +G      +                         +P G  R  D++  +
Sbjct: 63  REVYDQFGE--EGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEI 120

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
             S+ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ 
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAV-----KKCSSCNGQGIKFVTRQMG 175

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C +CHG G  +      K++CK C G+ +  E K L V +  G + G RI
Sbjct: 176 P-MIQRFQTECDVCHGTGDIIDP----KDRCKSCNGKKVENERKILEVHVEPGMKDGQRI 230

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD++FIV E          +R G DL+    I L  AI G +  L
Sbjct: 231 VFKGEADQ-APDVIPGDVVFIVSERPHK----NFKRDGDDLVYEAEIDLLTAIAGGEFAL 285

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK+    G+VISPG    +E +G P+  +   +G+L +   I FP +N F  
Sbjct: 286 -EHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVIKFTIKFP-ENHFTT 342

Query: 362 KSDLLKIRNILP 373
           + +L K+  ILP
Sbjct: 343 EENLKKLEEILP 354

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  177 bits (449), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 191/396 (48%), Gaps = 31/396 (7%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS  A   +IKKAYRK AL+ HPDK    +  EE+  +FKEIT+AYE+LSD +K
Sbjct: 7   LYDLLGVSPGADDNQIKKAYRKSALKFHPDK----NPSEEAAEKFKEITSAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G          +                            G  +  D++  + 
Sbjct: 63  REVYDQFGLEG----LSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHEIP 118

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++   + G+  K    ++++C+ CE                C +C G+G+K   R++ P
Sbjct: 119 ATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSV-----KKCTACSGQGFKFVTRQMGP 173

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +  V C  CHG G+ +      K +CK C G+ ++ E K L V+I  G + G RIV
Sbjct: 174 -MIQRFQVECESCHGAGEIIDP----KGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRIV 228

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ  G    GD++F+V E   P      +R G DL  +  I L  AI G  +   
Sbjct: 229 FQGEADQSPG-IIPGDVVFVVSEQPHP----VFKRDGNDLHYDAEIDLLSAIAG-GQFAV 282

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           K + G  LK+    G+VISPG +  +E +G P+  +   +G+L +  +I FP  + F + 
Sbjct: 283 KHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGG-YGNLLIKFNIKFPPAH-FTDD 340

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVD 398
             L K+  ILP      +V + P + E V D  L D
Sbjct: 341 ETLKKLEEILPP----RNVPSIPADAE-VEDCVLAD 371

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  176 bits (447), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 184/373 (49%), Gaps = 26/373 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  AT VEIKKAYRK AL++HPDK    +  EE+  +FKE ++AYE+LSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDK----NPSEEAAEKFKEASSAYEILSDSEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP--GDDRSDDVQVP 120
           R  YD +G+  DG      +                        AQ   G  R  D++  
Sbjct: 63  RDVYDQFGE--DGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGPQRGKDIKHE 120

Query: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
           +  S+ + Y G+  K    ++I+C+ CE                C SC G+G K   R++
Sbjct: 121 ISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAV-----KKCSSCNGQGIKFVTRQM 175

Query: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240
            P M+ +    C +CHG G  V      K++CK C G+ +  E K L V +  G + G R
Sbjct: 176 GP-MIQRFQTECDVCHGTGDIVDP----KDRCKSCNGKKVENERKILEVHVEPGMKDGQR 230

Query: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRT 300
           IVF+GEADQ       GD++F+V E          +R G DL+    I L  AI G +  
Sbjct: 231 IVFKGEADQ-APDVIPGDVVFLVSERPHK----SFKRDGDDLVYEAEIDLLTAIAGGEFA 285

Query: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFA 360
           L + + G  LK+    G+VI+PG    +E +G P+  +   +G+L +   + FP +N F 
Sbjct: 286 L-EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIIKFTVKFP-ENHFT 342

Query: 361 EKSDLLKIRNILP 373
            + +L K+  ILP
Sbjct: 343 AEENLKKLEEILP 355

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  176 bits (446), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/372 (33%), Positives = 186/372 (50%), Gaps = 24/372 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS +A++ EIKK YRK AL++HPDK    +  EE+  +FKE +AAYEVLSD +K
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDK----NPSEEAAEKFKECSAAYEVLSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD YG+                                   + P   R  D++  ++
Sbjct: 63  REVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGP--QRGRDIKHEIQ 120

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ P
Sbjct: 121 NTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVK-----KCTSCNGQGIKFVTRQMGP 175

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C +CHG G  +      K++CK C+G+ +  E K L V +  G R G +IV
Sbjct: 176 -MIQRFQTECDVCHGSGDIIDP----KDRCKDCKGKKIANERKVLEVHVEPGMREGQKIV 230

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ       GD+IF+V    E P     +R G DL+    I L  AI G +  + 
Sbjct: 231 FKGEADQ-APDVIPGDVIFVV---VEKPHK-HFKRAGDDLLYEAEIDLLTAIAGGEFAI- 284

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+ST  G+VIS G    +E +G P+  +   +G+L V   I FP +N FA +
Sbjct: 285 QHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG-YGNLIVTFKIKFPENN-FATE 342

Query: 363 SDLLKIRNILPS 374
             L ++ NILP+
Sbjct: 343 DKLKELENILPA 354

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  176 bits (446), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 128/375 (34%), Positives = 183/375 (48%), Gaps = 25/375 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  AT VEIKKAYRK AL+ HPDK    +  EE+  +FKE ++AYEVLSD EK
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDK----NPSEEAAEKFKEASSAYEVLSDSEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD +G+  DG      +                         +P G  R  D++  +
Sbjct: 63  REVYDQFGE--DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRGRDIKHEI 120

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
             S+ + Y G+  K    ++I+C++CE                C  C G+G K   R++ 
Sbjct: 121 SASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVK-----KCTGCNGQGIKFVTRQMG 175

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C  CHG G  V      K++CK C G+ +  E K L V +  G + G +I
Sbjct: 176 P-MIQRFQTECDACHGTGDIVDP----KDRCKSCNGKKIENERKILEVHVEPGMKDGQKI 230

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD++F+V E          +R G DL+    I L  AI G +  L
Sbjct: 231 VFKGEADQ-APDVIPGDVVFLVSERPHK----HFKRDGDDLVYEAEIDLLTAIAGGEFAL 285

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK+    G+VI+PG    +E +G P+  +   +G+L V   I FP +N F  
Sbjct: 286 -EHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIVKFTIKFP-ENHFTT 342

Query: 362 KSDLLKIRNILPSEA 376
           + +L K+  ILP  A
Sbjct: 343 EENLKKLEEILPPRA 357

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  175 bits (444), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 199/409 (48%), Gaps = 31/409 (7%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS +A++ EIKK YRK AL++HPDK   D   E    +FKE + AYEVLSD +K
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE----KFKECSGAYEVLSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD YG+                                   ++P G  R  D++  +
Sbjct: 63  REIYDQYGEEGL---SGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGKDIRHEI 119

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
           + ++ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ 
Sbjct: 120 QNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAV-----KKCSSCGGQGVKFVTRQMG 174

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C +CHG G  +      K++CK+C+G  +  E K L V +  G R G ++
Sbjct: 175 P-MIQRFQTECDVCHGSGDIIDP----KDRCKECKGNKVANERKVLEVHVEPGMREGQKV 229

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
            F+GEADQ       GD+IF+V   TE P     +R G DL+    + L  AI G D  +
Sbjct: 230 TFKGEADQ-APDIIPGDVIFVV---TEKPH-KHFKRSGDDLLYEAEVDLLTAIAGGDFAI 284

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK++   G+VISPG    ++ +G P+  +   +G+L +   I FP +N FA+
Sbjct: 285 -EHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKFP-ENHFAD 341

Query: 362 KSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPDYMGSNGDQ 410
           ++ L  + +ILP      +VK  P     + D  L +  P   G+N ++
Sbjct: 342 EAKLKALEDILPP---RTEVKIPP--KAHIDDCVLTEFDPVKYGNNNNR 385

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  174 bits (441), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/431 (30%), Positives = 202/431 (46%), Gaps = 29/431 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS  AT VEIKKAYRK+AL+ HPDK    +  EE+  +FKE ++AYEVLSD +K
Sbjct: 7   LYDVLGVSVTATDVEIKKAYRKMALKFHPDK----NPSEEAAEKFKEASSAYEVLSDADK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G   +G                                  G  R  D++  + 
Sbjct: 63  RDTYDQFG--LEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQRGRDIKHEIN 120

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
           V++ + Y GK  K    ++I+C+ CE                C SC G+G K   R++ P
Sbjct: 121 VTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVK-----KCSSCNGQGIKFVTRQMGP 175

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C +CHG G  V      K++CK C G+ +  E K L V +  G ++G ++V
Sbjct: 176 -MIQRFQTECDVCHGAGDIVD----PKDRCKSCNGKKVASERKILEVHVDPGMKNGQKVV 230

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ       GD++F+++E          +R G +L+    + L  AI G +  + 
Sbjct: 231 FKGEADQ-APDVIPGDVVFVINEKPHK----HFQRSGDNLVYEAEVDLLTAIAGGEFAI- 284

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK++   G+VI+PG    ++ +G P+  +   +G+L +   + FP  + F  +
Sbjct: 285 EHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPEPH-FTTE 342

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLPD-YMGSNGDQYAHEGHASGAF 421
            +L K+  ILP       +   P N   V D  L +  P  Y G NG   ++        
Sbjct: 343 ENLKKLEEILPQRTP---LPQMPKNA-HVEDCVLAEFDPSKYDGRNGRGQSYASDEEDEG 398

Query: 422 PDDGTPQCAQQ 432
                 QCA Q
Sbjct: 399 QGGEGVQCASQ 409

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  174 bits (440), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 179/371 (48%), Gaps = 22/371 (5%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS DA   +IKKAYRK AL+ HPDK    +  EE+  +FKE+T AYE+LSD +K
Sbjct: 7   FYDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD  G+          +                           G  +  D++  + 
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIKHEMS 122

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            S+ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ P
Sbjct: 123 ASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAV-----KKCSSCNGQGIKFITRQMGP 177

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C +C G G  +      K++CK C G+ +  E K L V I  G + G +IV
Sbjct: 178 -MIQRFQAECDVCSGTGDIIDP----KDRCKSCNGKKIDNERKILEVHIEPGMKDGQKIV 232

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ  G    GD++F++ +          ER+G DL+    + L  AI G +  + 
Sbjct: 233 FQGEADQAPG-IIPGDVVFVISQRPHK----HFERKGDDLLYQAEVDLLSAIAGGEFAI- 286

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+S   G+VISPG    +E +G P+  +   +G+L V   I FP  N FA++
Sbjct: 287 EHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGG-YGNLIVTFKINFPT-NHFADE 344

Query: 363 SDLLKIRNILP 373
             L K+  ILP
Sbjct: 345 ESLKKLEEILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  173 bits (439), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 134/438 (30%), Positives = 211/438 (48%), Gaps = 43/438 (9%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS DA   +IKKAYRK AL++HPDK    +   E+  +FK++TAAYE+LSD +K
Sbjct: 7   LYDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G+                                    + G  +  D++  + 
Sbjct: 63  REVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPR-GPQKGRDIKHDIS 121

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++ + Y G+  K    + ++C+ CE                C SC G G K   R++ P
Sbjct: 122 CTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSV-----KKCSSCGGHGVKFVTRQMGP 176

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +   +C  C+G+G  +      K++C++C G+ +  E K L V+I  G ++G ++V
Sbjct: 177 -MIQRFQTTCEACNGEGDVIDP----KDRCRECSGKKISNERKILEVNIEPGMKNGQKVV 231

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ+ G+   GD++F+V+E   P    +  R G +L     I L  A+ G    L 
Sbjct: 232 FQGEADQQPGQI-PGDVVFVVNEQEHP----KFVRNGDNLHYEAQIDLLTAVAGGQFAL- 285

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+    G+VI+PG +  +E +G P+  + + +G+L +  ++ FP+ + FA  
Sbjct: 286 EHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGNLLIKFNVKFPKSH-FASD 343

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVDQLP---DYMGSNG-----DQYAHE 414
           +DL K+  ILP       +   P   E V +  L D  P   D   +NG     D    E
Sbjct: 344 ADLKKLEEILPPRV----LPGIPLKAE-VEECVLADFEPSKHDPRTANGRGQSYDSDEEE 398

Query: 415 GHASGAFPDDGTPQCAQQ 432
           GHA G        QCA Q
Sbjct: 399 GHAEGV-------QCASQ 409

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  173 bits (438), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 184/372 (49%), Gaps = 23/372 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  A++ EIKKAYRK AL++HPDK    +  EE+  +FKE ++AYEVL D EK
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDK----NPSEEAAEKFKEASSAYEVLMDAEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQP-GDDRSDDVQVPL 121
           R  YD +G+                                   ++P G  R  D++  +
Sbjct: 63  REAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRDIKHEI 122

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
            V++ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ 
Sbjct: 123 TVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVK-----KCTSCNGQGVKFITRQMG 177

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C  C G G  ++     K++CK C G+ +  E K L V +  G + G +I
Sbjct: 178 P-MIQRFQTECDACDGTGDIINP----KDRCKACSGKKVANERKILEVHVDPGMKDGQKI 232

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD+IF+V E   P +  R  R   DL+    I L  AI G +  +
Sbjct: 233 VFKGEADQ-APDIIPGDVIFVVSE--RPHKHFR--RDSDDLVYEADIDLLTAIAGGEFAI 287

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            + + G  LK+    G+VISPG    +E +G P+  +   FG+L V  +IVFP+D+ F  
Sbjct: 288 -EHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLVKFNIVFPKDH-FTS 344

Query: 362 KSDLLKIRNILP 373
             ++ K+  ILP
Sbjct: 345 LENMKKLEEILP 356

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 181/378 (47%), Gaps = 23/378 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGVS  A+  EIKKAYRK AL++HPDK    +  EE+  +FKE +AAYEVLSD+EK
Sbjct: 7   FYDILGVSPSASSSEIKKAYRKFALKYHPDK----NPSEEAAEKFKEASAAYEVLSDDEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXX-XXXXXXXXXXXXXXAQPGDDRSDDVQVPL 121
           R  YD +G                                        G  R  D++  L
Sbjct: 63  REMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRDIKHEL 122

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
             ++ + Y G+  K    ++I+C+ CE                C SC G+G K   R++ 
Sbjct: 123 SATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK-----KCSSCNGQGVKFVTRQMG 177

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P M+ +    C +CHG G  +      K++CK C  + +  E K L V I  G + G ++
Sbjct: 178 P-MLQRFQAECEVCHGTGDIID----PKDRCKTCNAKKVTNERKILEVHIEPGMKDGQKV 232

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTL 301
           VF+GEADQ       GD+IF+V +  +P E    +R G DL+    I L  AI G +  +
Sbjct: 233 VFKGEADQ-APDIIPGDVIFVVSQ--KPHE--HFQRAGDDLVYEAEIDLLTAIAGGEFAI 287

Query: 302 TKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAE 361
            K + G  LK++   G+VISPG    +  +G P+  +   +G+L V  +I FP  N F +
Sbjct: 288 -KHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGG-YGNLIVKFNIKFP-PNHFTD 344

Query: 362 KSDLLKIRNILPSEAANN 379
           +  L K+  ILP     N
Sbjct: 345 EESLKKLEEILPPRTKTN 362

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  169 bits (427), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 179/373 (47%), Gaps = 22/373 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YD LGVS  AT++EIKKAYRK AL++HPDK    +   E+  +FKE+++AYEVLSD EKR
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDSEKR 63

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLKV 123
             YD +G+                                      G  R  D++  + V
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRGRDIKHEIAV 123

Query: 124 SMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPG 183
           ++ + Y G+  K    ++I+C+ C                 C SC G+GYK   R++ P 
Sbjct: 124 TLEELYKGRTAKLALNKQILCKGCNGRGGKEGAV-----KKCSSCNGQGYKFVTRQMGP- 177

Query: 184 MVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIVF 243
           M+ +    C  C G G  +      K++CK C G+ +  E K L V +  G + G +IVF
Sbjct: 178 MIQRFQTECEACAGTGDIIDP----KDRCKSCNGKKVANERKILEVHVDPGMKDGQKIVF 233

Query: 244 EGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLTK 303
           +GEADQ       GD+IF+V E          +R G DL+    I L  A+ G + +L +
Sbjct: 234 KGEADQ-APDVIPGDVIFVVSEKPHK----NFQRVGDDLVYEAEIDLLTAVAGGEFSL-E 287

Query: 304 TLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEKS 363
            + G  LK++   G+VISPG    VE +G P+      +G+L V   I FP  N F    
Sbjct: 288 HVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGG-YGNLLVTFKINFP-PNHFTSDE 345

Query: 364 DLLKIRNILPSEA 376
           +L K+  ILP  A
Sbjct: 346 NLKKLEEILPPRA 358

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  165 bits (418), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/374 (32%), Positives = 176/374 (47%), Gaps = 23/374 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
            YD LGV  DA   +IKK YRK AL+ HPDK    +   E+  +FKE+T AYEVLSD +K
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD  G+          +                         + G  +  D++  + 
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPR-GPQKGRDIKHEMS 121

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            S+ + Y G+  K    ++++C+ CE                C SC G+G K   R++ P
Sbjct: 122 ASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAV-----KKCASCNGQGVKFITRQMGP 176

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C  C+G G  V      K++CK C G+ +  E K L V I  G + G +IV
Sbjct: 177 -MIQRFQAECDACNGTGDIVDP----KDRCKTCNGKKIDNERKILEVHIEPGMKDGQKIV 231

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ  G    GD+IF++ +          ER+G +L     + L  AI G +  + 
Sbjct: 232 FQGEADQAPG-VIPGDVIFVISQRPHK----HFERKGDNLYYQAEVDLLSAIAGGEFAI- 285

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+    G+VISPG    +E +G P+  +   FGDL V   + FP  N FA++
Sbjct: 286 EHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPT-NHFADE 343

Query: 363 SDLLKIRNILPSEA 376
             L K+  ILP  A
Sbjct: 344 ESLKKLEEILPPRA 357

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  163 bits (412), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 184/396 (46%), Gaps = 27/396 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD +GVS  A   +IKKAYRK AL++HPDK    +  EE+  +FKEI++AYE+LSD +K
Sbjct: 7   LYDLIGVSPGADDAQIKKAYRKAALKYHPDK----NPTEEAAEKFKEISSAYEILSDSQK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLK 122
           R  YD +G+                                      G  +  D++  + 
Sbjct: 63  REMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRDIRHEIS 122

Query: 123 VSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAP 182
            ++ + Y G+  K    ++I+C+ CE                C SC G+G+K   R++ P
Sbjct: 123 ATLEELYKGRTAKLALNKQILCKSCEGRGGKAGAV-----KKCSSCNGQGFKFITRQMGP 177

Query: 183 GMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            M+ +    C  C+G G  +      K++CK C G+ +  E K L V I  G + G +IV
Sbjct: 178 -MIQRFQAECDACNGTGDIIDA----KDRCKACNGKKIANERKILEVHIEPGMKDGQKIV 232

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
           F+GEADQ         +  + +   E     R  R+G DL     + L  AI G +  + 
Sbjct: 233 FQGEADQAPDVVPGDVVFVVSERPHE-----RFNRKGDDLYYEAEVDLLTAIAGGEFAV- 286

Query: 303 KTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
           + + G  LK+    G+VI+PG    +E +G P+  +   FG+L V   I FP  N FA++
Sbjct: 287 QHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIVKFKIKFP-PNHFADE 344

Query: 363 SDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLVD 398
           + L ++ NILP       VK       Q+ D  L D
Sbjct: 345 ASLKQLENILPPR-----VKPTIPKGAQIEDCVLAD 375

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  162 bits (409), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/431 (28%), Positives = 195/431 (45%), Gaps = 54/431 (12%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS  A++ +IKKAYR  AL+HHPDK   +   EES+++F++I  AYE+L DE K
Sbjct: 9   LYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDERK 65

Query: 63  RSKYDTYGDTADGPDFEDES-----------------FMXXXXXXXXXXXXXXXXXXXXX 105
           R  YD +G TAD   +  ES                 F                      
Sbjct: 66  REMYDRFG-TADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQ 124

Query: 106 XAQPGDDRSD-----DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXX 160
            A     R +     D++  LK ++ + Y+GK  K   KR  +C+KC+            
Sbjct: 125 GAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKA----- 179

Query: 161 XQTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGM 220
             + C +C GRG + + +R  P MV   + +C  C G+G ++     +K+ C+ C GQG 
Sbjct: 180 --SQCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMK----QKDICRDCNGQGC 232

Query: 221 IEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSK------TGDLIFIVDEGTEPPEGVR 274
           I E +   + + +G  +G  +V  GEAD+ VG          GD+I I+++   P +   
Sbjct: 233 IRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQ--LPHKAFW 290

Query: 275 LERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP 334
             R    ++ +  + L  ++ G    +     G++LK+    G+++ PG I  VE  G P
Sbjct: 291 RHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP 350

Query: 335 LNSHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPG---NTEQV 391
            +    +FG+LY+  D+ FP      +   +  +R  L  E   N    +P       +V
Sbjct: 351 KS--GGRFGNLYIRFDVAFPES---LKPETVEALRAALGQEPGANSGAGEPAVAVEGREV 405

Query: 392 SDMKLVDQLPD 402
            +  L +  PD
Sbjct: 406 EEHVLSNFAPD 416

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  157 bits (398), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 176/373 (47%), Gaps = 24/373 (6%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGVS  A   EIKKAYRK AL++HPDK    +  EE   +FKE++AAYE+LSD EK
Sbjct: 7   LYDVLGVSPTAGDSEIKKAYRKSALKYHPDK----NPTEEGAEKFKEVSAAYEILSDSEK 62

Query: 63  RSKYDTYGDTADGPDFEDESFMXXXXXXXX--XXXXXXXXXXXXXXAQPGDDRSDDVQVP 120
           R  YD +G+                                        G  R  D++  
Sbjct: 63  REIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRDIKHE 122

Query: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
           +  ++ + Y G+  K    ++I+C+ CE                C SC G+G K   R++
Sbjct: 123 IAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK-----KCSSCNGQGVKFVTRQM 177

Query: 181 APGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDR 240
            P M+ +    C +C G G  +      K++CK C  + +  E K L V I  G + G  
Sbjct: 178 GP-MIQRFQAECDVCSGTGDIID----PKDRCKTCNAKKVTNERKILEVHIEPGMKDGQN 232

Query: 241 IVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRT 300
           IVF+GEADQ       GD+IF+V +          +R G DL+    I L  AI G +  
Sbjct: 233 IVFKGEADQ-APDVIPGDVIFVVAQKPHK----HFQRSGDDLVYEAEIDLLTAIAGGEFA 287

Query: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFA 360
           L + + G  LK+S   G+VISPG    +E +G P+  +    G+L V   + FP+ + FA
Sbjct: 288 L-EHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGG-HGNLIVHFTVKFPQKH-FA 344

Query: 361 EKSDLLKIRNILP 373
           ++  L K+  ILP
Sbjct: 345 DEDSLKKLEEILP 357

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  156 bits (394), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 185/384 (48%), Gaps = 55/384 (14%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYDTLGV+ +A++ EIKKAYR  AL+HHPDK   +   E+S+++F++I  AYE+L D++K
Sbjct: 9   LYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYEILGDDKK 65

Query: 63  RSKYDTYGDTAD-------GPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXA-------- 107
           R  YD +G TAD         ++E+ S M                               
Sbjct: 66  REMYDRFG-TADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFFGSSR 124

Query: 108 --------QPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXX 159
                   +    R  D++  LK ++ + YNGK  K   KR  +C+ C+           
Sbjct: 125 GFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKKA---- 180

Query: 160 XXQTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQG 219
              T+C +C+G+G + Q +R  P ++   + +CG C G G  V KP+   + C  C GQG
Sbjct: 181 ---TSCYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIV-KPS---DICNGCHGQG 232

Query: 220 MIEEAKPLTVSIPRGSRHGDRIVFEGEADQEV----GKSKT--GDLIFIVDEGTEPPEGV 273
            + E K   + + +G  +G  +V   EAD+ V    G  +   GD+I I+++        
Sbjct: 233 WVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQLPH----- 287

Query: 274 RLERRGYD---LITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQ 330
           R  +RG+D   L++   + L  ++ G    +     G+VLK+    G+++ PG I  V+ 
Sbjct: 288 RSLKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQS 347

Query: 331 EGWPLNSHATKFGDLYVLVDIVFP 354
            G P +     +GDL++   ++FP
Sbjct: 348 MGMPKSKGG--YGDLFIKFKVIFP 369

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  151 bits (382), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/384 (29%), Positives = 180/384 (46%), Gaps = 50/384 (13%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD L VS +A+ VEI+KAYR LAL+HHPDK   ++  EES+ +F E+  AYE+L DE+K
Sbjct: 7   LYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKK 63

Query: 63  RSKYDTYGDTADGPDFE-----DESFMXXXXXXXXXXXXXXXXXXXXXXAQPGD------ 111
           RS YD YG T D    +     ++  M                      A   D      
Sbjct: 64  RSLYDQYG-TIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPS 122

Query: 112 ----------DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXX 161
                     D   D++  LK +++  Y GK  K    R+ VC+ C+             
Sbjct: 123 FGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVR----- 177

Query: 162 QTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMI 221
              CK+C+GRG + + R++ P M+   T +C  C+G G +    T + + C+ C G+G I
Sbjct: 178 --TCKACRGRGQQSRSRQMGP-MMQTWTQTCSDCNGMGTF----TKDSDVCRDCEGEGCI 230

Query: 222 EEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSK-------TGDLIFIVDEGTEPPEGVR 274
            E K   V +  G   G +I+  GEAD EV K++        GD+I  + +  + P+  R
Sbjct: 231 RERKIFDVEVKPGMCQGQQIILPGEAD-EVIKTRFGNETVIPGDVIITIIQ-IKDPKFQR 288

Query: 275 LERRGYDL-ITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGW 333
           + R G DL + N  I L  ++ G   ++    +G+++ ++   G++I P     +E  G 
Sbjct: 289 VNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGM 348

Query: 334 PLNSHATK---FGDLYVLVDIVFP 354
           P          +G+LY+   + FP
Sbjct: 349 PRYEEKRAPEGYGNLYIQFQVEFP 372

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  149 bits (375), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 173/379 (45%), Gaps = 46/379 (12%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYDTL +S DAT  EIKKAYR  AL+ HPDK   ++  E+S+ +F+EI  AYE+L D +K
Sbjct: 9   LYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAKK 65

Query: 63  RSKYDTYGDT--------------------ADGPDFEDESFMXXXXXXXXXXXXXXXXXX 102
           +  YD YG                      + G  F                        
Sbjct: 66  KLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFT 125

Query: 103 XXXXAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQ 162
               +Q    R  D++  L+ S+ + Y+GK  K +  R  +C+ C+              
Sbjct: 126 GKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSS------- 178

Query: 163 TNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIE 222
           + C++C G+G+  Q RR  P MV   + +C  C G G +V +    K+ C +C+GQG I+
Sbjct: 179 SACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRR----KDVCSECKGQGCIK 233

Query: 223 EAKPLTVSIPRGSRHGDRIVFEGEADQEV----GKSKT--GDLIFIVDEGTEPPEGVRLE 276
           E K   + +  G  HG  IV   EAD+ V    GK +   GD+I IV +   P   +  +
Sbjct: 234 ERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHND 293

Query: 277 RRGYDLITN-ISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
               DL+ N   + L  ++ G +  +     G  LK+    G+++ PG +  VE  G P 
Sbjct: 294 T---DLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMP- 349

Query: 336 NSHATKFGDLYVLVDIVFP 354
           +  +  FG+LY+   + FP
Sbjct: 350 HPQSQGFGNLYIRFQVDFP 368

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  134 bits (338), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 166/368 (45%), Gaps = 38/368 (10%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV++DA   EIK AYR+L+ ++HPDK   D   EE+  +F E+  AY+VLSD EKR
Sbjct: 24  YKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGD---EEAHNKFIEVGEAYDVLSDSEKR 80

Query: 64  SKYDTYGDTA------------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGD 111
           + YD YG  A             G  F D   M                           
Sbjct: 81  NIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRGRP--- 137

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
            R  ++ +  +VS+ D YNG+ FK+  +    CEKC               T C  CQGR
Sbjct: 138 -RGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGKV-----TRCPDCQGR 191

Query: 172 GYKEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVS 230
           G   Q+  +  G++ QQ    C  C G G+ +      KN C  C G  + +  K  TV 
Sbjct: 192 GVIVQV--IQMGIMTQQIQHVCDRCSGSGEII------KNPCPHCHGHKVAKMDKEFTVK 243

Query: 231 IPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISL 290
           +P G++     +  GEA++       GDL+F   E +    G R  RRG  L     +S+
Sbjct: 244 LPNGAQRNYVDIKHGEAEKG-ADFDAGDLMFEFRENSMNNMGYR--RRGDHLYRTEVLSV 300

Query: 291 AEAIT-GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP-LNSHATKFGDLYVL 348
            EA+  G +R L      + +KL   A +V+  G+I  V   G P LNS   KFGDL++ 
Sbjct: 301 QEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFID 360

Query: 349 VDIVFPRD 356
             I+ P++
Sbjct: 361 YVILMPQE 368

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  134 bits (338), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/354 (28%), Positives = 156/354 (44%), Gaps = 30/354 (8%)

Query: 2   SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
           SLYD LGV+ DA+Q EIKKAYRKLAL++HPDK   D   E+    F++I+ AY VL D  
Sbjct: 3   SLYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGD---EKCHEAFQKISHAYGVLGDVA 59

Query: 62  KRSKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPL 121
           +R +YD  GD  +       +                           G  R  ++   L
Sbjct: 60  QRQRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGPNIIHEL 119

Query: 122 KVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVA 181
           K ++ D Y GKV K   +R   CE+C                 C SC G G   ++ RV 
Sbjct: 120 KCTLQDLYRGKVIKLALRRTAPCERCSLGAANV----------CSSCNGSGNITRIERVG 169

Query: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
           P +    + +C  C G+G+           C +C G   + E     V +  G   G  I
Sbjct: 170 P-LTQTWSSTCNACQGQGRMSV-------DCSQCGGAQYLNERVVFKVHVKPGMHDGQTI 221

Query: 242 VFEGEADQ-------EVGKSKTGDLIFIVDEGTEPP-EGVRLERRGYDLITNISISLAEA 293
           V +GEADQ        +  +++GD++ ++ E  +   +   L +R    +  + + L  A
Sbjct: 222 VLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDLTTA 281

Query: 294 ITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYV 347
           +TG +  L     G ++K++   G+ +    I  VE  G P++    + GDLY+
Sbjct: 282 LTGGNVLLEDHPSGNLMKINILPGEFLPENCIKCVEGLGMPIDDTGQR-GDLYI 334

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  133 bits (334), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 107/372 (28%), Positives = 164/372 (44%), Gaps = 40/372 (10%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+ ++A++  IK AYR+L+ ++HPDK  +D   EE+   F EI  AYEVLSD EKR
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQND---EEAHNHFIEIGEAYEVLSDPEKR 87

Query: 64  SKYDTYGDTA---------------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQ 108
             YD +G  A                   F D                            
Sbjct: 88  RTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDP--FDLFNQMFGGNKGNFGGFGGFGGGG 145

Query: 109 PGDDR---SDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNC 165
             DDR   +  +QV   +S+ + + G    FQ   K  C+ C+                C
Sbjct: 146 FADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGKV-----DKC 200

Query: 166 KSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAK 225
           K C G G+  Q+ R+ P +  Q    C  CHG G  +      KN CKKC GQ ++ ++K
Sbjct: 201 KECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAGSTI------KNHCKKCHGQKLVTKSK 253

Query: 226 PLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITN 285
            + V +P G+      + E   D+E+  ++ GDL+    E  +   G R  RRG DL   
Sbjct: 254 EINVKVPAGAPRDFLKIVENGGDKELN-AEAGDLLVQFQEIAQNNLGYR--RRGNDLFRT 310

Query: 286 ISISLAEAIT-GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
            ++   +A+  G +RT+      R +K+S   G  +   +I K+   G P+   + +FGD
Sbjct: 311 EALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQG-SDRFGD 369

Query: 345 LYVLVDIVFPRD 356
           LY+   I+ P++
Sbjct: 370 LYIDYVIIVPQN 381

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  131 bits (330), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 106/362 (29%), Positives = 166/362 (45%), Gaps = 28/362 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV++DA++ +IK AYR+++ + HPDK   D   +E+  +F EI  AYEVLSD EKR
Sbjct: 21  YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGD---DEAHHKFIEIGEAYEVLSDSEKR 77

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDD---RSDDVQVP 120
           + YD +G  A                                 + PG     +  ++ V 
Sbjct: 78  ATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSNLIVK 137

Query: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
             V++   Y+G            CE C                 C++CQGRG   Q+  +
Sbjct: 138 DSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQF-----ATCETCQGRGVIIQV--I 190

Query: 181 APGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGD 239
             G + QQ    CG C GKGK +      K+ CK CRG  +++  K   +S+P G++   
Sbjct: 191 QMGFMTQQIQQVCGACQGKGKTI------KHVCKICRGARVVKTPKTFEISVPAGAQRNY 244

Query: 240 RIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT-GLD 298
            +V  G+A++ V   ++GDL+F+ +E +    G R  RRG  L     +   EA+  G +
Sbjct: 245 NVVKSGQAEK-VPDMQSGDLVFVFEENSHENLGYR--RRGDHLYRTEVLHWKEALLGGWE 301

Query: 299 RTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP-LNSHA---TKFGDLYVLVDIVFP 354
           R +    D + + +      V +PG+I +V   G P LNS       +GDL++   IV P
Sbjct: 302 RRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVIVSP 361

Query: 355 RD 356
           ++
Sbjct: 362 KE 363

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  129 bits (325), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/378 (26%), Positives = 161/378 (42%), Gaps = 45/378 (11%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD LGV    +  E+KK+Y+  AL++HPDK   +   E S+ RF++I  AY VL DE  
Sbjct: 7   LYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDERL 63

Query: 63  RSKYDTYGDTADG-----------------PDFEDESFMXXXXXXXXXXXXXXXXXXXXX 105
           R  YD YG   +G                 P      F                      
Sbjct: 64  RKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESGASSAR 123

Query: 106 XAQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNC 165
            ++    R  D++  L+ ++ + Y GKV +    R  +C  C               + C
Sbjct: 124 CSRV--SRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLC-------AGRGGSRASTC 174

Query: 166 KSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAK 225
            +C G+G   Q +R    +V   + +C +C G G  V     + + C  C G G + E K
Sbjct: 175 TACSGQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVK----DCDTCTSCGGAGYLRERK 229

Query: 226 PLTVSIPRGSRHGDRIVFEGEADQEV----GKSKT--GDLIFIVDEGTEPPEGVRLERRG 279
              V I  G R G  +VF GEAD+ V    GK +   GDL   ++E T      R + RG
Sbjct: 230 VFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEAT---PATRYQCRG 286

Query: 280 --YDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNS 337
               L+T + + L  ++ G    +     G++++L    G+++ PG I  +E  G P   
Sbjct: 287 DANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPD 346

Query: 338 HATKFGDLYVLVDIVFPR 355
             +++G L++   + FP+
Sbjct: 347 DPSQYGHLFIKFHVDFPK 364

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  127 bits (318), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 108/370 (29%), Positives = 161/370 (43%), Gaps = 46/370 (12%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+++DA+  ++K AYR+L+ ++HPDK   D   E +  RF E+  AYEVLSD EKR
Sbjct: 21  YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGD---ESAHQRFIEVGEAYEVLSDPEKR 77

Query: 64  SKYDTYGDTADG---------------PDFED--ESFMXXXXXXXXXXXXXXXXXXXXXX 106
             +D YG  ADG                 F D  + F                       
Sbjct: 78  GIFDQYG--ADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHRG 135

Query: 107 AQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCK 166
             P       ++V  ++S+ D Y+G   +F+     +C+ CE                C 
Sbjct: 136 KGP------SLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGKV-----ETCP 184

Query: 167 SCQGRGYKEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAK 225
            C G+G   Q+ R+  G++ Q+    CG C G+G  +      KNQCK C G  ++++ K
Sbjct: 185 DCGGQGILIQIIRM--GIMTQRIQQPCGRCSGRGHII------KNQCKACGGHKVVKKPK 236

Query: 226 PLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITN 285
              V +P G+      V   EADQ     + GD+     E  +   G R  RRG  L   
Sbjct: 237 SFQVEVPAGAPRDHVEVRHQEADQST-DMEAGDIFVEFTESDKNNMGYR--RRGDHLFRT 293

Query: 286 ISISLAEAITG-LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
             +S  EA+ G   R +    D + +KL  P G ++  G+I ++   G P  S    FGD
Sbjct: 294 EVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGD 353

Query: 345 LYVLVDIVFP 354
           L+V   +V P
Sbjct: 354 LFVEYAVVMP 363

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  124 bits (311), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 102/362 (28%), Positives = 156/362 (43%), Gaps = 34/362 (9%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  L + +DAT  +I+ AYR+L+ ++HPDK  +D   E++  +F E+  AYE+LSD EKR
Sbjct: 24  YKILELDKDATDKDIRSAYRQLSKKYHPDKNPND---EDAHHKFIEVGQAYEILSDPEKR 80

Query: 64  SKYDTYG---------DTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRS 114
            +YD +G             G  F D   +                       Q    R 
Sbjct: 81  QRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQ----RG 136

Query: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYK 174
            +V      S+ + YNG V KF      +C+ C               T C  CQGRG  
Sbjct: 137 QNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKS-----TKCPDCQGRGVT 191

Query: 175 EQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPR 233
            Q+ R+  GM+ QQ    CG C GKG+ +      KN CK C G  ++++ K   + +P 
Sbjct: 192 VQVIRM--GMMTQQIQQVCGKCGGKGQII------KNPCKTCHGSKVVQKPKDFEIELPA 243

Query: 234 GSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEA 293
           G+         G AD+      +GD+     E  +   G R  RRG  L     ++  EA
Sbjct: 244 GAPRKFVHAEHGAADKHP-DYDSGDVYIEFTENDKDNMGYR--RRGPHLYRTEVLNATEA 300

Query: 294 ITG-LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352
           + G  +R L      +++ +     K+I  G+  ++   G PL +    FGDL++   +V
Sbjct: 301 LYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVV 360

Query: 353 FP 354
            P
Sbjct: 361 MP 362

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  123 bits (309), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 108/358 (30%), Positives = 158/358 (44%), Gaps = 26/358 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGVS+ A   +IK AYR+L+ ++HPDK  DD   + +  +F E+  AYEVLSD EKR
Sbjct: 22  YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLSDPEKR 78

Query: 64  SKYDTYGDTA---DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVP 120
             YD YG  A   +G     +                          Q    R  +++  
Sbjct: 79  KIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRRARGHNLETR 138

Query: 121 LKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRV 180
            ++++ + Y G    F       CE CE              T C  C+G G   Q+ R+
Sbjct: 139 EELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGKV-----TKCPDCKGHGVVVQIVRM 193

Query: 181 APGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGD 239
            P  V QQ    CG C G+G  +      KN+CK C G+ ++ + K   V +P G+    
Sbjct: 194 GP--VTQQIQQMCGKCQGRGSTI------KNKCKHCHGEKVVRKPKSFHVDVPPGAPRNF 245

Query: 240 RIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDR 299
             V +GE+D+       GDL     E +    G R  RRG DL    ++SL EA+ G   
Sbjct: 246 VEVKQGESDKGP-DFDAGDLFIKFSETSRDNLGYR--RRGDDLFRTEALSLREALKGGWE 302

Query: 300 TLTKTLDG-RVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRD 356
              + LD  R +K+   +  V + G+I ++   G P      KFGDLY+   ++ P D
Sbjct: 303 REIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYIDYVVIVPDD 358

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 163/372 (43%), Gaps = 50/372 (13%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+++DA+  EIK +YR+L+ + HPDK   D   EE+  +F EI  AYEVLSD EKR
Sbjct: 23  YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGD---EEAHHKFIEIGEAYEVLSDPEKR 79

Query: 64  SKYDTYGDTA-----------------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXX 106
             +D YG  A                 D  D  ++ F                       
Sbjct: 80  KIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMF---------NRGGGGGGGGFGRM 130

Query: 107 AQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCK 166
            +P   R  +++V  ++S+ + Y G   +F      +C+ C+                C 
Sbjct: 131 QRP---RGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTGSADGKV-----AKCS 182

Query: 167 SCQGRGYKEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAK 225
            CQGRG   Q+ R+  GM+ QQ    CG C GKG  +      KN CK C G  ++++ K
Sbjct: 183 DCQGRGVVIQVIRM--GMMTQQIQQMCGRCGGKGSVI------KNHCKTCHGSKVVKKQK 234

Query: 226 PLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITN 285
           P  V +P G+         GE+D+       GD+    +E T    G R  RRG  L   
Sbjct: 235 PFHVEVPPGAARHYTETRSGESDKG-ADFDAGDVFIEFNEKTTNNLGYR--RRGPHLYRT 291

Query: 286 ISISLAEAITGLDRTLTKTLD-GRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
             +S  EA+ G  +   + LD  + +K++     V+  G++ ++   G P  +    FGD
Sbjct: 292 EVLSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGD 351

Query: 345 LYVLVDIVFPRD 356
           L++   +V P +
Sbjct: 352 LFIEYVVVMPHE 363

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  124 bits (312), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 125/463 (26%), Positives = 194/463 (41%), Gaps = 83/463 (17%)

Query: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           LYD L V  DA+QV IKKA+   AL+ HPDK   ++  EES+ +F+EI+ AYEVLSD + 
Sbjct: 7   LYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKS 63

Query: 63  RS---KYDTYGDTADG---PDFEDESFMXXXXXXXXXXXXX------------------- 97
           R    +Y T  ++A     P  E  SF                                 
Sbjct: 64  REMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFG 123

Query: 98  -------XXXXXXXXXAQPGDDRSD-DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEX 149
                           A+ G  R+  D++  LK +++D Y GK  K    R  VC  C+ 
Sbjct: 124 FGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDG 183

Query: 150 XXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEK 209
                         +C++C+G+G   + RRV P MV   + +C  CHG G ++     + 
Sbjct: 184 KGGMRV-------ASCRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFIK----DS 231

Query: 210 NQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKS------KTGDLIFIV 263
           + C  C+G G+ +E K   V +  G  H   IV  GEAD+ +  S      + GD++ ++
Sbjct: 232 DLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIVI 291

Query: 264 DEGTEPPEGVRLERRGYDLIT-NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISP 322
           D        V      +DL+  N  + L   + G +  +     G+++KLS    +++ P
Sbjct: 292 DLVKNTQFQV---VNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKP 348

Query: 323 GKIIKVEQEGWP---LNS-HAT-------KFGDLYVLVDIVFPRDNWFAEKSDLLKIRNI 371
                VE  G P    NS HA         +G+LYV   + FP      E + + K++ I
Sbjct: 349 SCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPER---LEDTTITKLQEI 405

Query: 372 L-----------PSEAANNDVKADPGNTEQVSDMKLVDQLPDY 403
           L             +   +D   +     +V +  L D +PDY
Sbjct: 406 LEQDPNVKKEDESDQKRIDDAVTNSDGAVEVEEHVLSDFVPDY 448

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  122 bits (307), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 104/365 (28%), Positives = 163/365 (44%), Gaps = 38/365 (10%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+++DAT  EIK AYR+L+ + HPDK   +   E++  +F E+  AYEVLSD +KR
Sbjct: 23  YQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSDPQKR 79

Query: 64  SKYDTYGDTA----------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDR 113
             +D +G  A           G  F D   +                        P    
Sbjct: 80  QTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPRGP---- 135

Query: 114 SDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGY 173
             ++    ++S+ D Y G    F      +C+ C               T C  CQGRG 
Sbjct: 136 --NIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTGSDDGKL-----TPCPDCQGRGV 188

Query: 174 KEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
             QL R+  GM+ QQ    CG C GKG+   K      QC+KC G  ++ + K   V +P
Sbjct: 189 IIQLIRM--GMMTQQIQQMCGRCGGKGQLFKK------QCRKCHGNKVMPQKKEFQVKLP 240

Query: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292
           +G++     V  GEAD+     + GDL+   +E  +   G R  RRG +L     +++ E
Sbjct: 241 KGAKRHYMDVKHGEADKNP-DLEAGDLLIEFNENDKSNMGYR--RRGQNLYRTEVLNVTE 297

Query: 293 AITGLDRTLTKTLD-GRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATK-FGDLYVLVD 350
           A+ G  +     LD  + L++   +  V+S G++ ++   G P      + FGDL++   
Sbjct: 298 ALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDYV 357

Query: 351 IVFPR 355
           ++ P+
Sbjct: 358 VIMPK 362

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  121 bits (303), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 164/355 (46%), Gaps = 28/355 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+S+DA+  EIK AYR+L+ ++HPDK   D   EE+  +F E+  AY++L D EKR
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGD---EEAHHKFIEVGEAYDILGDPEKR 78

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLKV 123
             YD +G  A    F++                                RS + QV  +V
Sbjct: 79  KTYDVHGADA----FKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQRSQNYQVRNQV 134

Query: 124 SMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPG 183
           S+ + Y+G   +F+     +C+ C                 C +CQGRG   Q+ R+ P 
Sbjct: 135 SLKEFYSGGEVEFEIPLNDICDSCHGSGSADGKVKV-----CPACQGRGVVVQVIRMGP- 188

Query: 184 MVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRG--SRHGDRI 241
                 ++  +    G+   K  + +N CK C+G  ++ + KP     P G    H D+ 
Sbjct: 189 ------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGIPRNHIDKK 242

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT-GLDRT 300
              GE+D+     ++GD+I   +E  +   G R  RRG +L     I+  EAI  G  R 
Sbjct: 243 --SGESDKSP-DMESGDIIIEYNESEKENLGYR--RRGNNLYRTEIITANEAINGGWTRE 297

Query: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
           +    + + +KLS P G +++ G I +++  G P+   +  FGDLY+   ++ P+
Sbjct: 298 IEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMG-SKNFGDLYIDYVVLVPK 351

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  119 bits (298), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 167/375 (44%), Gaps = 36/375 (9%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  L + +DAT+ EIK AYR+L+ ++HPDK   ++  EE+  +F E+  AY+VLSD EK+
Sbjct: 25  YAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSDPEKK 81

Query: 64  SKYDTYGDTA-------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD 116
             YD +G  A        GP                               Q    R   
Sbjct: 82  KIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFGQRQRQRGPM 141

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
           ++V  K+S+   Y+G   +F       C+ C                 C  CQGRG   Q
Sbjct: 142 IKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKL-----AQCPDCQGRGVIIQ 196

Query: 177 LRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235
           + R+  G++ QQ    CG C G G+ +      KN+CK C G+ + ++ K   V +P G+
Sbjct: 197 VLRM--GIMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFHVDVPPGA 248

Query: 236 --RHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEA 293
              + D  V E E   +      GDL+    E      G R  RRG +L     +S AEA
Sbjct: 249 PRNYMDTRVGEAEKGPDF---DAGDLVIEFKEKDTENMGYR--RRGDNLYRTEVLSAAEA 303

Query: 294 IT-GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352
           +  G  RT+    + + +KLS PA  V+S G++  V+  G P  S    +GDLY+   +V
Sbjct: 304 LYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMPKGSKG--YGDLYIDYVVV 361

Query: 353 FPRDNWFAEKSDLLK 367
            P+   F    ++LK
Sbjct: 362 MPKT--FKSGQNMLK 374

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 160/359 (44%), Gaps = 28/359 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  L + +DA++ EIK AYR+L+ ++HPDK   ++  +E+  +F EI  AYEVLSD EK+
Sbjct: 25  YAILDIGKDASEKEIKSAYRQLSKKYHPDK---NAGSDEAHHKFIEIGEAYEVLSDPEKK 81

Query: 64  SKYDTYGDTA-----DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQ 118
             YD +G  A      G                                Q    R   ++
Sbjct: 82  KIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRGPTIK 141

Query: 119 VPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLR 178
           V   +S+   Y+G   +F       C+ C                 C  CQGRG   Q+ 
Sbjct: 142 VHENLSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKL-----AQCPDCQGRGIIVQVV 196

Query: 179 RVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRH 237
           R+  G++ QQ    CG C G G+ +      KNQCK C G+ + ++ K   V +P G+  
Sbjct: 197 RM--GIMTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKKNKFFHVDVPPGAPR 248

Query: 238 GDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT-G 296
                  GEA++       GDL+    E      G R  RRG++L     +S AEA+  G
Sbjct: 249 NYMDTRAGEAEKGP-DFDAGDLVIEFREMDTENMGYR--RRGHNLYRTEVLSAAEALYGG 305

Query: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
            +RT+    + + +KLS PA  V+S G+I  V+  G P  S     GDLY+   +V P+
Sbjct: 306 WERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKGSR--DHGDLYIDYVVVMPK 362

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 107/360 (29%), Positives = 156/360 (43%), Gaps = 29/360 (8%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV + A+  +IK AYR+L+ ++HPDK   D   E++  RF E+  AYE LSD EKR
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGD---EDAHNRFIEVGEAYEALSDPEKR 79

Query: 64  SKYDTYGDTA-------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDD 116
             YD +G  A        G       F                        Q    R   
Sbjct: 80  KIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQRGQS 139

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
           +QV  ++++   Y+G   +F       C+ C+                C  C GRG   Q
Sbjct: 140 LQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGKVE-----KCGQCGGRGMVVQ 194

Query: 177 LRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235
           + R   G + QQ    C  C G+G+ +      KN+CK C G  ++++ K   V +P G+
Sbjct: 195 VIR--QGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFHVDVPAGA 246

Query: 236 RHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT 295
                 V  GEA++    ++ GD+   V E   P + +   RRG DL     +SL EA+ 
Sbjct: 247 PRDFVAVIRGEAEKSP-DTEPGDIYVKVVE--SPVQNMGYRRRGPDLFRTEVLSLTEALK 303

Query: 296 -GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFP 354
            G  R L      + + LS   G  +  G++  ++  G PL S  TK+GDLYV   IV P
Sbjct: 304 GGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLES-GTKYGDLYVDYVIVMP 362

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  117 bits (293), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 154/357 (43%), Gaps = 24/357 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGVS+DA+  EIK AYR+L+ + HPDK   D   E++  +F E+  AYEVLSD++KR
Sbjct: 27  YGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGD---EDAHHKFIEVGEAYEVLSDDQKR 83

Query: 64  SKYDTYGDTA----DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQV 119
             YD +G  A                                        G  R  +++ 
Sbjct: 84  QIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGRGRPRGHNLEA 143

Query: 120 PLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRR 179
             ++++   Y G    F       CE C               T+C  C+G+G   Q+ R
Sbjct: 144 REELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKT-----THCSECRGQGVVIQVVR 198

Query: 180 VAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGD 239
           + P +  +    CG C GKG+ +      KN+CK+C G  +  +AK   V +P G+    
Sbjct: 199 MGP-LTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVDVPAGAPRDF 251

Query: 240 RIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDR 299
             V  GEAD+      +GD+     E +    G R  RRG  L     +SL EA+ G  +
Sbjct: 252 VDVKAGEADKGP-DFDSGDVFIKFSESSRDNMGYR--RRGPHLYRTEVLSLKEALLGGWK 308

Query: 300 TLTKTLD-GRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
              +  D  + LKL    G  +  G+I +V   G P   H  K GDL+V   +V P+
Sbjct: 309 REIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGDLFVDYVVVIPK 364

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 127/249 (51%), Gaps = 20/249 (8%)

Query: 113 RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRG 172
           R  D++  LK ++A+ Y+GK+ K    R+ +C+ C+             +  CK+C+G+G
Sbjct: 161 RGPDIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLR-------RRTCKTCRGQG 213

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
            + + RR  P MV   T +C  C+G G Y    T + + C +CRG+  I+E K   V + 
Sbjct: 214 QQTETRRTGP-MVQTWTQTCPDCNGLGTY----TKQADVCHECRGESYIKERKIFDVEVS 268

Query: 233 RGSRHGDRIVFEGEADQ------EVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLIT-N 285
           +G  HG  IV  GEAD+       V K   GD++  +D+  +  +  R+ R G DL+  +
Sbjct: 269 KGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQ-VKDSKFHRVNRYGCDLVMGS 327

Query: 286 ISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDL 345
            SI L+ ++ G D  +     G++LK+S   G++I P  +  +E  G P   H    G+L
Sbjct: 328 CSIDLSTSLCGGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGKGNL 387

Query: 346 YVLVDIVFP 354
           Y+   + +P
Sbjct: 388 YIQFQLEYP 396

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 51/68 (75%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYDTL VS DAT  EIK+AY+ +AL++HPDK   +   E+++ +F+E+  AYE+L+DE+K
Sbjct: 7  LYDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDK 63

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 64 RVMYDRYG 71

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  115 bits (287), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 153/354 (43%), Gaps = 24/354 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV + A++ EIK AYR+L+ ++HPDK   +   +E+   F E+  AY+VLSD EKR
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHFIEVGEAYDVLSDPEKR 78

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLKV 123
             YD +G  A                                 A+ G  R  ++QV   +
Sbjct: 79  QIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRAR-GKPRGQNLQVNHDI 137

Query: 124 SMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPG 183
           S+   Y G  F+F      +C+ C+                C  C G G   ++ R  P 
Sbjct: 138 SLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTE-----TCPDCGGSGQIMKVFRAGP- 191

Query: 184 MVAQQTVS--CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241
              +Q V   C  C G+G+ +      K+ CKKC+G  +++++K  T  +  G       
Sbjct: 192 --IEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKVEPGMERNHIH 243

Query: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITG-LDRT 300
           V +G++++     + GDL     E  +   G R  RRG  L     +S  EA+ G  +R 
Sbjct: 244 VMQGQSEKHP-DIEPGDLYQYFRESEKDSMGYR--RRGNTLYRTEILSFKEALQGGWERN 300

Query: 301 LTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFP 354
           +      + L LS P G  +  G+   ++  G P+ S   KFGDL +   I+ P
Sbjct: 301 IEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLP 354

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 110/370 (29%), Positives = 159/370 (42%), Gaps = 38/370 (10%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LG+S++  + EIK AYR+L+ + HPDK  +D   E++  +F EI  AYEVLSD EKR
Sbjct: 25  YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPND---EDAHNKFIEIGEAYEVLSDPEKR 81

Query: 64  SKYDTYGDTA-------------DGPDFED--ESF--MXXXXXXXXXXXXXXXXXXXXXX 106
             YD +G  A                 F D  + F  M                      
Sbjct: 82  RMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGGFGGGQ 141

Query: 107 AQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCK 166
              G  R   ++V   +++ D YNG    F       C+ C                 C 
Sbjct: 142 QHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKV-----KKCP 196

Query: 167 SCQGRGYKEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAK 225
            C GRG   Q+ R+  G+V QQ    C  C G G+ +      +N+CK C G  + ++ K
Sbjct: 197 DCGGRGVVIQVIRM--GIVTQQVQQRCNRCAGSGEII------QNKCKVCSGAKVQKKEK 248

Query: 226 PLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITN 285
            ++VS   G       V +GEA++  G  + GDLI    E  E   G R  RRG DL   
Sbjct: 249 DISVSFDSGIERNHISVQQGEAEKGPG-IEPGDLIVEFFEVPEANMGYR--RRGKDLFRT 305

Query: 286 ISISLAEAITGLDRTLTKTLD-GRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
             ++L EAI G      + LD  + L+L      ++  G++ K+   G P+     KFGD
Sbjct: 306 EVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGD 365

Query: 345 LYVLVDIVFP 354
           LY+   ++ P
Sbjct: 366 LYIDYVVIKP 375

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  114 bits (285), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 158/361 (43%), Gaps = 31/361 (8%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  L V +DA++ EIK AYR+L+ ++HPDK   +S  EE+  +F E+  AY+VLSD EK+
Sbjct: 25  YAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSDPEKK 81

Query: 64  SKYDTYGDTA--------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSD 115
             YD +G  A         G                                Q    R  
Sbjct: 82  KIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGFGQRQRQRGP 141

Query: 116 DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKE 175
            ++V  K+S+   Y+G   +F       C+ C                 C  CQGRG   
Sbjct: 142 MIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKL-----AQCPDCQGRGVII 196

Query: 176 QLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRG 234
           Q+ R+  G++ QQ    CG C G G+ +      KNQCK C G+ +I++ K   V +P G
Sbjct: 197 QVLRM--GIMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKNKFFHVDVPPG 248

Query: 235 SRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAI 294
           +         GEA++       GDL+    E      G R  RRG +L     +S  EA+
Sbjct: 249 APRNYLDTRAGEAEKGP-DFDAGDLVIEFKEKDTENMGYR--RRGDNLYRTEVLSAEEAL 305

Query: 295 T-GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVF 353
             G  RT+    + + +KLS PA  V+S G+I  ++  G P +      GDLY+   ++ 
Sbjct: 306 YGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKG--HGDLYIDYVVIM 363

Query: 354 P 354
           P
Sbjct: 364 P 364

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  111 bits (278), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 155/359 (43%), Gaps = 27/359 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGVS+DA++ EIK AYR+L+ ++HPDK   D   E +  +F E+  AYEVLSD++KR
Sbjct: 26  YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGD---ETAHHKFIEVGEAYEVLSDDQKR 82

Query: 64  SKYDTYGDTA------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDV 117
             Y+ YG  A       G                                  G  R  ++
Sbjct: 83  QIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRPRGHNL 142

Query: 118 QVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQL 177
           +   ++++ + Y G    F       C+ C+              T C  CQG+G   Q+
Sbjct: 143 EAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKT-----TRCSDCQGQGVVIQI 197

Query: 178 RRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRH 237
            R+ P +  Q    CG C GKG+ +      KN+CK+C G  +  + K   V +P G+  
Sbjct: 198 IRMGP-ITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKTKHFHVDVPAGAPR 250

Query: 238 GDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGL 297
               V  GEAD+       GD+     E +    G R  RRG  L     ++L EA+ G 
Sbjct: 251 DFVDVKNGEADKGP-DFDAGDVYIKFSESSRDNMGYR--RRGVHLHRTEVLTLKEALQGG 307

Query: 298 DRTLTKTLDG-RVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
            +   + LD  + +KL   AG  +  G+  +V   G P +     FGDL+V   ++ P 
Sbjct: 308 WKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMPKD--GRHFGDLFVDYVVLTPH 364

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  108 bits (271), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 117/247 (47%), Gaps = 22/247 (8%)

Query: 117 VQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQ 176
           ++  LK ++ D ++GK  K    R  +C++C+              T C+ CQG G    
Sbjct: 165 IRHNLKCNLYDLFHGKRAKLALNRTRLCQRCQGYGGKKA-------TQCRGCQGTGLFTT 217

Query: 177 LRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSR 236
            +R+ P MV     +C  C G GKY+      K+ C +C G G I+E K   V +  G R
Sbjct: 218 TKRMGP-MVQTWQTTCKECSGTGKYIR----SKDACTECSGNGFIKERKFFDVEVLPGMR 272

Query: 237 HGDRIVFEGEADQ----EVGKSKT--GDLIFIVDEGTEPPEGVRLERRGYD---LITNIS 287
           +G+ I+  GEAD+    E GK +   GD+I  +         +R +   +D   ++ N  
Sbjct: 273 NGNEIILPGEADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFE 332

Query: 288 ISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYV 347
           + L  ++ G    +     G   K+   +G+++ PG I  VE +G P++S+   FG+LY+
Sbjct: 333 VDLKTSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYI 391

Query: 348 LVDIVFP 354
              + FP
Sbjct: 392 RFRVKFP 398

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (65%), Gaps = 3/73 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD L V+  AT+ EIKKAYRK AL+HHPDK   ++   ES   F++I+ AYE LS+  K
Sbjct: 7  LYDILEVNTTATEQEIKKAYRKKALKHHPDK---NNHSAESIKLFQDISHAYETLSNSNK 63

Query: 63 RSKYDTYGDTADG 75
          R  YD YG   +G
Sbjct: 64 RELYDQYGTVDEG 76

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  108 bits (271), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 128/288 (44%), Gaps = 32/288 (11%)

Query: 107 AQPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCK 166
           A+ G  R  D++  LK  + + Y+GKV K    R  +C +C               + C 
Sbjct: 145 ARDGKSRGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHGSMT-------SSVCG 197

Query: 167 SCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKP 226
            C+G+G   Q RR  P +V   + SC  C G G +V       + C+ CRG G I E K 
Sbjct: 198 ECRGQGVYSQTRRHGP-LVQTWSSSCRNCSGAGTFVK----SNDVCQTCRGTGYIRERKI 252

Query: 227 LTVSIPRGSRHGDRIVFEGEADQEV----GKSKT--GDLIFIVDEGTEPPEGVRLERRGY 280
             V I  G  +   I+  GEADQ +    GK +   GD+I IV E        R   R  
Sbjct: 253 FEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRF--RES 310

Query: 281 DLI-TNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHA 339
           DL+ T   + L  ++ G    +     GR +KL    G++++PG I  VE  G P   + 
Sbjct: 311 DLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNP 370

Query: 340 TKFGDLYVLVDIVFPR----------DNWFAEKSDLLKIRNIL-PSEA 376
           +++GDLY+   + FP            +  A  S++++  NI  PS A
Sbjct: 371 SQYGDLYIKFCVNFPERLEPETMNVISSALASDSNIIRQENITEPSSA 418

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           YD L VS   +  E+KK+Y+  AL++HPDK   +   E ++  F++IT AY +LSDE K
Sbjct: 7  FYDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDERK 63

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 64 RKIYDRYG 71

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  107 bits (267), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 156/359 (43%), Gaps = 28/359 (7%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  L + + A++ EIK AYR+L+ + HPDK   ++  EE+  +F E+  AY+VLSD EK+
Sbjct: 25  YAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQKFIEVGEAYDVLSDPEKK 81

Query: 64  SKYDTYGDTA-----DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQ 118
             YD +G  A     DG                                Q    R   ++
Sbjct: 82  KIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRGPMIK 141

Query: 119 VPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLR 178
           V  K+S+   Y+G   +F       C+ C                 C  CQGRG   Q+ 
Sbjct: 142 VQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKL-----AQCPDCQGRGVIIQVL 196

Query: 179 RVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRH 237
           R+  G++ QQ    CG C G G+ +      KN+CK C G  + +  K   V +P G+  
Sbjct: 197 RM--GIMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVPPGAPR 248

Query: 238 GDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAIT-G 296
                  GEA++       GDL+    E      G R  RRG +L     +S+ EA+  G
Sbjct: 249 NYMDTRAGEAEKGP-DFDAGDLVIEFKEKDSENMGYR--RRGDNLYRTEVLSIEEALYGG 305

Query: 297 LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
            +RT+    + + +KLS PA   +S G+I  ++  G P       +GDLY+   ++ P+
Sbjct: 306 WERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMPKGGKG--YGDLYIDYVVIMPK 362

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 159/369 (43%), Gaps = 36/369 (9%)

Query: 4   YDTLGVSQD-ATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y  LG++++   + EIK AYRKL+ ++HPDK  +D   ++++  F ++  AY+VL D +K
Sbjct: 26  YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKND---KDAQQNFIKVGEAYDVLGDPDK 82

Query: 63  RSKYDTYGDTA--------------DGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQ 108
           + +YD  G  A               G  F D   M                        
Sbjct: 83  KRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNPFGGG 142

Query: 109 PGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSC 168
            G  R   ++V  ++S+   Y G  F+F       C+ C                 C  C
Sbjct: 143 GGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTKV-----CPDC 197

Query: 169 QGRGYKEQLRRVAPGMVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPL 227
           +G G   Q+ R+  GM+ QQ    CG C G+G  +      KN CK C G  + ++ K  
Sbjct: 198 KGSGIIIQIIRM--GMMTQQIQQPCGRCRGQGHLI------KNFCKVCNGAKVQQKLKDF 249

Query: 228 TVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNIS 287
            V +P GS      V  G+A++     + GD+I   +E   P + +   RRG +L     
Sbjct: 250 KVYVPPGSPRNHVEVKAGQAEKNPN-YEPGDVIIEFNE--LPLDNLGYRRRGNNLFRTEY 306

Query: 288 ISLAEAITG-LDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLY 346
           ISL EA+ G  +RTL      + + L       I  G+I  ++  G P+ +   KFGDLY
Sbjct: 307 ISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLY 366

Query: 347 VLVDIVFPR 355
           +   ++ P+
Sbjct: 367 IDYKVIIPK 375

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 125/273 (45%), Gaps = 26/273 (9%)

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           DR  D++  LK ++ + Y GK  K    R  +C  C+             +  CK+C+G+
Sbjct: 174 DRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLK-------KCTCKTCKGQ 226

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           G + Q RR+ P +V   + +C  C G G +V      K+ C++C+G G I+E K L V++
Sbjct: 227 GIQTQTRRMGP-LVQSWSQTCADCGGAGVFVK----NKDICQQCQGLGFIKERKILQVTV 281

Query: 232 PRGSRHGDRIVFEGEADQEVG-------KSKTGDLIFIVDEGTEPPEGVRLERRGYDLIT 284
             GS H   IV  GE D+ +        K   GD++  +    +P    ++      +  
Sbjct: 282 QPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDP--NFQVINYSNLICK 339

Query: 285 NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP--LNSHATKF 342
              I    ++ G    +     G+++KL    G+++ PG    VE  G P  +N   + F
Sbjct: 340 KCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGF 399

Query: 343 GDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSE 375
           G LYV  D+ +P      E  +  KI+NIL ++
Sbjct: 400 GHLYVKFDVTYPER---LEPENAKKIQNILAND 429

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          SLYD+L V+  A+  EIKKAYR  AL++HPDK   ++  EES+ +F+EI  AYE+L D  
Sbjct: 6  SLYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNR 62

Query: 62 KRSKYDTYGDT 72
           R+ YD YG T
Sbjct: 63 LRALYDQYGTT 73

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 149/353 (42%), Gaps = 21/353 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV ++AT+ +IK AYR+L+ ++HPDK   D+    +   F E+  AYE LSD EKR
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 64  SKYDTYGDTADGPDFEDESFMXXXXXXXXXXXXXXXXXXXXXXAQPGDDRSDDVQVPLKV 123
             YD YG  A       E                          Q    RS  +QV  ++
Sbjct: 80  RIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQSLQVQEEL 139

Query: 124 SMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPG 183
           ++   Y+G   +F       C+ C                 C  C  RG   Q+ R   G
Sbjct: 140 TLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGKVE-----RCTQCSVRGVIVQVGR--QG 192

Query: 184 MVAQQTVS-CGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRIV 242
            + QQ    C    G       P +   +CK C+G   I++ K   V +P G+      V
Sbjct: 193 FMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAPRDFVAV 247

Query: 243 FEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLT 302
            +GEA++ V     GD+   V E T    G R  R+G +L     +SL EA+ G  +   
Sbjct: 248 QQGEAEK-VPDMDPGDIYVKVFENTRDNMGYR--RQGANLFRTEVLSLKEALHGDWKREL 304

Query: 303 KTLD-GRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFP 354
           + LD  + +  S   G+ +  G++ +V   G PL   A  FGDLYV   ++ P
Sbjct: 305 EFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAG-FGDLYVDYVVILP 356

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 139/310 (44%), Gaps = 49/310 (15%)

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           +R  D++  L+ S+ D Y GK  K +  R  +C  C              ++ C +C G 
Sbjct: 162 ERGPDIKHTLRCSLKDLYYGKKTKLRLDRTRLCVLC-------MGQGSMKKSKCFTCNGL 214

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           G   Q RR+ P M+   + SC  C G G +V +  +    C+ C G G +EE K   V I
Sbjct: 215 GSLTQTRRMGP-MIQTFSQSCPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFDVEI 269

Query: 232 PRGSRHGDRIVFEGEADQEV----GKSKT--GDLIFIVDEGTEPPEGVRLERRGYDLIT- 284
             G  +G  I+  GEAD+ V    GK K   GD++  +++         L+   +++I  
Sbjct: 270 QPGMVNGQVIILPGEADEVVNTSFGKQKVIAGDIVLTINQ---------LKDNNFEVIND 320

Query: 285 ------NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP---- 334
                 N S++L++A+ G    ++    G ++K+    G+++SPG I  V   G P    
Sbjct: 321 CDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEK 380

Query: 335 ----LNSHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPGNTEQ 390
               ++      G+LYV  DI FP      E+  + K++ +L  +   +   AD    E+
Sbjct: 381 RDPDVSIINISKGNLYVKFDIKFPTR---LEEDTIAKLKAVLSEDRYAHAEMAD----EE 433

Query: 391 VSDMKLVDQL 400
             D+  +D L
Sbjct: 434 AKDVSNLDDL 443

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD L +S +A   +IKKAYR LAL++HPDK   ++  EES+V F++I+ AYEVL D EK
Sbjct: 7  LYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVEK 63

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 64 RKLYDQYG 71

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 129/278 (46%), Gaps = 28/278 (10%)

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           +R  D++  LK ++ + Y GK  K    R  +C  C+             +  CK C+G+
Sbjct: 181 NRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLR-------KYTCKPCKGQ 233

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           G + Q +R+ P +V   + +C  C G G +V      K+ C++C+G G I++ K L V++
Sbjct: 234 GIQTQTKRMGP-LVQSWSQTCADCGGAGTFVK----NKDICEQCQGLGFIKQRKILQVTV 288

Query: 232 PRGSRHGDRIVFEGEADQEV-----GKSKT--GDLIFIVDEGTEPPEGVRLERRGYDLIT 284
             GS H   IV  GE D+ +     G+ K   GD++  +    +P   +       DLI 
Sbjct: 289 QPGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQI---TDNCDLIC 345

Query: 285 -NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP--LNSHATK 341
               + L  ++ G    +     G+++K+    G+V+ PG    VE  G P  +N   + 
Sbjct: 346 KKCEVDLMTSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSG 405

Query: 342 FGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANN 379
           FG LYV  D+ +P      E  +  K+++IL ++   N
Sbjct: 406 FGHLYVKFDVTYPER---LEPENAAKVKSILANDKYIN 440

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          SLYD+L V+  A+  EIKKAYR  AL++HPDK   ++  EES+ +F+EI  AYEVL D  
Sbjct: 6  SLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNH 62

Query: 62 KRSKYDTYGDT 72
           RS YD YG T
Sbjct: 63 LRSLYDQYGTT 73

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 130/274 (47%), Gaps = 28/274 (10%)

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           +R  D++  LK ++ + Y GK  K    R  +C+ C+             +  CK+C+G+
Sbjct: 178 NRGPDIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLK-------KYACKTCKGQ 230

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           G + Q  R+ P +V   + +C  C G G +V      K+ C++C+G G +++ K L V++
Sbjct: 231 GVQTQTNRMGP-LVQSWSQTCADCGGAGIFVE----SKDICQQCQGLGFVKQRKILQVAV 285

Query: 232 PRGSRHGDRIVFEGEADQEVG-------KSKTGDLIFIVDEGTEPPEGVRLERRGYDLI- 283
             GS H   IV  GE D+ +        K   GD++  +    +P   +  +   Y+LI 
Sbjct: 286 QPGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDD---YNLIY 342

Query: 284 TNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP--LNSHATK 341
               + L  ++ G    +     G+++KL    G+V+ PG    VE  G P  +N   + 
Sbjct: 343 KKCKVDLMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSG 402

Query: 342 FGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSE 375
           FG +YV  ++ +PR     E  + +K++ +L ++
Sbjct: 403 FGHMYVKFEVTYPRR---LEPENAIKLQKVLAND 433

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          SLYD+L V+  A+  EIKKAYR  AL++HPDK   ++  EES+ +F+EI  AYE L D  
Sbjct: 6  SLYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNH 62

Query: 62 KRSKYDTYGDT 72
           RS YD YG T
Sbjct: 63 LRSLYDQYGTT 73

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 115/253 (45%), Gaps = 23/253 (9%)

Query: 113 RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRG 172
           R  D++  LK ++ + YNGK+ K    R  +C  C              +T C+SCQG G
Sbjct: 150 RGPDIKHVLKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQ-------RTTCESCQGDG 202

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
           ++ Q RR+ P MV   T +C  C G G ++ KP    + C  C G+G I E K   V + 
Sbjct: 203 FQTQTRRMGP-MVQTWTQTCASCDGAGCFI-KPN---DVCPHCHGEGFIRERKIFHVEVK 257

Query: 233 RGSRHGDRIVFEGEADQ----EVGKSKT--GDLIFIVDEGTEPPEGVRLERRGYDLITNI 286
            G + G  ++ +GEAD+     + K K   GD++  + +  +     ++      L+   
Sbjct: 258 PGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMINNKDLLMNGC 317

Query: 287 SISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL-----NSHATK 341
            + L  ++ G +  +     G+++KL    G+++ P     +E  G P      +    +
Sbjct: 318 PVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLR 377

Query: 342 FGDLYVLVDIVFP 354
            GDLY+   I +P
Sbjct: 378 RGDLYIQFKIQYP 390

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 51/70 (72%), Gaps = 3/70 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LY+TL V   AT ++IKKAY+KLAL++HPDK   ++  E+S+ +F+ +  AYE+L+D++ 
Sbjct: 7  LYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQS 63

Query: 63 RSKYDTYGDT 72
          R+ YD  G T
Sbjct: 64 RAIYDALGIT 73

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 125/276 (45%), Gaps = 39/276 (14%)

Query: 112 DRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           +R  D++  LK ++ + Y GK  K    R  +C  CE             +  CK+C+G+
Sbjct: 185 NRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQ-------KYTCKTCKGQ 237

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231
           G + Q + + P +V   + +C  C G G +V      K+ C++C+G G I++ K L V++
Sbjct: 238 GVQTQTKCMGP-LVQSWSQTCADCGGAGIFVE----SKDICQQCQGLGFIKQRKILQVTV 292

Query: 232 PRGSRHGDRIVFEGEADQEVGKSK------TGDLIFIVDEGTEPPEGVRLERRGYDLITN 285
             G+ H   IV  GE D+ + K         GD++  +         +RL+   + +  N
Sbjct: 293 QPGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITI---------LRLKDPKFQVTDN 343

Query: 286 ISISLAEAITGLDRTLTKTL-------DGRVLKLSTPAGKVISPGKIIKVEQEGWP--LN 336
            S+   +    L  +L   +        G+++KL    G+V+ P     +E  G P  +N
Sbjct: 344 CSLIYKKCKVDLMTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFIN 403

Query: 337 SHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNIL 372
              + FG LYV  D+ +P      E  + +K++ IL
Sbjct: 404 GVRSGFGHLYVKFDVSYPER---LEPENAMKLQKIL 436

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          SLYD+L V+  A+  EIKKAYR  AL++HPDK   ++  EES+ +F+EI  AYEVL D  
Sbjct: 6  SLYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNH 62

Query: 62 KRSKYDTYGDT 72
           RS YD YG T
Sbjct: 63 LRSLYDQYGTT 73

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 142/322 (44%), Gaps = 43/322 (13%)

Query: 113 RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRG 172
           R  D++  LK ++++ Y+GK  K + +R   C KC+                C  C GRG
Sbjct: 229 RGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS-------CSKCNGRG 281

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232
              Q ++  P M    T +C  C G G +       ++ C +C+G+G + E K   V I 
Sbjct: 282 SLTQTKKFGP-MTQTFTQTCDGCGGNGTFADA----QDICNECQGEGFLNEKKIFEVEIT 336

Query: 233 RGSRHGDRIVFEGEADQ----EVGKSKT--GDLIFIVDEGTEPPEGVRLERRGYDLI-TN 285
            G   G  I+  GEAD+     +GK +   GD+I  ++   +P   V    +G DL+  N
Sbjct: 337 PGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKV---VQGADLLYAN 393

Query: 286 ISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP----------- 334
             I+L  ++ G    +       ++K++   G++I  G I  VE  G P           
Sbjct: 394 YKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSND 453

Query: 335 -LNSHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPGNTEQVSD 393
              +  T  G+L +  +IV+P      E   +++++NIL     NND       TE+ +D
Sbjct: 454 IQANKPTLKGNLVIHFEIVYPD---MLETDTVIELQNIL-----NNDKYIQNQITEEEAD 505

Query: 394 MKL-VDQLPDYMGSNGDQYAHE 414
            K+ ++ L +Y     + +A E
Sbjct: 506 NKVDLEDLVEYEEHVFNNFATE 527

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD L V  D+ +  IKKAYR LAL++HPDK   +++ EES+  F++I+ AY VLS+++K
Sbjct: 7  LYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDK 63

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 64 RQMYDKYG 71

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 127/295 (43%), Gaps = 45/295 (15%)

Query: 108 QPGDDRSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKS 167
           + G  R  D++  L  ++ + Y GK  K    R   C  C                 C  
Sbjct: 164 EKGLSRGPDIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMGGMNTII-------CNE 216

Query: 168 CQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPL 227
           CQG+G   + + + P MV   + +C  C G G ++   +     CK+C+G+G + E    
Sbjct: 217 CQGKGINTETKMLGP-MVQSWSSTCFNCSGMGYFIDSQSG----CKECQGEGYLRERTIF 271

Query: 228 TVSIPRGSRHGDRIVFEGEADQ-----EVGKSKT--GDLIFIVDE--------GTEPPEG 272
           TV++  G R+  +IV +GEADQ     ++ K K   GD+I ++++         +   +G
Sbjct: 272 TVTVKPGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQG 331

Query: 273 VRLERRGYDLIT-------NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKI 325
               +  +++I        N  I L  ++ G +  +     G+++KL     +++ P  +
Sbjct: 332 ENKNKFHFEIINEKDLLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCL 391

Query: 326 IKVEQEGWPL-----NSHATKF---GDLYVLVDIVFPRDNWFAEKSDLLKIRNIL 372
             VE  G P       ++  ++   GDLY+   + +P      E   + K+R+IL
Sbjct: 392 KCVENLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTK---LENETIDKLRSIL 443

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LY  L V   AT  EIK AY+KLAL++HPDK   ++  EES+++F+EI  AYEVL D++K
Sbjct: 14 LYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDK 70

Query: 63 RSKYDTYG 70
          +  YDTYG
Sbjct: 71 KLLYDTYG 78

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 123/281 (43%), Gaps = 28/281 (9%)

Query: 116 DVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKE 175
           D+   LK ++ D Y GK  K + +R  +C  C+             ++ C  C G G   
Sbjct: 159 DINHNLKCTIKDLYRGKRSKLRLERSKLCSICKGDGGVK-------RSMCNQCHGDGNIT 211

Query: 176 QLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGS 235
           +  R+ P M+   T +C +C+G G  +    +    C+ C G G   E K   V I  G 
Sbjct: 212 ETTRLGP-MLQTFTHTCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPGM 266

Query: 236 RHGDRIVFEGEADQEVGKSKT--GDLIFIVDEGTEPPEGVRLER--RGYDLIT-NISISL 290
           + G +IVF  E D+ V K +   G++I  ++E     E  + +R   G DL   N  I L
Sbjct: 267 KDGTQIVFNNEGDEIVNKRRVIPGNVIIHINE----IEDNKFKRVNDGQDLYYWNYEIDL 322

Query: 291 AEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVD 350
             ++ G    +    + +++K+    G++I  G +  VE  G P N    ++G LY+   
Sbjct: 323 FTSLCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMPKNK-GNEYGILYIQFQ 381

Query: 351 IVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADPGNTEQV 391
           + +P      EK ++  I+ I      + +VK    N E +
Sbjct: 382 VKYP------EKLNMESIKAIEKILLKDENVKQMQKNDENI 416

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LY+ L +   A+Q +IKKAYR  AL++HPDK   ++  EES+ +F++I+ AY +L DE +
Sbjct: 7  LYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSILRDENQ 63

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 64 RKMYDKYG 71

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 51/79 (64%), Gaps = 9/79 (11%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A+  EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD  K
Sbjct: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDSNK 60

Query: 63 RSKYDTYGDTA---DGPDF 78
          RS YD YG  A    GP F
Sbjct: 61 RSVYDQYGLDAARNGGPSF 79

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV+  AT VEIKKAYRK ++Q HPDK  DD +  E   RF+ I+ AY+VLSDE+ R
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDEDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
           KYD +G T   P   FED
Sbjct: 65 GKYDRFGKTEAVPKGGFED 83

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LG+S  A + EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD +K
Sbjct: 7  LYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDAQK 60

Query: 63 RSKYDTYG 70
          R  YDTYG
Sbjct: 61 REVYDTYG 68

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 67/139 (48%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G G + E   + + +  G + G +I F+GE D          L F++ E  +P E    
Sbjct: 208 KGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQE--KPHE--FF 263

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
            R+  DLI  + +S  E++ G  + + +T+DG+ + ++    + I P +      +G  L
Sbjct: 264 TRQDNDLIYTLPLSFKESLLGFSKQV-QTIDGKTIPIT--RTQPIQPTQTSTYPGQGMTL 320

Query: 336 NSHATKFGDLYVLVDIVFP 354
           + + ++ GDL +   I +P
Sbjct: 321 SKNPSQRGDLIIKFKIDYP 339

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 52/79 (65%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGVS  AT +EIKKAYRK A+Q HPDK  DD    E+E +F+ +  AY+VLSD E R
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDP---EAETKFQAVGEAYQVLSDTELR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          S+YD +G  D      FED
Sbjct: 65 SRYDQFGKDDAVPQQGFED 83

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A+  E+KK YRK AL++HPDK T D+       +FKEI+ A+E+LSD  K
Sbjct: 7  LYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDPNK 60

Query: 63 RSKYDTYG 70
          R  YDTYG
Sbjct: 61 REVYDTYG 68

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 72/139 (51%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +GQ  I E K + + +  G + G +I ++ E D          + FI+ E  +P E  + 
Sbjct: 203 KGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQE--KPHEFFK- 259

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
            R G DLI  + ++  E++ G D+T+ +T+DGR  ++S    + + P + ++   +G PL
Sbjct: 260 -RDGNDLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPL 315

Query: 336 NSHATKFGDLYVLVDIVFP 354
           + + ++ GDL V     +P
Sbjct: 316 SKNPSERGDLIVKYKTDYP 334

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 94/392 (23%), Positives = 155/392 (39%), Gaps = 65/392 (16%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREE--SEVRFKEITAAYEVLSDEE 61
           Y TLGVS+DA+  +IK+AY KLA ++HPD      + +E  ++  F  +  AYE+LSDE+
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPD------INKEPGADKTFHNLQNAYEILSDEK 103

Query: 62  KRSKYDT--------------------YGDTADGPDFEDESFMXXXXXXXXXXXXXXXXX 101
           K+ +YD                     +G  A    F D   +                 
Sbjct: 104 KKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRN 163

Query: 102 XXXXXAQPG------DDRSDDVQVPLKVSMADCYNG-KVFKFQSKRKIVCEKCEXXXXXX 154
                   G      + + D +++   VS  D   G      + K    C  C       
Sbjct: 164 GGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLKN 223

Query: 155 XXXXXXXQTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKK 214
                  +  C  C G G +  ++    G   Q   +C  CHG+G  +++    ++ C  
Sbjct: 224 GEQHK--RKTCSYCNGTGTQVHVK---SGF--QMASTCMHCHGEGTTIAR----EDTCSA 272

Query: 215 CRGQGM-IEEAKPLTVSIPRGSRHGDRI----------VFEGEADQEVGKSKTGDLIFIV 263
           C G G+ I   K L V+ P G   GD I          +  GE D+ +  S+ GDL+  +
Sbjct: 273 CDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSR-GDLLVRI 331

Query: 264 DEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPG 323
              ++P   V+ +   YD+ T   I +  A  G      +T+DG+ ++L   +G      
Sbjct: 332 RVKSDPKFFVKNK---YDIWTIKEIPITTAALG-GTVEIETVDGKNIRLKVISG--TQHD 385

Query: 324 KIIKVEQEGWPLNSHATKFGDLYVLVDIVFPR 355
           ++  +   G P   + T  G++ V   IV  +
Sbjct: 386 QVTSIPNMGIPY-RNGTGRGNMNVQYKIVIKK 416

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LG+S  A + EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD +K
Sbjct: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDPQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDQYG 68

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK + D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDA------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YDTYG
Sbjct: 61 REVYDTYG 68

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 65/144 (45%), Gaps = 17/144 (11%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G G   E + + + +  G + G +I ++ E D      +   L FI+ E          
Sbjct: 207 KGPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPH----SNY 262

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLS-----TPAGKVISPGKIIKVEQ 330
            R G DLI ++ ++  E++ G  +T+ +T+DGR L +S      P+     PG       
Sbjct: 263 TRDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRTLPISRVQPVQPSDSSTYPG------- 314

Query: 331 EGWPLNSHATKFGDLYVLVDIVFP 354
           +G P+    ++ G+L V   I +P
Sbjct: 315 QGMPIAKTPSQRGNLIVKYKIDYP 338

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 50/79 (63%), Gaps = 9/79 (11%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD L VS  A + EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDAEK 60

Query: 63 RSKYDTYGDTA---DGPDF 78
          R  YD YG  A   + P F
Sbjct: 61 REVYDQYGLKAARGEAPQF 79

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGVS  AT +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VL D+E R
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDDELR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          +KYD YG     P   FED
Sbjct: 65 AKYDKYGRKEAIPQGGFED 83

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A   EIKK YRK ALQ+HPDK T ++       +FK+I+ AYE+LSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNT------EKFKQISEAYEILSDSNK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 11/141 (7%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVF--EGEADQEVGKSKTGDLIFIVDEGTEPPEGV 273
           +G G  +E K + + + RG + G +I +  EG+ +   G  KT  L F++ E   P    
Sbjct: 194 KGPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKT--LQFVLQEKAHP---- 247

Query: 274 RLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGW 333
             +R G +L+  + +S  E++ G  +T+ +T+DGR L LS    + I P +      +G 
Sbjct: 248 LFKRDGENLLYTVPLSFQESLLGFSKTV-QTIDGRSLSLS--RTQPIQPTETTTYPGQGM 304

Query: 334 PLNSHATKFGDLYVLVDIVFP 354
           P   +  + GDL +   I +P
Sbjct: 305 PNPKNPNQRGDLIITYKIDYP 325

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGV+  A + EIKK YRK AL++HPDK T D+       +FK+I+ AYE+LSD  K
Sbjct: 7  LYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDT------EKFKQISEAYEILSDSNK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 68/139 (48%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G G ++E   + + +  G + G ++ ++ + D          L FI+DE   P      
Sbjct: 215 KGPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPHP----TF 270

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
           +R   +L+  + ++  E++ G  +T+ +T+DGR L +S    + I P +I +   +G P+
Sbjct: 271 QREDDNLVCTVPLTFKESLLGFSKTV-QTIDGRNLPIS--RSQPIQPTEITRYPGQGMPI 327

Query: 336 NSHATKFGDLYVLVDIVFP 354
           +    + GDL V   I +P
Sbjct: 328 SKKPGQRGDLIVKYKIAYP 346

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDA------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDNYG 68

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 69/139 (49%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G G   E + + + +  G + G +I ++ E D      +   + FI+ E  +P E    
Sbjct: 204 KGPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQE--KPHEN--Y 259

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
            R G DLI  + ++  E++ G ++T+ +T+DGR L +S    + + P  +     +G P+
Sbjct: 260 TRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPIS--RVQPVQPSDVSTYPGQGMPV 316

Query: 336 NSHATKFGDLYVLVDIVFP 354
             + ++ G+L V   I +P
Sbjct: 317 AKNPSQRGNLIVKYKIDYP 335

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A   EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD+ K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDKNK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDQYG 68

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 9/79 (11%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDSQK 60

Query: 63 RSKYDTYGDTA---DGPDF 78
          R  YD YG  A    GP F
Sbjct: 61 REIYDQYGLEAARNGGPAF 79

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 83/190 (43%), Gaps = 39/190 (20%)

Query: 180 VAPGMVAQQTVSCGM-------CHGK------GKYVSKPTSEKNQCKKCRGQGMIEEAKP 226
            +P  V ++ VS  +       C GK      G+     TSEK Q               
Sbjct: 189 ASPSQVEEEVVSVNLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQ--------------- 233

Query: 227 LTVSIPRGSRHGDRIVF--EGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLIT 284
           + + + +G + G +I +  EG+ +   G  KT  L F++ E   P      +R G +LI 
Sbjct: 234 IDIQLKQGWKAGTKITYKNEGDYNPRTGGRKT--LQFVLQEKAHP----LFKRDGDNLIY 287

Query: 285 NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
            + +S  E++ G  +T+ +T+DGR L +S    + I P +  +   +G P+     + GD
Sbjct: 288 TLPLSFKESLLGFSKTI-QTIDGRTLPISRV--QPIQPSESSRYPGQGMPITKKPGQRGD 344

Query: 345 LYVLVDIVFP 354
           L V   I +P
Sbjct: 345 LIVKYKIDYP 354

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGV+ DA Q++IKKAYRK +++ HPDK  DD    E   RF+ I+ AY+VLS EE
Sbjct: 6  TYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R KYD +G     P   FED
Sbjct: 63 LRMKYDKFGKEEAMPKNGFED 83

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 49/79 (62%), Gaps = 9/79 (11%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK Y+K AL++HPDK   D+       +FKEI+ AYE+LSD  K
Sbjct: 7  LYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDT------EKFKEISEAYEILSDSSK 60

Query: 63 RSKYDTYGDTA---DGPDF 78
          R  YD YG  A    GP F
Sbjct: 61 REIYDQYGLEAARNGGPAF 79

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 76/144 (52%), Gaps = 13/144 (9%)

Query: 213 KKCRGQGMIEEAKPLTVSIPRGSRHGDRIVF--EGEADQEVGKSKTGDLIFIVDEGTEPP 270
           +K RG G  E+ + + + +  G + G +I +  EG+ + + G  KT  L F++ E + P 
Sbjct: 210 RKNRG-GSFEKTQ-IDIQLKPGWKAGTKITYKNEGDYNPQTGGRKT--LQFVLQEKSHP- 264

Query: 271 EGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQ 330
                +R G +LI ++ +S  E++ G  +T+ +T+DGR L +S    + + P ++     
Sbjct: 265 ---LYKRDGDNLIYSLPLSFKESLLGFSKTI-QTIDGRTLPISKI--QPVQPTEVSSYPG 318

Query: 331 EGWPLNSHATKFGDLYVLVDIVFP 354
           +G P++    + GDL V   I +P
Sbjct: 319 QGMPVSKRPGQRGDLVVKYKIDYP 342

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 53/81 (65%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGVS +A  +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS+EE
Sbjct: 6  TYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNEE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD +G     P   FED
Sbjct: 63 LRTKYDKFGKEEAVPQNGFED 83

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LG+   AT VEIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS EE
Sbjct: 6  TYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD +G     P   FED
Sbjct: 63 LRAKYDKFGKQEAIPKGGFED 83

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+S  AT +EIKKAYRK +++ HPDK  +D    E   RF+ I+ AY+VLSD++ R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          S YD YG     P   FED
Sbjct: 65 SNYDKYGKEKAIPSGGFED 83

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YD+YG
Sbjct: 61 REIYDSYG 68

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 71/141 (50%), Gaps = 11/141 (7%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVF--EGEADQEVGKSKTGDLIFIVDEGTEPPEGV 273
           +G G + E K + + +  G + G +I F  EG+ +Q+ G  +T  + F++ E   P    
Sbjct: 202 KGPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQT--MQFVIQEKLHP---- 255

Query: 274 RLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGW 333
             +R G +LI  + +S  E++ G  +T+ +T+DGR L +S    + I P +      +G 
Sbjct: 256 HFKRDGNNLIYTLPLSFKESLLGFSKTI-QTIDGRTLPISRV--QPIQPSETSTYPGQGM 312

Query: 334 PLNSHATKFGDLYVLVDIVFP 354
           PL     + GDL +   + +P
Sbjct: 313 PLPKTPAQRGDLIIKYKVDYP 333

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDSQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D++K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDT------EKFKEISEAFEILNDKQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 70/141 (49%), Gaps = 11/141 (7%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFE--GEADQEVGKSKTGDLIFIVDEGTEPPEGV 273
           +G G  +E   + + +  G + G ++ ++  G+ +   G  KT  L F++ E T P    
Sbjct: 217 KGPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKT--LQFVIQEKTHP---- 270

Query: 274 RLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGW 333
             +R G DL   + ++  E++ G  +T+ +T+DGR L LS  +   + P +  +   +G 
Sbjct: 271 LYKRNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLSRSS--PVQPTETSRYPGQGM 327

Query: 334 PLNSHATKFGDLYVLVDIVFP 354
           P+    ++ GDL V   I +P
Sbjct: 328 PMPKMPSQRGDLVVRFKIDYP 348

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          +  YD LGVS  A+ +EIKKAYRK A++ HPDK  DD    +++ +F+ +  AY+VLSDE
Sbjct: 5  LEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDP---DAQAKFQRVGEAYQVLSDE 61

Query: 61 EKRSKYDTYG 70
          E R +YD +G
Sbjct: 62 ELRKRYDEFG 71

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGVS DA  +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS +E
Sbjct: 6  AYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSDE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD +G     P   FED
Sbjct: 63 LRAKYDKFGKEEAVPQNGFED 83

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LG++  ATQ EIKKAYRK +++ HPDK  +D    E   RF++I+ AY+VLSDE 
Sbjct: 6  TYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDEH 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+ YD +G     P   FED
Sbjct: 63 LRNNYDQFGKEQAIPKEGFED 83

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGVS  A+ +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VL D++ R
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          +KYD YG     P   FED
Sbjct: 65 AKYDKYGRKEAIPQGGFED 83

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDAQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+S  AT  EIKKAYR+ A++ HPDK  DD    E+E +F+ +  AY+VLSDE  R
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDP---EAENKFQAVGEAYQVLSDESLR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          ++YD YG  D      FED
Sbjct: 65 ARYDEYGKDDAVPQQGFED 83

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV  DAT  +IKKAYRK A+Q HPDK  +D    E++ +F+E++ AY+VLSD E R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDP---EAQAKFQEVSKAYKVLSDGELR 64

Query: 64 SKYDTYG 70
          S+YD  G
Sbjct: 65 SRYDEVG 71

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ LG+S  AT +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLSD+ 
Sbjct: 6  AYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDDT 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R KYD YG     P   FED
Sbjct: 63 LRLKYDKYGKKEAVPTGGFED 83

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGVS  A+ +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VL D+E R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDDELR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          +KYD +G     P   FED
Sbjct: 65 AKYDKFGRKEAIPQGGFED 83

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGVS DA Q++IKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VL  +E
Sbjct: 6  TYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSDE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD +G     P   FED
Sbjct: 63 LRAKYDKFGKDEAVPQNGFED 83

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A   EIKK YRK AL++HPDK T ++       +FKEI+ A+E+LSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNT------EKFKEISEAFEILSDSNK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDQYG 68

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGVS  A+ +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VL D E R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDNELR 64

Query: 64 SKYDTYGDTADGPD--FED 80
           KYD YG     P   FED
Sbjct: 65 VKYDKYGRKEAIPQGGFED 83

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS +    E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D  K
Sbjct: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPNK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDKYG 68

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G   I E K + + +  G + G +I ++ E D          L FI+ E         L
Sbjct: 201 KGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQEKMHD----FL 256

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
           +R G DL   + +S  E++ G  +T+  T+DGR + +S    + + P +  +   +G PL
Sbjct: 257 KRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGRQIFISKT--QPVQPSEESRYPGQGMPL 313

Query: 336 NSHATKFGDLYVLVDIVFP 354
           + + ++ GDL V   I +P
Sbjct: 314 SKNPSERGDLIVKYKIDYP 332

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 5/82 (6%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          M  YD LG+  DAT  EIKKAYR+ A+Q HPDK  DD    +++ +F+ +  AY+VLSD 
Sbjct: 5  MEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDP---DAQSKFQAVGEAYQVLSDP 61

Query: 61 EKRSKYDTYG--DTADGPDFED 80
          + +S+YD +G  D      FED
Sbjct: 62 QLKSRYDQFGKDDAVPQAGFED 83

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV   AT  EIKKAYR+ A+Q HPDK  DD    E++ +F+E+  AY+VLSD   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDP---EAQAKFQEVGEAYQVLSDPGLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          S+YD +G     P   FED
Sbjct: 65 SRYDEFGKDEAVPQQGFED 83

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  DA+  EIKKAYRK A+  HPDK  DD    E++ +F+ I  AY+VLSD E R
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGQAYQVLSDPELR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          S+YD +G  D      FED
Sbjct: 65 SRYDEFGKEDAVPQQGFED 83

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV+ +AT  +IKKAYRK A+Q HPDK  DD    E++ +F+ +  AY+VLSD   R
Sbjct: 8  YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          SKYD +G  D      FED
Sbjct: 65 SKYDQFGKDDAVPNAGFED 83

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/79 (51%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+   ATQ EIKKAYRK +++ HPDK  +D    E   RF+ I+ AY+VLSDE  R
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE---RFQAISEAYQVLSDESLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
           KYD YG     P   FED
Sbjct: 65 LKYDKYGKKEAIPQNGFED 83

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGVS DA  ++IKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS ++
Sbjct: 6  TYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKDD 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD +G     P   FED
Sbjct: 63 LRAKYDKFGKEEAVPKEGFED 83

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD LGVS  A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D   
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPNT 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%), Gaps = 7/139 (5%)

Query: 216 RGQGMIEEAKPLTVSIPRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRL 275
           +G G  +E   + + +  G + G ++ ++ + D          L F++ E   P      
Sbjct: 181 KGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAHP----DF 236

Query: 276 ERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPL 335
           +R G DLI  + +S  E++ G  +T+  T+DGR L LS    + I P +I     +G P+
Sbjct: 237 KRDGDDLIYILRLSFKESLLGFSKTIN-TIDGRKLPLSR--SQPIQPTEISTYPGQGMPV 293

Query: 336 NSHATKFGDLYVLVDIVFP 354
           + + ++ G+L +   I +P
Sbjct: 294 SKNPSQRGNLIIKYKIDYP 312

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 53/81 (65%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LG++ +AT +EIKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS++E
Sbjct: 6  AYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSNDE 62

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD  G     P   FED
Sbjct: 63 LRAKYDRLGKQEAVPKGGFED 83

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 57/86 (66%), Gaps = 7/86 (8%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD L V  DA+ +++KKAYR+ ALQ+HPDK  D+   EE+   F EI AAYEVLSD ++R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNV--EEATTIFAEIRAAYEVLSDPQER 63

Query: 64 SKYDTY-----GDTADGPDFEDESFM 84
          + YD++      DT   P+ ED+ ++
Sbjct: 64 AWYDSHKEQILSDTPLNPNDEDDDYV 89

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV  DAT  EIKKAYR+ A+Q HPDK  DD    +++ +F+ +  AY+VLSD   R
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          S+YD +G  D      FED
Sbjct: 65 SRYDEFGKDDAVPKQGFED 83

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
          LYD L V   A + E+KK YRK AL++HPDK T D+       +FKEI+ A+E+L+D +K
Sbjct: 7  LYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILNDPQK 60

Query: 63 RSKYDTYG 70
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 227 LTVSIPRGSRHGDRIVFE--GEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLIT 284
           + + +  G + G +I ++  G+ + + G  KT  L FI+ E   P      +R   +LI 
Sbjct: 232 IDIQLKPGWKAGTKITYKSKGDYNPKTGGRKT--LQFIISEKPHP----HFKREDDNLIY 285

Query: 285 NISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGD 344
            + ++  E++ G  +T+ +T+DG+ L LS   G+ + P +      +G P+     + GD
Sbjct: 286 TLPLTFKESLLGFSKTI-QTIDGKNLPLS--RGQPVQPSETTTYPGQGMPITKKPGQRGD 342

Query: 345 LYVLVDIVFP 354
           L +   + +P
Sbjct: 343 LLIKYKVDYP 352

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  DAT  EIKKAYR+ A++ HPDK  DD    +++ +F+ +  AY+VLSD   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFEDES 82
          SKYD +G  D      FED S
Sbjct: 65 SKYDEFGKEDAVPQQGFEDAS 85

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD L VS DA+  EIKK+YRKLA++ HPDK  DD    +++ +F+E+  AY+VL D++
Sbjct: 6  TYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDP---QAQTKFQELAKAYQVLIDDD 62

Query: 62 KRSKYDTYG 70
           R KYD +G
Sbjct: 63 LRKKYDQFG 71

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD LGV   A  ++IKKAYRK ++Q HPDK  +D    E   RF+ I+ AY+VLS E+
Sbjct: 7  TYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKED 63

Query: 62 KRSKYDTYGDTADGPD--FED 80
           R+KYD YG     P   FED
Sbjct: 64 LRAKYDKYGKEEAIPKEGFED 84

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  +AT  EIKKAYR+ A++ HPDK  DD    +++ +F+ +  AY+VLSD+  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDQGLR 64

Query: 64 SKYDTYG--DTADGPDFEDES 82
          SKYD +G  D      FED S
Sbjct: 65 SKYDEFGKEDAVPQQGFEDAS 85

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + AT  EIKKAYRKLA++ HPDK +     E     FK I  A+EVLS+EEK
Sbjct: 22 FYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 63 RSKYDTYGDTAD 74
          RS YD  G   D
Sbjct: 78 RSIYDRIGRDPD 89

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 7/86 (8%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV  +AT VE+KKAYR+ ALQ HPDK  D+   EE+   F  + AAYEVL+D ++R
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPDNV--EETTAIFASVRAAYEVLADPQER 63

Query: 64 SKYDTY-----GDTADGPDFEDESFM 84
          + YD +      D+ +  D +DES +
Sbjct: 64 AWYDDHKEQILNDSVNLDDADDESHL 89

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + AT  EIKKAYRKLA++ HPDK +     E     FK I  A+EVLS+EEK
Sbjct: 22 FYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEA----FKVINRAFEVLSNEEK 77

Query: 63 RSKYDTYGDTAD 74
          RS YD  G   D
Sbjct: 78 RSIYDRIGRDPD 89

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (62%), Gaps = 5/80 (6%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           YD LG+S +AT  EIKKAYRK+A+  HPDK  DD    E++ +F+ +  AY+VL+D   
Sbjct: 7  FYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDP---EAQAKFQAVGEAYQVLNDPAL 63

Query: 63 RSKYDTYGDTADGPD--FED 80
          R +YD +G     P   FED
Sbjct: 64 RKQYDEFGKDNAVPQQGFED 83

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD L V + A  VEIKK+YRKLA++ HPDK       E     FK I  A+EVLSD+E
Sbjct: 24 AFYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGEA----FKVINRAFEVLSDDE 79

Query: 62 KRSKYDTYGDTAD 74
          KRS +D  G   D
Sbjct: 80 KRSVFDRIGRDPD 92

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV  +AT  EIKKAYR+ A++ HPDK  DD    E++ +F+ +  AY+VLSD   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          S+YD +G  D      FED
Sbjct: 65 SRYDEFGKDDAVPQHGFED 83

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  +AT  EIKKAYR+ A++ HPDK  DD    +++ +F+ +  AY+VLSD   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFEDES 82
          SKYD +G  D      FED S
Sbjct: 65 SKYDEFGKEDAVPQQGFEDAS 85

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  DA+  +IKKAYRK A+  HPDK  DD    E++ +F+ I  AY+VLSD + R
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGEAYQVLSDPDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          S+YD +G     P   FED
Sbjct: 65 SRYDEFGKENAVPQQGFED 83

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y+TLGV++DA+  +IKKAY KLA Q HPD   D    E +E +F ++  AYE+LSDE KR
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKD----EGAEKKFHDLQNAYEILSDENKR 98

Query: 64  SKYDTY 69
            +YD +
Sbjct: 99  RQYDQF 104

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 103/261 (39%), Gaps = 30/261 (11%)

Query: 113 RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGRG 172
           + D +QVP K+S  D   G   K    R  V ++C              ++ C  C G G
Sbjct: 171 KGDSIQVPFKLSFRDAVFG--LKDVPLRYAVYDQC-GTCSGSGLKAGAQRSVCGGCHGTG 227

Query: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMI-EEAKPLTVSI 231
            +  +R    G   Q   +C  C G+G  + +     ++C  C G+G++    K + +  
Sbjct: 228 TQVHVR---AGF--QMASTCSQCSGEGYSIRR----GDRCGTCSGEGVVFNRNKEVKMDF 278

Query: 232 PRGSRHGDRIVFEGEAD----------QEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYD 281
           P G + GD +   G+                + + GDL+  V    +P   +   +  YD
Sbjct: 279 PHGLQDGDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQVERDPRFQI---KNNYD 335

Query: 282 LITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATK 341
           +     I +  A  G   ++  T+DG  ++L    G    P +++ +  +G P      +
Sbjct: 336 IWYVQEIPITTAALGGTVSIP-TVDGDQIRLKVIPG--TQPDQVVSIPNKGVPRGLSGAR 392

Query: 342 FGDLYVLVDIVFPRDNWFAEK 362
            GD+ V   IV  +    AEK
Sbjct: 393 -GDMKVQYRIVMKKPQSKAEK 412

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 56/85 (65%), Gaps = 11/85 (12%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK ALQ+HPDK  D+   EE+  +F  I AAYEVLSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATEKFAIIRAAYEVLSDSQER 63

Query: 64 SKYDTY-----GDT---ADG-PDFE 79
          + YD++      DT   ADG  DFE
Sbjct: 64 AWYDSHKEQILNDTPPDADGYYDFE 88

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK ALQ+HPDK  D+   EE+  +F  I AAYEVLSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAIIRAAYEVLSDSQER 63

Query: 64 SKYDTY 69
          + YD++
Sbjct: 64 AWYDSH 69

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+  +AT  EIKKAYR+ A++ HPDK  DD    +++ +F+ +  AY+VLSD   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFEDES 82
          SKYD +G  D      FED S
Sbjct: 65 SKYDQFGKEDAVPQQGFEDAS 85

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 57/84 (67%), Gaps = 8/84 (9%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK ALQ+HPDK   D+V+E +E +F  I AAYEVLSD ++R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK-NPDNVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 64 SKYDTY-----GDTA-DGPDFEDE 81
          + YD++      DTA D   + DE
Sbjct: 64 AWYDSHKEQILNDTAPDADGYYDE 87

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 7/86 (8%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ LGVS  A  +E+KKA+R+ ALQ+HPDK   D+V E +E  F +I AAYEVL+D ++
Sbjct: 5  YYELLGVSSTADDLELKKAFRRKALQYHPDK-NRDNVEEATET-FAQIRAAYEVLNDPQE 62

Query: 63 RSKYDTY-----GDTADGPDFEDESF 83
          R+ YD++      D  +G  +ED+ +
Sbjct: 63 RAWYDSHKSQILNDDINGGTYEDDEY 88

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+   AT  EIKKAYRK A++ HPDK  DD    +++ +F+ +  AY+VLSD++ R
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDP---DAQSKFQSVGEAYQVLSDDDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
           +YD +G     P   FED
Sbjct: 65 KRYDEFGKDNAVPQHGFED 83

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + AT  +IKKAYRKLA++ HPDK +     E     FK I  A+EVLS+EEK
Sbjct: 22 FYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEVLSNEEK 77

Query: 63 RSKYDTYGDTAD 74
          RS YD  G   D
Sbjct: 78 RSIYDRIGRDPD 89

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+S DAT  EIKKAYRK A+  HPDK  +D    +++ +F+ +  AY+VLSD   R
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDP---DAQAKFQAVGQAYQVLSDPGLR 64

Query: 64 SKYDTYG--DTADGPDFED 80
          S+YD +G  D      FED
Sbjct: 65 SRYDEFGKDDAVPQQGFED 83

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           YD LGVS  A+  EIK AYRKL+L+ HPDKV  D   EE    E  + +I+ AYE L+DE
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 61  EKRSKYDTYGDTADGP 76
             +  Y  YG   DGP
Sbjct: 182 LVKQNYLMYGH-PDGP 196

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK ALQ+HPDK  D+   EE+  +F  I AAYEVLSD ++R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNV--EEATQKFAVIRAAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD++
Sbjct: 64 AWYDSH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   AT +E+KKAYRK ALQ HPDK   D+V E +E+ F  I +AYEVLSD ++R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDK-NPDNVEEATEI-FATIRSAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD +
Sbjct: 64 AWYDAH 69

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LG+   AT  EIKKAYR+ A++ HPDK  DD    E   RF+++  AY+VLSD + R
Sbjct: 8  YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
           +YD +G     P   FED
Sbjct: 65 KQYDEFGKDNAVPQQGFED 83

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD L V  DAT  ++K+AYRK AL +HPDK   +++ E +EV F +I AAYEVLSD ++R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDK-NRNNIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 64 SKYDTYGD 71
          + YD + D
Sbjct: 64 AWYDAHKD 71

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV  +AT  EIKKAYR+ A++ HPDK  +D     ++ +F+ +  AY+VLSD+E R
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDP---NAQAKFQAVGEAYQVLSDDELR 64

Query: 64 SKYDTYGDTADGP 76
           +YD  G  +  P
Sbjct: 65 KRYDQLGKESAVP 77

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 49/79 (62%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LG+   AT VEIKKAYRK +++ HPDK  +D    E   RF+ I+ AY+VLSD + R
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDSDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          + YD +G     P   FED
Sbjct: 65 ANYDKFGKEKAIPKGGFED 83

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV   AT VEIKKAYRK ++  HPDK  DD    E   RF+ I+ AY+VLS+++ R
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          + YD  G     P   FED
Sbjct: 65 ANYDKSGKEKAIPKGGFED 83

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ L VS+ A+ +E+KKAYRK ALQ+HPDK  ++   EE+   F EI AAYEVLSD ++R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENP--EEATAIFSEIRAAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD++
Sbjct: 64 AWYDSH 69

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 51/75 (68%), Gaps = 4/75 (5%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   AT +E+KKAYRK ALQ HPDK   D+V E +E+ F  I +AYEVLSD ++R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDK-NPDNVDEATEI-FATIRSAYEVLSDPQER 63

Query: 64 SKYDTYGD--TADGP 76
          + YD + +   +D P
Sbjct: 64 AWYDAHKEQILSDAP 78

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 53/78 (67%), Gaps = 2/78 (2%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+  ++KKAYR+ ALQ+HPDK   + V++ +E+ F  I AAYEVLSD ++R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIGN-VQQATEI-FASIRAAYEVLSDAQER 63

Query: 64 SKYDTYGDTADGPDFEDE 81
          + YD + +     DFE++
Sbjct: 64 AWYDAHREQILNDDFEND 81

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L + ++A+  EIKKAYRKLA++ HPDK       E     FK I  A+EVLSDE+
Sbjct: 22 AFYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQ 77

Query: 62 KRSKYDTYGDTAD 74
          KR  +D  G   D
Sbjct: 78 KRRIFDQVGHDPD 90

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 50/79 (63%), Gaps = 4/79 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV---TDDSVREESEVRFKEITAAYEVLSDE 60
           Y+ LG+S  A+  +IK AYRKL+L+ HPDK+     ++ RE  E ++ +IT AYE L+DE
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 61  EKRSKYDTYGDTADGPDFE 79
             R  Y TYG   DGP  E
Sbjct: 183 LIRFNYLTYGH-PDGPQSE 200

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD L +   AT +EIKKAYRK +++ HPDK  +D    E   RF+ I+ AY+VLSD+  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDKNLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          + YD +G     P   FED
Sbjct: 65 ANYDKFGKEKAIPKGGFED 83

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y  L V + AT  EIKKAYRKLA++ HPDK       E     FK I  A+EVLS+EEK
Sbjct: 22 FYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEVLSNEEK 77

Query: 63 RSKYDTYGDTAD 74
          R  YD  G   D
Sbjct: 78 RGLYDRIGRDPD 89

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 51/79 (64%), Gaps = 5/79 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          YD LGV  ++T +EIKKAYRK +++ HPDK  ++    ++  +F+ I+ AY+VLSD+  R
Sbjct: 8  YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNP---DATKKFQAISEAYQVLSDKNLR 64

Query: 64 SKYDTYGDTADGPD--FED 80
          S YD +G     P   FED
Sbjct: 65 SNYDKFGKDKAIPKGGFED 83

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          ++ Y+ L +  DATQ EIKKAYR   L  HPDK+T ++    + V   +I  AY++LS+ 
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNN 66

Query: 61 EKRSKYD 67
          +KR +YD
Sbjct: 67 QKRGEYD 73

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 47/76 (61%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           YD LG+S  A++ EIK AYRKL+++ HPDK+  +   +E    E  + +IT AYE L+DE
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 61  EKRSKYDTYGDTADGP 76
             R  +  YG   DGP
Sbjct: 181 LTRQNFLKYGH-PDGP 195

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L + + A+  EIKK+YRKLA++ HPDK       E     FK I  A+EVLSDEE
Sbjct: 24 AFYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASEA----FKVINRAFEVLSDEE 79

Query: 62 KRSKYDTYGDTAD 74
          KR  YD  G   D
Sbjct: 80 KRRLYDRLGRDPD 92

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 6/84 (7%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK ALQ+HPDK     V E +E+ F  I  AYEVLSD ++R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK-NPTKVEEATEI-FATIRTAYEVLSDPQER 63

Query: 64 SKYDTYGDTA--DGP--DFEDESF 83
          + YD++ +    D P  ++EDE +
Sbjct: 64 AWYDSHKEQILNDIPLNEYEDEKY 87

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD L V + ++ V+IKKAYRKLA++ HPDK       E     FK I  A+EVLSD +
Sbjct: 21 AFYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSDSQ 76

Query: 62 KRSKYDTYGDTAD 74
          KR  YD  G   D
Sbjct: 77 KRQIYDQIGRDPD 89

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 60.8 bits (146), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L V + +T+ EIKKAYRKLA++ HPDK       E     FK I  A+EVLSD E
Sbjct: 21 AFYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASEA----FKIINRAFEVLSDNE 76

Query: 62 KRSKYDTYGDTAD 74
          KR  +D  G   D
Sbjct: 77 KRRIFDQLGRDPD 89

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 57.4 bits (137), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 4/62 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L V + A+ +EIKKAYRKLA++ HPDK       E     FK I  A+EVLSDE+
Sbjct: 22 AFYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSDEQ 77

Query: 62 KR 63
          KR
Sbjct: 78 KR 79

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          S Y+ L + ++A+  ++KKAYRKLA++ HPDK       E     FK+I  A+EVLSDE 
Sbjct: 24 SFYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSDEN 79

Query: 62 KRSKYDTYG 70
          KR  YD  G
Sbjct: 80 KRKVYDQIG 88

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 2/67 (2%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y TL +S DA   ++KK+YR+L L++HPDK+++D  +EE++ RF ++  +YEVL+  + R
Sbjct: 14 YATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT--KFR 71

Query: 64 SKYDTYG 70
            YD  G
Sbjct: 72 EIYDKSG 78

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+  E+KKAYRK ALQ HPDK   D+V E +E  F  I AAYEVLSD ++R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDK-NPDNVDEATE-NFATIRAAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD +
Sbjct: 64 AWYDAH 69

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           Y+ LG+S  A++ +IK AYRKL+++ HPDK++ D   +E    E  + +IT AYE L+DE
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 61  EKRSKYDTYGDTADGP 76
             R  +  YG   DGP
Sbjct: 191 AMRENFLKYGH-PDGP 205

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + A+  EIKKAYRKLA++ HPDK T     E     FK I  A+EVLSD  K
Sbjct: 25 FYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSDVGK 80

Query: 63 RSKYDTYGDTAD 74
          R  +D  G   D
Sbjct: 81 RRMFDQLGRDPD 92

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 48/79 (60%), Gaps = 10/79 (12%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVT------DDSVREESEVRFKEITAAYEVL 57
           Y+ LG+S  A+  +IK AYRKL+++ HPDKV       + SV EE+ V   +IT AYE L
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYV---QITKAYESL 183

Query: 58  SDEEKRSKYDTYGDTADGP 76
           +DE  R  Y  YG   DGP
Sbjct: 184 TDELVRQNYLKYGH-PDGP 201

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           Y  LGVS  AT  +IK AYRKL+++ HPDK++ D   EE    E  + +I+ AYE L+DE
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 61  EKRSKYDTYGDTADGP 76
             ++ Y TYG   DGP
Sbjct: 185 ITKANYLTYGH-PDGP 199

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREE---SEVRFKEITAAYEVLSDE 60
           Y+ LG+S  A+  +IK AYRKL+++ HPDK++ D  +EE    E ++ +IT AYE L+DE
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 61  EKRSKYDTYGDTADGP 76
             +  +  YG   DGP
Sbjct: 183 VIKENFLKYGH-PDGP 197

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD L V + A   EIKK+YRKLA++ HPDK       E     FK I  A+EVL DE+
Sbjct: 24 AFYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEVLGDEK 79

Query: 62 KRSKYDTYGDTAD 74
          KR  +D  G   D
Sbjct: 80 KRVLFDRIGRDPD 92

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          S Y+ L V + A+  +IKKAYRK+A++ HPDK       E     FK++  A+EVLSDE+
Sbjct: 24 SFYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSDEK 79

Query: 62 KRSKYDTYG 70
          KR  YD  G
Sbjct: 80 KRRVYDQLG 88

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + A++ +IKKAYRKLA++ HPDK       E     FK+I  A+EVLSD+ K
Sbjct: 23 FYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEVLSDDSK 78

Query: 63 RSKYDTYGDTAD 74
          R  +D  G   D
Sbjct: 79 RRIFDQLGHDPD 90

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L V + A   EIKKAYRKLA++ HPDK       E     FK I  A+EVLSD E
Sbjct: 22 AFYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEA----FKIINRAFEVLSDVE 77

Query: 62 KRSKYDTYGDTAD 74
          KR  YD  G   D
Sbjct: 78 KRQLYDRIGRDPD 90

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 53/86 (61%), Gaps = 11/86 (12%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+  ++KKAYRK AL +HPDK  D+   EE+   F  I AAYEVL+D ++R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNV--EEATAIFATIRAAYEVLADPQER 63

Query: 64 SKYDTY---------GDTADGPDFED 80
          + YD++         G T DG ++++
Sbjct: 64 AWYDSHKQQILSDDIGMTNDGEEYDE 89

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDD---SVREESEVRFKEITAAYEVLSDE 60
           Y+ LGVS  A   EIK AYRKL+++ HPDK+  D     R + E  + +IT AYE L+DE
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 61  EKRSKYDTYGDTADGP 76
             +  Y  YG   DGP
Sbjct: 184 NVKENYLRYGH-PDGP 198

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 2/75 (2%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+  ++KKAYR+ ALQ+HPDK  D+   EE+   F  I +AYEVL+D ++R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNV--EEATTVFATIRSAYEVLADPQER 63

Query: 64 SKYDTYGDTADGPDF 78
          + YD++       DF
Sbjct: 64 AWYDSHKQQILSDDF 78

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + + + EIKK+YRKLA++ HPDK       E     FK I  A+EVLSD EK
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASEA----FKVINRAFEVLSDNEK 78

Query: 63 RSKYDTYGDTAD 74
          R  +D  G   D
Sbjct: 79 REIFDRIGRDPD 90

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 8/66 (12%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREE--SEVRFKEITAAYEVLSDEE 61
          Y  LGV   A+Q EIKKAY KLA Q+HPD      + +E  +E +F ++  AYE+LSDE 
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPD------INKEAGAEKKFHDLQNAYEILSDES 90

Query: 62 KRSKYD 67
          KR ++D
Sbjct: 91 KRKQFD 96

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 91/272 (33%), Gaps = 51/272 (18%)

Query: 113 RSDDVQVPLKVSMADCYNGKV-FKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           + D V V   +S  D   GK   K +      C+ C              +  C  CQG 
Sbjct: 182 KGDSVHVSYNMSFKDAVFGKSGVKLKFNVFDPCDTCSGSGIKKGAS----RHQCPGCQGS 237

Query: 172 GYKEQLRR-----------VAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGM 220
           G K  +R               G     +  CG CHG+G +                   
Sbjct: 238 GTKIHVRGGFQMMSTCNECQGEGTTVNSSDLCGACHGEGVH------------------- 278

Query: 221 IEEAKPLTVSIPRGSRHGDRIVFEGEADQ-EVG---------KSKTGDLIFIVDEGTEPP 270
               K +TV +P G + GD I   G+    EV          K   GD++  V    +P 
Sbjct: 279 FHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPT 338

Query: 271 EGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQ 330
             +R +    D+   + I +  A  G       T+DG  ++L    G     G +I V  
Sbjct: 339 FTIRDKS---DIWYTMEIPITTAALG-GTVQVPTVDGSHIRLKVAPG--TQSGDVITVPN 392

Query: 331 EGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
            G P ++     G + V   IV  + +   EK
Sbjct: 393 MGVPRSNLTRSRGAMKVQYRIVIKKPSSEVEK 424

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVR---FKEITAAYEVLSDE 60
           Y+ LG+S  A+  +IK AYRKL+++ HPDK+      +E +V    + +IT AYE L+DE
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 187 LVRQNYLKYGH-PDGP 201

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ LGV   A+ +E+KKAYRK AL++HPDK  ++   EE+   F  I  AYEVLSD ++R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNV--EEATQAFATIRLAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD++
Sbjct: 64 AWYDSH 69

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 48/79 (60%), Gaps = 10/79 (12%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVT------DDSVREESEVRFKEITAAYEVL 57
           Y+ LG+S  A+  +IK AYRKL+++ HPDK+       + SV EE+ V   +IT AYE L
Sbjct: 127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYV---QITKAYESL 183

Query: 58  SDEEKRSKYDTYGDTADGP 76
           +DE  R  Y  YG   DGP
Sbjct: 184 TDELVRQNYLKYGH-PDGP 201

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + A   EIKK+YRKLA++ HPDK       E     FK I  A+EVL D EK
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA----FKLINRAFEVLGDSEK 78

Query: 63 RSKYDTYGDTAD 74
          RS YD  G   D
Sbjct: 79 RSLYDRLGRDPD 90

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          ++ Y+ L +  DATQ EIK+AYR   L  HPDK+T ++    S V   +I  AY +LSD 
Sbjct: 7  LTHYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDI 66

Query: 61 EKRSKYD 67
            R +YD
Sbjct: 67 RSRCEYD 73

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 109/254 (42%), Gaps = 31/254 (12%)

Query: 162 QTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGM- 220
           +T C SC G G    +R    G   Q   +C  C G+G  V+      + CK C G+G+ 
Sbjct: 237 KTTCPSCHGSGTTVHVR---AGF--QMMSTCQTCGGEGTTVN----ASDFCKSCHGEGVN 287

Query: 221 IEEAKPLTVSIPRGSRHGDRIVFEGEA-------DQEVGKS---KTGDLIFIVDEGTEPP 270
           +   K +TV +P G + GD +   G+        D+E+ KS     GD++  +    +P 
Sbjct: 288 VNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSRGDILVRIRVNKDPH 347

Query: 271 EGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQ 330
             +   +  YD+     I +  A  G   ++  T++G  +++  PAG   +P ++I +  
Sbjct: 348 FSI---KNKYDIWYTKEIPITTAALGGTVSI-PTIEGTKIRIKVPAG--TAPEQVISIPN 401

Query: 331 EGWP-----LNSHATKFGDLYVLVDIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKADP 385
            G P      NS     GD+ +   +V  +    AE+     + ++     A   +++  
Sbjct: 402 MGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADVTNDTNAKRTMESFA 461

Query: 386 GNTEQVSDMKLVDQ 399
            + E+  + KL D 
Sbjct: 462 SSVEKSVEDKLSDN 475

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%), Gaps = 8/66 (12%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREE--SEVRFKEITAAYEVLSDEE 61
           Y+TLGV + ++Q +IKKAY KLA ++HPD      + +E  +E +F ++  AYE+LSDE 
Sbjct: 49  YETLGVKKSSSQSDIKKAYYKLAKKYHPD------INKEAGAEKKFHDLQNAYEILSDES 102

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 103 KRKQYD 108

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEV---RFKEITAAYEVLSDE 60
           Y+ LGVS  A+  +IK AYRKL+++ HPDK+      +E  V    + +IT AYE L+DE
Sbjct: 127 YEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 187 LVRQNYLKYGH-PDGP 201

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          S Y+TLG++ D +  EIKKAY++  L  HPDK+ D+S    S V   +I  AY+VL D  
Sbjct: 4  SHYETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDES----SSVEVNKIQEAYKVLCDVN 59

Query: 62 KRSKYD 67
           R KYD
Sbjct: 60 LREKYD 65

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 4/72 (5%)

Query: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62
           Y+ L V + A+  EIKKAYR+LA++ HPDK    +    S   FK I  A+EVL DE+K
Sbjct: 24 FYEVLQVERTASDNEIKKAYRRLAIKLHPDK----NGHPRSAEAFKVINRAFEVLGDEDK 79

Query: 63 RSKYDTYGDTAD 74
          R  +D  G   D
Sbjct: 80 RRLFDQLGRDPD 91

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           Y+ LG+   AT+ E++ +YRKL+++ HPDK++ D  +EE    E ++  IT AY+ L++E
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 177 VTRENYLKYGH-PDGP 191

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ L V   A   E+KKAYR+ ALQ+HPDK   ++V E +E+ F  I AAYEVLSD ++R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK-NPENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 64 SKYDTY 69
          + YD++
Sbjct: 64 AWYDSH 69

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (64%), Gaps = 4/82 (4%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y+ L V   A+  ++KKAYR+ ALQ+HPDK   ++++E +++ F  I  AYE+LSD ++R
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNI-NNIKEATDI-FANIRTAYEILSDPQER 63

Query: 64 SKYDTYGDTA--DGPDFEDESF 83
            YD++ +    D P  ED S+
Sbjct: 64 VWYDSHKNQILNDEPIMEDGSY 85

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ LGV  DAT  EIKKAYRK AL   P+K   +    E   +F+ I  AY+VL  +E
Sbjct: 6  AYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANE---KFQAIAEAYQVLHSKE 62

Query: 62 KRSKYDTYGDTADGPD--FEDES 82
           R KYD  G  A  P   FED S
Sbjct: 63 LREKYDKLGKEAAIPKKGFEDAS 85

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y TLG+S +A + EI K+Y  LA Q HPDK    S  E S  +FK I+ A+ VL DE 
Sbjct: 13 TYYSTLGLSSNANEAEIHKSYMMLARQLHPDK----SKSEASAEQFKLISHAHSVLMDEA 68

Query: 62 KRSKYD 67
          KR KYD
Sbjct: 69 KRLKYD 74

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVRE---ESEVRFKEITAAYEVLSDE 60
           Y  LGV+  AT  E++ AYRKL+++ HPDK+  D  +E   E E ++  IT AY+ L+DE
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 61  EKRSKYDTYGDTADGP 76
             +  Y  +G   DGP
Sbjct: 178 ITKENYLKFGH-PDGP 192

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV---TDDSVREESEVRFKEITAAYEVLSDE 60
           Y+ LGV+  +T+ EIKKAYR L+L+ HPDK+     +  R   E  F +I+ AYE L++ 
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 61  EKRSKYDTYGDTADGP 76
             +  Y  YG   DGP
Sbjct: 183 ATKENYLLYGH-PDGP 197

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV--TDDSVREESEVRFKEITAAYEVLSDEE 61
           Y  LG+S++AT  +I+KAY +L  ++HPDK     +S ++++  +  EI  AYE LSDE 
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 62  KRSKYDT 68
           K+S+YD+
Sbjct: 621 KKSEYDS 627

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSV---REESEVRFKEITAAYEVLSDE 60
           Y+ LGV+  +T  EIK AYRKL+++ HPDK++ D     R   E +F  I  AY+ L+DE
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 61  EKRSKYDTYGDTADGP 76
             +  Y  YG   DGP
Sbjct: 173 ITKENYRKYGH-PDGP 187

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 4/70 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y+TLGVS+DA+  +IKKAY KLA ++HPD   D    E +E +F ++  AYE+LSDE KR
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKD----EGAEKKFHDLQNAYEILSDESKR 108

Query: 64  SKYDTYGDTA 73
           S+YD +G  A
Sbjct: 109 SQYDQFGAAA 118

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 112/266 (42%), Gaps = 40/266 (15%)

Query: 113 RSDDVQVPLKVSMADCYNG-KVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           + D + VP  VS  D   G K  K +      C  C              +++C  C G 
Sbjct: 187 KGDSIHVPFNVSFKDAVFGLKGIKLKYSAYDQCGTC----AGSGLKSGAKRSSCSICHGT 242

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMI-EEAKPLTVS 230
           G +  +R    G   Q   +C  C+G+G  + +     +QC  CRG+G++    K + V 
Sbjct: 243 GTQMHVR---AGF--QMASTCTQCNGEGSSIRR----SDQCSSCRGEGVVFNRQKEIDVD 293

Query: 231 IPRGSRHGD--RIVFEG-----EADQEVG---KSKTGDLIFIVDEGTEPPEGVRLERRGY 280
           +P G + GD  ++  +G     + D E+    +++ GDL+  +    +P   +   R  Y
Sbjct: 294 LPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDPRFQI---RNNY 350

Query: 281 DLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPG----KIIKVEQEGWPLN 336
           D+     I +  A  G    +  T+DG  L+L       I+PG    +++ V  +G P  
Sbjct: 351 DIWYTQDIPITTAALGGVVNI-PTVDGEQLRLK------IAPGTQHEQVVSVPNKGVPKG 403

Query: 337 SHATKFGDLYVLVDIVFPRDNWFAEK 362
             A++ GD+ V   I   +    AEK
Sbjct: 404 LTASR-GDMKVQYKISLRKPQSKAEK 428

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%), Gaps = 2/67 (2%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV--TDDSVREESEVRFKEITAAYEVLSDEE 61
           Y  LGV + AT  +++++Y +L  + HPDK    +D  R+++E +  EI  AYE+LSD++
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 62  KRSKYDT 68
           KR+KYD 
Sbjct: 590 KRTKYDN 596

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y+ L V++ A   EIKKAYRKLA++ HPDK       E     FK I  A+EVL + E
Sbjct: 22 AFYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAEA----FKLINRAFEVLGNSE 77

Query: 62 KRSKYDTYGDTAD 74
          KR  ++  G   D
Sbjct: 78 KREIFNRIGRDPD 90

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDD-SVREES--EVRFKEITAAYEVLSDE 60
           Y  L VS  +T  EI+ AYRKL+++ HPDK++ D S  E S  E ++  IT AY+ L+DE
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 179 VTRENYLKYGH-PDGP 193

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y  LG++  AT  EI+K+Y KLA Q HPDK   DS  E     FK +  A+ +L+DEE
Sbjct: 7  TYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE----LFKLVVHAHSILTDEE 62

Query: 62 KRSKYDT 68
           + KYDT
Sbjct: 63 TKRKYDT 69

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 52/76 (68%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y TLG++ +A+Q +IKKAY KLA ++HPD     +  E +E +F ++  AYE+LSDE+KR
Sbjct: 49  YKTLGINSNASQSDIKKAYYKLAKKYHPDI----NKEENAEAKFHDLQNAYEILSDEQKR 104

Query: 64  SKYDTYGDTADGPDFE 79
            +YD +G +A  P+  
Sbjct: 105 KQYDQFGPSAFDPNIN 120

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           YD LG+S  A+  +IK AYR+L+L+ HPDK++ +   EE    E  + +I+ A+E L+D 
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 187 IVRENYLKYGH-PDGP 201

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 95/237 (40%), Gaps = 41/237 (17%)

Query: 144 CEKCEXXXXXXXXXXXXXQTNCKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVS 203
           C KC              +T C SC G G K  +R    G   Q   +C  CHG+G  + 
Sbjct: 252 CNKCSGSGLNRNAK----RTTCPSCHGSGQKVHIRS---GF--QMVSTCNHCHGEGTII- 301

Query: 204 KPTSEKNQCKKCRGQGM-IEEAKPLTVSIPRGSRHGDRIVFEGEADQ-EVGKS------- 254
                K+ C  C G G+ +   K + V++P G + GD I   G+ +  + G S       
Sbjct: 302 ---DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMN 358

Query: 255 ----KTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVL 310
                 GDL+  V    +P   +R +   YD+     I +  AI G       T+DG  +
Sbjct: 359 SIKLSRGDLLVRVRVNKDPNFSIRDK---YDIWFTKQIPITTAILG-GVVKIPTVDGTQI 414

Query: 311 KLSTPAGKVISPG----KIIKVEQEGWPLNS-HATKFGDLYVLVDIVFPRDNWFAEK 362
           +L       +SPG    +II +   G P +S +    G++ V   I+       AEK
Sbjct: 415 RLK------VSPGTKHDQIISIPNLGVPRSSINKDNRGNMKVQYKIIMKTPQSQAEK 465

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 4/70 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           Y  LGV+  A+  EIKKAY KLA ++HPD     + + ++E +F ++  AYE+LSDE KR
Sbjct: 81  YSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDENKR 136

Query: 64  SKYDTYGDTA 73
            +YDT+G +A
Sbjct: 137 KQYDTFGPSA 146

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 112/264 (42%), Gaps = 37/264 (14%)

Query: 113 RSDDVQVPLKVSMADCY---NGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQ 169
           R D +++  KVS  D     N    KF +     C  C              + NC +C 
Sbjct: 197 RGDPIEIVHKVSFKDAVFGSNNVQLKFSALDP--CSTCSGTGMKPNTH----KVNCSTCH 250

Query: 170 GRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGM-IEEAKPLT 228
           G G    +R    G   Q   +C  C+G+G  + +P   ++ C KC G+G+ +  AK +T
Sbjct: 251 GTGTTVHIR---GGF--QMMSTCPTCNGEGT-MKRP---QDSCTKCHGEGVQVNRAKTIT 301

Query: 229 VSIPRGSRHGDRIVFEG---------EAD-QEVGKSKTGDLIFIVDEGTEPPEGVRLERR 278
           V +P G + GD +   G         EAD ++  K   GD++  +    +P   +   + 
Sbjct: 302 VDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVRIRVDKDPNFSI---KN 358

Query: 279 GYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSH 338
            YD+  +  I +  A  G   T+  T++G+ +++    G   +  ++I +   G P  + 
Sbjct: 359 KYDIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPGTQYN--QVISIPNMGVPKTT- 414

Query: 339 ATKFGDLYVLVDIVFPRDNWFAEK 362
            T  GD+ +   IV  +    AEK
Sbjct: 415 -TIRGDMKIQYKIVVKKPQSLAEK 437

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YDTLG+ + AT  EIKKAY KLA ++HPD     +   ++E +F ++  AYE+LSDE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEVDAEKKFHDLQNAYEILSDENKR 118

Query: 64  SKYD 67
            +YD
Sbjct: 119 QQYD 122

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKV---TDDSVREESEVRFKEITAAYEVLS 58
          S Y+ LG+  DA+ +EIK+AYR + L+ HPDK     + +    S     +I  AY+ L 
Sbjct: 4  SFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLI 63

Query: 59 DEEKRSKYD 67
          D++ R KYD
Sbjct: 64 DQDLRKKYD 72

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEV---RFKEITAAYEVLSDE 60
           Y  L +S  +T  EI+ AYRKL+++ HPDK++ D   +E  V   ++  IT AY+ L+DE
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 177 ITRENYLRYGH-PDGP 191

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 112/262 (42%), Gaps = 33/262 (12%)

Query: 113 RSDDVQVPLKVSMADC-YNGKVFKFQSKRKIVCEKCEXXXXXXXXXXXXXQTNCKSCQGR 171
           R D +++  KVS  D  +  K  + +      C  C              + +C +C G 
Sbjct: 198 RGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTH----KVSCSTCHGT 253

Query: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGM-IEEAKPLTVS 230
           G    +R    G   Q   +C  C+G+G  + +P   ++ C KC G+G+ +  AK +TV 
Sbjct: 254 GTTVHIRG---GF--QMMSTCPTCNGEGT-MKRP---QDNCTKCHGEGVQVNRAKTITVD 304

Query: 231 IPRGSRHGDRIVFEG---------EAD-QEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY 280
           +P G + GD +   G         EAD ++  K   GD++  +    +P   +   +  Y
Sbjct: 305 LPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSI---KNKY 361

Query: 281 DLITNISISLAEAITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHAT 340
           D+  +  I +  A  G   T+  T++G+ +++    G   +  ++I +   G P  S  T
Sbjct: 362 DIWYDKEIPITTAALGGTVTI-PTVEGQKIRIKVAPGTQYN--QVISIPNMGVPKTS--T 416

Query: 341 KFGDLYVLVDIVFPRDNWFAEK 362
             GD+ V   IV  +    AEK
Sbjct: 417 IRGDMKVQYKIVVKKPQSLAEK 438

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YDTLG+ + AT  EIKKAY KLA ++HPD     +   ++E +F ++  AYE+LSDE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDETKR 118

Query: 64  SKYD 67
            +YD
Sbjct: 119 QQYD 122

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKV----TDDSVREESEVRFKEITAAYEV 56
          +S Y+ LGV  DA+  EIK  YRK+ L  HPDK      D +++  S V   +I  AY V
Sbjct: 9  ISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRV 68

Query: 57 LSDEEKRSKYD 67
          LS+++ R+ Y+
Sbjct: 69 LSNDQLRAAYN 79

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          S Y+ LGV  D  +V+IKKAY+   L  HPDKV  D     ++V  +EI  AY VL +  
Sbjct: 6  SFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDV---GNKVLIEEIKEAYRVLIESP 62

Query: 62 KRSKYD 67
           R KYD
Sbjct: 63 SREKYD 68

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV--TDDSVREESEVRFKEITAAYEVLSDEE 61
           Y  LG+  DA   +I++AY  L  ++HPDK     D+ R + E +   I  AYEVLSDE 
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 571 KRKEYD 576

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          ++ Y+ L +  DATQ EIKKAYR   L  HPDK++       S V   +I  AY++LS+ 
Sbjct: 7  LTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNI 66

Query: 61 EKRSKYD 67
          + R +YD
Sbjct: 67 KTRREYD 73

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          ++ Y+ L +  DATQ EIKKAYR   L  HPDK+   +  + + V    I  AY+VLS+ 
Sbjct: 7  LTHYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNI 66

Query: 61 EKRSKYD 67
          + R +YD
Sbjct: 67 KTRGEYD 73

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y  LGV  DAT  EI K+YRKLA++ HPDK   D   E     FK +  A+ VL++ E+R
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEE----LFKLVVHAHSVLTNGEER 66

Query: 64 SKYD 67
          +KY+
Sbjct: 67 AKYN 70

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 1  MSLYDTLGVSQDATQV---EIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVL 57
          ++LYD LG   + + +   EIKK YR LAL++HPDK  +D    E   +F +IT A  +L
Sbjct: 13 VNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVE---KFHKITIALNIL 69

Query: 58 SDEEKRSKYDTYGDT 72
          ++ + +++YD + ++
Sbjct: 70 TNNQLKTEYDKWLNS 84

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEV--RFKEITAAYEVLSDEE 61
           Y  L VS+DA   +I+K+Y  L  + HPDK    S +E+ ++  +  EI  AYEVLSDE 
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDET 588

Query: 62  KRSKYD 67
           KR++YD
Sbjct: 589 KRNEYD 594

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREES---EVRFKEITAAYEVLSDE 60
           YD LG+S  ++  +IK AYRKL+++ HPDK++ D   +E    E ++ +IT AYE L+DE
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 61  EKRSKYDTYGDTADGP 76
             R  Y  YG   DGP
Sbjct: 184 TVRENYLKYGH-PDGP 198

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV--TDDSVREESEVRFKEITAAYEVLSDEE 61
           Y TLGV+  AT  EI+KAY  L  ++HPDK+    +  +E       +I  AYE LSD+ 
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 600 KRKEYD 605

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKV--TDDSVREESEVRFKEITAAYEVLSDEE 61
           Y  LGVS +A   EI+KAY  L  ++HPDK+    +  +E       +I  AYE LSDE+
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 604 KRKEYD 609

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
          Y  LG++ DAT+ +IKKAYRK+A+  HPDK    S  E     FK ++ A  VL D+E+R
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAE----LFKLVSHAQSVLIDKEQR 69

Query: 64 SKYD 67
            Y+
Sbjct: 70 QSYN 73

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 92/227 (40%), Gaps = 47/227 (20%)

Query: 165 CKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYV----------SKPTSE------ 208
           C +C G G K    +V          SC  CHG G  V          + PT        
Sbjct: 234 CGTCSGTGMKPNTHKV----------SCTTCHGSGSTVHVRGGFQMMSTCPTCNGEGTMK 283

Query: 209 --KNQCKKCRGQGM-IEEAKPLTVSIPRGSRHGDRIVFEG---------EAD-QEVGKSK 255
             ++ C  C G+G+     K +TV +P G + GD +   G         EAD Q+  K  
Sbjct: 284 RPQDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLS 343

Query: 256 TGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTP 315
            GD++  +    +P   +R +   YD+  +  I +  A  G   T+  T+DG+ +++   
Sbjct: 344 RGDILVRIRVDKDPSFSIRNK---YDIWYDKEIPITTAALGGTITI-PTVDGQKIRIKVA 399

Query: 316 AGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
            G   +  ++I +   G P    AT  GD+ V   IV  +    AEK
Sbjct: 400 PGTQYN--QVISIPNMGVPRT--ATLRGDMKVQYKIVVKKPQSLAEK 442

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YDTLG+ + AT  EIKKAY KLA ++HPD     +   ++E +F ++  AYE+LSD+ KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDDTKR 118

Query: 64  SKYD 67
            ++D
Sbjct: 119 QQFD 122

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          ++ Y+ L V  DA+ +EIK+AYR   L  HPDK  D++ +    V    I  AY VLSDE
Sbjct: 2  LTHYEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDEN-KPALNVSVNAIQEAYRVLSDE 60

Query: 61 EKRSKYD 67
          + R +YD
Sbjct: 61 KLRREYD 67

>AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR285C
           (ZUO1)
          Length = 430

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 3   LYDTLGVSQ---DATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSD 59
           LY  +G+S+    ATQ +I KA+RK  L+HHPDK +      E +  FK I  A+E L+D
Sbjct: 98  LYAAMGLSKLRYKATQAQIIKAHRKQVLKHHPDKKSAAGASLEEDNFFKIIQKAFETLTD 157

Query: 60  EEKRSKYDTYGDTAD 74
             KR+++D+    AD
Sbjct: 158 PVKRAQFDSCDFNAD 172

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVR--FKEITAAYEVLSDEE 61
           Y  LGV+  AT  EI+KAY  L  ++HPDK+  +   +E  +     +I  AYE LSD++
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 597 KRKEYD 602

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + YD +GV    +Q ++K +Y++L  + HPDK +    +E     F  +  AY+ LS+++
Sbjct: 23 TYYDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQ 78

Query: 62 KRSKYDTYGDTA 73
          KR+ YD YG+ A
Sbjct: 79 KRAMYDKYGNDA 90

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          +LY  L +   AT+V+I+KAY KLA + HPDK    S  EE+   FK++  A+ +L+D++
Sbjct: 14 TLYSVLNLKYGATEVQIRKAYMKLARELHPDK----SKSEEAGELFKKVAHAHFILTDKK 69

Query: 62 KRSKYDT 68
          ++ KYD+
Sbjct: 70 EKMKYDS 76

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 3   LYDTLGVSQ---DATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSD 59
           LY  +G+S+    AT+ +I KA+RK  L+HHPDK +     E+    FK I  AYE L+D
Sbjct: 97  LYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGF-FKIIQKAYETLTD 155

Query: 60  EEKRSKYDTYGDTAD 74
             KR++YD+    AD
Sbjct: 156 SNKRAQYDSCDSNAD 170

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3   LYDTLGVSQ---DATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSD 59
           LY  +G+S+    AT  +I KA+RK  L+HHPDK +     EE    FK I  AYE L+D
Sbjct: 98  LYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGF-FKIIQKAYETLTD 156

Query: 60  EEKRSKYDTYGDTAD 74
             KR++YD+    AD
Sbjct: 157 SNKRAQYDSCDFNAD 171

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 4  YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDD------SVREESEVRFKEITAAYEVL 57
          Y+ L ++ DAT  EIKKAY++  L  HPDK +        +  + + V   +I  AY++L
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 58 SDEEKRSKYD 67
          S+E  R +YD
Sbjct: 71 SNESTREQYD 80

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVR--FKEITAAYEVLSDEE 61
           Y  LGVS  A+  EI+KAY  L  ++HPDK+  +   ++  +     +I  AYE LSD++
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 600 KRKEYD 605

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDK--VTDDSVREESEVRFKEITAAYEVLSDEE 61
           Y  LGV Q AT  +I+K+Y  +  ++HPDK     ++ + +++ +  EI  AYE+LSDE 
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 62  KRSKYD 67
           KR +YD
Sbjct: 567 KRKEYD 572

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y TLG+S +A+  EI K+Y KLA + HPDK   D   E     FK I+ A+ VL D+E
Sbjct: 13 TYYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAE----LFKLISHAHSVLMDKE 68

Query: 62 KRSKYD 67
          K+  YD
Sbjct: 69 KKDAYD 74

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEV--RFKEITAAYEVLSDEE 61
           Y  LG+S+ A+  EI+KAY  L  ++HPDK    S +E+ ++  +  ++  AYE+LSDE 
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 62  KRSKYDT 68
           K+  YD 
Sbjct: 584 KKRDYDN 590

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 91/227 (40%), Gaps = 47/227 (20%)

Query: 165 CKSCQGRGYKEQLRRVAPGMVAQQTVSCGMCHGKGKYV----------SKPTSE------ 208
           C +C G G K    +V          +CG CHG G  V          + PT        
Sbjct: 235 CGTCSGTGMKPNTHKV----------NCGTCHGTGTTVHIRGGFQMMSTCPTCNGEGTMK 284

Query: 209 --KNQCKKCRGQGM-IEEAKPLTVSIPRGSRHGDRIVFEGEAD----------QEVGKSK 255
             ++ C KC G+G+ +   K +TV +P G + GD +   G+            ++  K  
Sbjct: 285 RPQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEEDLKDSVKLS 344

Query: 256 TGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAITGLDRTLTKTLDGRVLKLSTP 315
            GD++  +    +P   +   +  YD+  N  I +  A  G   T+  T++G+ +++   
Sbjct: 345 RGDILVRIRVDKDPNFSI---KNKYDIWYNKEIPITTAALGGTVTIP-TVEGQKIRIKVA 400

Query: 316 AGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFPRDNWFAEK 362
            G   +  ++I +   G P     T  GD+ V   IV  +    AEK
Sbjct: 401 PGTQYN--QVISIPNMGVP--KTPTIRGDMKVQYKIVVKKPQSLAEK 443

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 4/66 (6%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63
           YDTLG+ + AT  EIKKAY KLA ++HPD     +   ++E +F ++  AYE+LSDE KR
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDESKR 118

Query: 64  SKYDTY 69
            +YD +
Sbjct: 119 QQYDQF 124

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVT---DDSVREESEVRFKEITAAYEVLSDE 60
           Y+ L V   AT  EI+ AYRKL+++ HPDK+     D+ R   E ++  IT AY+ L+D+
Sbjct: 117 YELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDD 176

Query: 61  EKRSKYDTYGDTADGP 76
             R  +  YG   DGP
Sbjct: 177 ATRDNFLRYGH-PDGP 191

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y  LG+  DAT  +I+K+Y KLA + HPDK   +   E     FK +  A+ +L+D E
Sbjct: 12 TYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAE----LFKVVAHAHSILTDRE 67

Query: 62 KRSKYD 67
          KR KYD
Sbjct: 68 KRLKYD 73

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 5/66 (7%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          S YD LG++ DA  +E+++AYR+  L+ HPDK     V + +  R ++   AY VLSD  
Sbjct: 4  SHYDILGIAVDAEPLEVRQAYRQRLLEAHPDK--QGGVDKGAVTRIQQ---AYRVLSDPT 58

Query: 62 KRSKYD 67
          +RS YD
Sbjct: 59 QRSAYD 64

>TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4
           YGR285C
          Length = 433

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 3   LYDTLGVSQ---DATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSD 59
           LY  +G+S+    AT+ +I KA+RK  L+HHPDK +      E +  FK I  A+E L+D
Sbjct: 98  LYAAMGLSKLRYRATENQIIKAHRKQVLKHHPDKKSASGAGLEQDGFFKIIQKAFETLTD 157

Query: 60  EEKRSKYDTYGDTAD 74
             KR++YD+    AD
Sbjct: 158 NNKRAQYDSCDFNAD 172

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%), Gaps = 10/76 (13%)

Query: 1  MSLYDTLGVS-------QDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAA 53
          ++LY  LG S       +  + ++++K YRKLALQ+HPDK   D+       +F +++ A
Sbjct: 13 VNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKNPHDTSLIH---KFHQVSVA 69

Query: 54 YEVLSDEEKRSKYDTY 69
           ++LSD   RS YD++
Sbjct: 70 TKILSDSRLRSLYDSW 85

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 1  MSLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDE 60
          +S Y  LG+  DA    IKKAYR+  L+ HPDK     +  ES +   ++  AY VL D+
Sbjct: 3  VSHYSVLGIDSDADSDTIKKAYRRRLLETHPDK---KQISNES-LSVDQLQKAYRVLIDK 58

Query: 61 EKRSKYDT 68
          E R+KYD+
Sbjct: 59 ELRAKYDS 66

>AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YJL162C
          (JJJ2)
          Length = 535

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 4/66 (6%)

Query: 2  SLYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEE 61
          + Y  LG+   A+++ I+KAY +LA + HPDK    S  +E+   FK +  A+ VL+D+E
Sbjct: 12 TYYSLLGLPFGASELHIRKAYMRLARELHPDK----SKSKEAAELFKVVAHAHSVLTDKE 67

Query: 62 KRSKYD 67
          KR KYD
Sbjct: 68 KRLKYD 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,668,373
Number of extensions: 1823573
Number of successful extensions: 4959
Number of sequences better than 10.0: 394
Number of HSP's gapped: 4451
Number of HSP's successfully gapped: 477
Length of query: 432
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 320
Effective length of database: 40,638,807
Effective search space: 13004418240
Effective search space used: 13004418240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)