Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01584g8.265ON28228213090.0
TDEL0F039208.265ON3223293362e-36
Suva_2.2738.265ON3763763173e-33
YDR113C (PDS1)8.265ON3733813033e-31
Smik_4.3588.265ON3713753023e-31
Skud_4.3748.265ON3733022586e-25
SAKL0H16962g8.265ON3363542163e-19
Kpol_543.418.265ON3063202101e-18
NCAS0B038308.265ON3253032066e-18
KNAG0H032308.265ON2811931843e-15
AGR083W8.265ON2952581801e-14
Ecym_43058.265ON3112551757e-14
KLLA0F19206g8.265ON2631681721e-13
Kwal_56.237818.265ON2932271606e-12
KLTH0G13618g8.265ON3022991492e-10
KAFR0B055108.265ON2752161323e-08
CAGL0L12298g8.265ON2862191226e-07
NDAI0J013508.265ON4221231093e-05
TBLA0E044608.265ON277123860.019
TPHA0A017808.265ON352266870.020
TPHA0D034003.518ON33826702.2
CAGL0J01309g2.471ON44255702.3
Skud_13.1732.565ON92039693.3
CAGL0H09746g7.149ON63452693.3
KLLA0C18777g6.377ON34156659.7
ZYRO0A09526g8.430ON33873659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01584g
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   508   0.0  
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   134   2e-36
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   126   3e-33
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   121   3e-31
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   120   3e-31
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   103   6e-25
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    88   3e-19
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    86   1e-18
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    84   6e-18
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    75   3e-15
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    74   1e-14
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    72   7e-14
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    71   1e-13
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    66   6e-12
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    62   2e-10
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    55   3e-08
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    52   6e-07
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    47   3e-05
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    38   0.019
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    38   0.020
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    32   2.2  
CAGL0J01309g Chr10 (122339..123667) [1329 bp, 442 aa] {ON} simil...    32   2.3  
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    31   3.3  
CAGL0H09746g Chr8 complement(951805..953709) [1905 bp, 634 aa] {...    31   3.3  
KLLA0C18777g Chr3 complement(1665876..1666901) [1026 bp, 341 aa]...    30   9.7  
ZYRO0A09526g Chr1 complement(769311..770327) [1017 bp, 338 aa] {...    30   9.7  

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/282 (91%), Positives = 258/282 (91%)

Query: 1   MVGKVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRG 60
           MVGKVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRG
Sbjct: 1   MVGKVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRG 60

Query: 61  QRRLPLASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD 120
           QRRLPLASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD
Sbjct: 61  QRRLPLASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD 120

Query: 121 GXXXXXXXXXXNSELQKKLQDAMNRREDSNEGLGGLAKLVRDTKDDIEYAPHRLPPLEYA 180
           G          NSELQKKLQDAMNRREDSNEGLGGLAKLVRDTKDDIEYAPHRLPPLEYA
Sbjct: 121 GDDEDDDEEEENSELQKKLQDAMNRREDSNEGLGGLAKLVRDTKDDIEYAPHRLPPLEYA 180

Query: 181 PDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIXXXXXXXXXXXXX 240
           PDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSI             
Sbjct: 181 PDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIESNNEDSNENEAD 240

Query: 241 XILPKNHRIHPFPKLRVFDEDQVENIYNGEGLNAEELEDLLA 282
            ILPKNHRIHPFPKLRVFDEDQVENIYNGEGLNAEELEDLLA
Sbjct: 241 EILPKNHRIHPFPKLRVFDEDQVENIYNGEGLNAEELEDLLA 282

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 162/329 (49%), Gaps = 63/329 (19%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP--EEN----------TPVKKS 52
           + +NKEN++VL+  E+G ++ PQTP HLLKRSQ  ++KP  EEN           PVK++
Sbjct: 3   INENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVKRA 62

Query: 53  RSVSPVR--GQRRLPLASKDHNKSSA------------------AGPVKKRQPTLQGELL 92
              SP R   Q R PLASKD+N+S+                   +   K+    + G+LL
Sbjct: 63  ---SPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLL 119

Query: 93  SNPRKLQKYGSVLGYTDLPRTKSLVLKDGXXXXXXXXXXNSE------LQKKLQDAMNRR 146
           +NPR+L+KYGSVLGY  LP+ KSLVLKD           N +      L+ KL +A++R 
Sbjct: 120 TNPRRLKKYGSVLGYNALPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRS 179

Query: 147 EDSNEGLGGLA------KLVRDTKDD--------IEYAPHRLPPLEYAPDGHTRWEDEDI 192
           ++  E +GGL        LVRD+K D        IEY P R  PL Y P+GH     ED 
Sbjct: 180 DEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDY 239

Query: 193 VKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPF 252
            KLK    R     +D   +   +  DG L L  I              I  +N  +   
Sbjct: 240 DKLKT--FRSPYLIEDDYSDSDDDKQDGFLQLEEI------GSAGDDENIERENLTVKQR 291

Query: 253 PKLRVFDEDQVENIYNGEGLNAEELEDLL 281
             L  +D  +++  Y GEGL+A +L DLL
Sbjct: 292 EMLPQYDTFEIQPSYCGEGLDASDLNDLL 320

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  126 bits (317), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 120/376 (31%), Positives = 170/376 (45%), Gaps = 100/376 (26%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-----------EENTP----- 48
             ++KENN+V    E+ S + PQTP HLLKRS  NVLKP             N+      
Sbjct: 3   ANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNLKY 62

Query: 49  VKKSRSVSPVRG-------QRRLPLASKDHNKSSA-------------AGPVKKRQPTLQ 88
           ++  + VSP +        Q RLPLA+KD+N+S +             A  V ++Q TL 
Sbjct: 63  IQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLS 122

Query: 89  GE----------------------LLSNPRKLQKYGSVLGYTDLPRTKSLVLKD------ 120
                                   +L+N RKLQKYGSVLGY  LP+ KSLVLKD      
Sbjct: 123 TRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADPAK 182

Query: 121 ---GXXXXXXXXXXNSELQKKLQDAMNRR---EDSNE-----GL----GGLAKLVRDTKD 165
                         +++L +KLQ A  ++   ED +E     GL    GGL +L+++T  
Sbjct: 183 NQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAK 242

Query: 166 -------------DIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDN 212
                        DIE AP R  PL Y PDG+  ++ EDI+KLK  +     D + + +N
Sbjct: 243 GKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNN 302

Query: 213 EPQENDDGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPFPKLRVFDEDQ------VENI 266
               +  GLL L+ +              I  +         L+  ++D       +E++
Sbjct: 303 TNSADKVGLLSLVEV--NEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL 360

Query: 267 YNGEGLNAEELEDLLA 282
           YNGEGL++EELEDLL 
Sbjct: 361 YNGEGLDSEELEDLLT 376

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  121 bits (303), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 122/381 (32%), Positives = 167/381 (43%), Gaps = 114/381 (29%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP--------------EENT--P 48
             ++KENN+V    E+  +  PQTP HLLKRS  N+LKP                NT   
Sbjct: 4   ANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTLKY 63

Query: 49  VKKSRSVSPVR-------GQRRLPLASKDHNKS-SAAGPVKKRQ------PTLQG----- 89
           ++  + VSP +        Q RLPLA+KD+N+S S   P    Q      P LQ      
Sbjct: 64  IQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIR 123

Query: 90  ---------------------ELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD-------- 120
                                +LLSN RKLQKYGSVLGY  LP+ KSLVLKD        
Sbjct: 124 KNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADSGKNE 183

Query: 121 -GXXXXXXXXXXNSELQKKLQDAMNRREDS------NEGL------GGLAKLVRDTKD-- 165
                        S+L KKLQ A+ +++ S      N GL      GGL +L++++    
Sbjct: 184 ESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNSTKNE 243

Query: 166 --------------DIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHED 211
                         DIE AP R  PL Y P+G++ ++ +DI KLK  +   + D +D ED
Sbjct: 244 QKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED-ED 302

Query: 212 NEPQENDDGLLPLMSIXXXXXXXXXXXXXX---------ILPKNHR-IHPFPKLRVFDED 261
           + P + D  LLPL  I                       +L KN + +   P + +    
Sbjct: 303 DTPDKVD--LLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMEL---- 356

Query: 262 QVENIYNGEGLNAEELEDLLA 282
               +Y+ EGL+ EELEDL+ 
Sbjct: 357 ----VYSEEGLDPEELEDLVT 373

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  120 bits (302), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 122/375 (32%), Positives = 168/375 (44%), Gaps = 103/375 (27%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-----------EENTP----- 48
             ++KENN+V     + +L  PQTP HLLKRS  NVLKP             N       
Sbjct: 3   ANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKY 62

Query: 49  VKKSRSVSPVR-------GQRRLPLASKDHNKSSA-------------AGPVKKRQPTL- 87
           ++  + VSP +        Q RLPLA+KD+N++ +             A  + ++Q TL 
Sbjct: 63  IQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLS 122

Query: 88  ---------------------QGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD----GX 122
                                  +LL+N RKLQKYGSVLGY  LP+ KSLVLKD    G 
Sbjct: 123 IRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGK 182

Query: 123 XXXXXXXXXNSE-----LQKKLQDAMNRREDSNE--------GL----GGLAKLVRD--- 162
                     SE     L KKLQ+A+ ++  S++        GL    GGL +L+++   
Sbjct: 183 NEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQ 242

Query: 163 ----TKDD------IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDN 212
               +K D      IE AP RL PL Y PDG++ +  EDI KLK  +      + D ED+
Sbjct: 243 NESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPY---ELDLEDD 299

Query: 213 EPQENDDGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPFPKL-----RVFDEDQVENIY 267
               +   LLPL +I              I        P P L     ++     +E++ 
Sbjct: 300 GGSTDKVDLLPLEAI---NEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLC 356

Query: 268 NGEGLNAEELEDLLA 282
           NGEGL+ EELEDL+ 
Sbjct: 357 NGEGLDPEELEDLIT 371

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  103 bits (258), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 133/302 (44%), Gaps = 94/302 (31%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-----------EENTP----- 48
             ++KENN+V    E+  +  PQTP HLLKRS  NVLKP             N       
Sbjct: 3   ANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKY 62

Query: 49  VKKSRSVSPVR-------GQRRLPLASKDHNKSSA-------------AGPVKKRQPTLQ 88
           ++  + VSP +        Q RLPLA+KD+N+S +             +  + ++Q TL 
Sbjct: 63  IQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLS 122

Query: 89  ----------------------GELLSNPRKLQKYGSVLGYTDLPRTKSLVLKDGXXXXX 126
                                  ELL+N RKLQKYGSVLGY  LP+ KSLVLKD      
Sbjct: 123 IRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGPAK 182

Query: 127 XXXXXN---------SELQKKLQDAMNRREDSNE--------GL----GGLAKLVRDTKD 165
                +         S+L  KLQ+A  ++  S++        GL    GGL +L+++T  
Sbjct: 183 NQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTK 242

Query: 166 DIE---------------YAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHE 210
             +                AP R  PL Y PDG+  ++ EDI KL+  +     D +DH 
Sbjct: 243 GKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHG 302

Query: 211 DN 212
           D+
Sbjct: 303 DS 304

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 87.8 bits (216), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 105/354 (29%), Positives = 151/354 (42%), Gaps = 96/354 (27%)

Query: 4   KVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP-EENTPVKKSRSVSPVRGQR 62
           +  +NKEN  V+   EN    LP TP HLLKRSQ + +KP   N+P KKS         +
Sbjct: 2   RTHENKEN--VIFSSEN----LPTTPSHLLKRSQ-SFMKPLASNSPTKKS--------GK 46

Query: 63  RLPLASKDHNKSSA---------------------AGPVKKRQPTLQ--GELLSN----- 94
           RLPLASKD+NKS+                       G +K+ +P +   G  ++      
Sbjct: 47  RLPLASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKS 106

Query: 95  ------PRKLQKYGSVLGYTDLPRTKSLVLKDGXXXXXXXXXXNSE-------------- 134
                   +L+KYGSVLGY  LPR KSLVLKD             E              
Sbjct: 107 SFPLLPDSRLKKYGSVLGYNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNP 166

Query: 135 LQKKLQDAMNRR--EDSNEG----LG---GLAKLVR--------DTKDDIEYAPHRLPPL 177
           L  KL  A+N    +D  EG    LG   GL +L++        ++  +IE  P     L
Sbjct: 167 LAAKLLKALNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEEL 226

Query: 178 EYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIXXXXXXX--- 234
            + P+G++ +++ D++KL          ++D  D E  ++ DGLL +  +          
Sbjct: 227 PHVPNGYSPFKESDVIKLNTFTSPFSMHKED-SDCEECDDYDGLLTISMVKSEDEEQDDD 285

Query: 235 -------XXXXXXXILPKNHRIHPFPKLRVFDEDQVENIYNGEGLNAEELEDLL 281
                         +    H +  F K  ++    +E  YNGEGLN E+LE LL
Sbjct: 286 TNDRKRRKSWIDEGLATARHGLFDFNKPELY----IEPHYNGEGLNKEDLESLL 335

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 85.5 bits (210), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 146/320 (45%), Gaps = 65/320 (20%)

Query: 8   NKENNVVLDPGENGSLA-LPQTPIHLLKRSQPNVLKPEENTPVKK---SRSVSPVRGQRR 63
           NKENN+      +  L  +PQTP +LLKR+   +      T + K     +V     Q+R
Sbjct: 4   NKENNIF----RHAMLKDMPQTPNNLLKRTHSKL-----KTGIAKDIQGGNVINTSPQKR 54

Query: 64  LPLASKDHNKSSAAGPVK------------------------KRQPTLQ---GELLSNPR 96
           LPLASKD+N+S++                             K+Q   Q     +L++ R
Sbjct: 55  LPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILADDR 114

Query: 97  KLQKYGSVLGYTDLPRTKSLVLKDGXXXXXXXXXXNSELQKKLQDAMNRRE----DSNEG 152
           KL+KYGSVLGY  LP+ KSLVLK            +  L  KL+D+MN++      SN G
Sbjct: 115 KLKKYGSVLGYNALPKVKSLVLK---DISDNEDDDDDLLSLKLRDSMNKKSINTNKSNSG 171

Query: 153 L-----GGLAKLVRDTKDD---IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRD 204
           +     G L +L+RD  +D   IE+  +  P  EY PD H  +++ DI KLK  +   + 
Sbjct: 172 IGLLSGGNLQQLIRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKL 231

Query: 205 DQDDHEDNEPQENDDGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPFPKLR-VFDED-- 261
           +Q + +D E          L+ +                 KN  I+  P  + V   D  
Sbjct: 232 EQSNSDDEEDSS------ELLLLANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADIL 285

Query: 262 QVENIYNGEGLNAEELEDLL 281
            +E  Y GEGL++ +LEDLL
Sbjct: 286 DIEPSY-GEGLDSNDLEDLL 304

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 84.0 bits (206), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 94/303 (31%), Positives = 130/303 (42%), Gaps = 75/303 (24%)

Query: 25  LPQTPIHLL-KRSQPNVLKPEENTPVKKSRSVSPVRGQ-----RRLPLASKDHNKSSAAG 78
           +P+TP HLL KRS   VLKP       +  ++SP R Q      RLPLA KD+N SS + 
Sbjct: 28  MPETPAHLLLKRSLSTVLKPNSVNATDELGNISPRRRQLLQLQNRLPLAKKDNNNSSFSS 87

Query: 79  PVKKRQPTLQGELLSNPRKLQKYGSVLGYTDLPRTKSLVLK--DGXXXXXXXXXXNSELQ 136
                    +   L+N +KL+KYGSVLG   LPRTKSL+LK  D           ++   
Sbjct: 88  ---------RKNGLNNIKKLKKYGSVLGMDALPRTKSLILKDVDDKPDDDEEDEDDNAFG 138

Query: 137 KKLQDAMNRR------------------------EDSNEGLGGLAKLVR----------- 161
            KL++AM +                         ++S   LGGL +L+R           
Sbjct: 139 LKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKI 198

Query: 162 -----------DTKDDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHE 210
                      D+  +IEYAP R  PL + P G+T +  EDI KLK      + D     
Sbjct: 199 RSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDS---- 254

Query: 211 DNEPQENDDGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPFPKLRVFDEDQVENI--YN 268
                E+ D LL L +I                 ++HR  P    R  ++D ++ +  YN
Sbjct: 255 PVSTVEDADKLLALETIETSVDDEAEWEHEV---RHHRRRP---TRDSNDDSIDLVPLYN 308

Query: 269 GEG 271
           GEG
Sbjct: 309 GEG 311

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 98/193 (50%), Gaps = 20/193 (10%)

Query: 22  SLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSV--SPVRGQRRLPLASKDHNKSSAAGP 79
           ++A+PQTP   +      VLKP   +  K+S SV  SP RG R LPLASKD+N S     
Sbjct: 10  AVAVPQTPASNILDGSGVVLKPV-GSRGKQSFSVRKSPTRGGR-LPLASKDNNASGLVVS 67

Query: 80  VK-KRQPTLQGELLSNPRKLQKYGSVLGYTD--LPRTKSLVLKDGXXXXXXXXXXNSELQ 136
            K  RQP  Q    ++ RKL++YGS+LGY +  L R+KSL+LKD              L 
Sbjct: 68  GKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSKSVTKRLL 127

Query: 137 KKLQDAMNRREDSNEGL------------GGLAKLVRDTKD-DIEYAPHRLPPLEYAPDG 183
              + A N  +  ++G             GGL +LVR +++ ++E  P     L Y PDG
Sbjct: 128 LDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRLVRQSQNRELEIRPQAQDELPYIPDG 187

Query: 184 HTRWEDEDIVKLK 196
           H    + DI KL+
Sbjct: 188 HIILHEADIAKLR 200

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 117/258 (45%), Gaps = 58/258 (22%)

Query: 4   KVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRR 63
           K  ++KEN +V   G      +P+TPIH LKRS  N+                  R   R
Sbjct: 2   KKHEDKEN-LVTSAGRGA--MMPRTPIHQLKRSSSNLAG----------------RNSTR 42

Query: 64  LPLASKDHNKSSAAGPVK-------------KRQPTLQGELLSNP-RKLQKYGSVLG--Y 107
           +PLASKD N+S     +K              ++P       + P  KL+KYGSVLG  Y
Sbjct: 43  MPLASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGY 102

Query: 108 TDLPRTKSLVLKDGXXXXXXXXXXNSE----LQKKLQDAMNRRE------DSNEGL---G 154
             L + KSLVLKD             E    L  KL+  +   E      D + GL    
Sbjct: 103 GSLAKAKSLVLKDTSDCESANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGE 162

Query: 155 GLAKLVR--DTKDDI---EYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD---LRIRDDQ 206
            L++L    +T++D+   EYAP +LP L + P+G+   +  D+ KL K     LR   D+
Sbjct: 163 ALSQLAAAGETQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRF-GDK 221

Query: 207 DDHEDNEPQENDDGLLPL 224
           +D E+ EP ++   L+PL
Sbjct: 222 EDEENTEPGDSQQ-LIPL 238

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 117/255 (45%), Gaps = 69/255 (27%)

Query: 20  NGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLPLASKDHNKSSAAGP 79
           +GS+ +P+TP+H LKRS  NV                 ++   RLPLASKD N+S +   
Sbjct: 17  SGSI-VPRTPMHQLKRSTSNV----------------HLKNNSRLPLASKDRNRSQSGFN 59

Query: 80  VKK------------------RQPTLQGELLSNP-RKLQKYGSVLG--YTDLPRTKSLVL 118
           +K+                  ++P     + + P  KL+KYGSVLG  Y  L +TKSLVL
Sbjct: 60  LKQQLVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVL 119

Query: 119 KD--------GXXXXXXXXXXNSELQKKLQDAMNRR-EDSNE-----------GLGGLAK 158
           KD        G           + L  KL+  +    ED NE           GL  L K
Sbjct: 120 KDASDGSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIK 179

Query: 159 LVRDTKDD------IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD---LRIRDDQDDH 209
           L      D      IE AP ++P LE+ P+G+ ++EDE+IVKL       LR  D ++D 
Sbjct: 180 LHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREED- 238

Query: 210 EDNEPQENDDGLLPL 224
            D++  E +  L+PL
Sbjct: 239 -DSDSTEGERLLIPL 252

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 89/168 (52%), Gaps = 22/168 (13%)

Query: 47  TPVKK-SRSVSPVRGQRRLPLASKDHNKS---------SAAG----PVKKRQPTLQGELL 92
           TP+ +  R+ S VRG RR PLASKD+N++         +A G    P+K+   +    + 
Sbjct: 23  TPLNQMKRTDSLVRGNRR-PLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMP 81

Query: 93  SNPRKLQKYGSVLGY-TDLPRTKSLVLKDGXXXXXXXXXXNSELQKKLQDAMNRREDSNE 151
            N  KL+KYGSVLG  T +PRTKSLVLKD             + +  L       +  N 
Sbjct: 82  EN--KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLP-IFPSGKSLNL 138

Query: 152 GLG-GLAKLVRDTKDD--IEYAPHRLPPLEYAPDGHTRWEDEDIVKLK 196
           G G GL  L+R+ +D+  IEYAP R   L Y P+G+  ++ E I KL+
Sbjct: 139 GFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQ 186

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 103/227 (45%), Gaps = 52/227 (22%)

Query: 5   VQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRL 64
            ++NKEN +          ++P TP HLL RSQ  +            +++SP R ++R 
Sbjct: 3   ARENKENAIW------SERSVPVTPTHLLSRSQSFM------------KNISPKRAEQRK 44

Query: 65  PLASKDHNKSS----AAGPVKKR-QPTLQ--GELLSNPRKLQKYGSVLGYTDLPRTKSLV 117
           PLASKD+NKS+    A  P++KR +PT+   G  + N R       +L     PR KSLV
Sbjct: 45  PLASKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLV 102

Query: 118 LKDGXXXXXXXX-------XXNSELQKKLQDAMNR--REDSNE-----------GLGGLA 157
           LKD                  ++ L  KL+  +N   R+DS E                 
Sbjct: 103 LKDDIEEEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANT 162

Query: 158 KLVRDTKD-----DIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD 199
           KL  +T D     ++E  P R  PL + P G+T + DEDI KL+  +
Sbjct: 163 KLHSETLDSDSDLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTE 209

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 121/299 (40%), Gaps = 56/299 (18%)

Query: 25  LPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLPLASKDHNKS-SAAG---PV 80
           +P TP HLL RSQ  +            ++ SP R + R PLASKD+N+S S  G   P+
Sbjct: 17  VPVTPRHLLSRSQSFM------------KNKSPKRAEARRPLASKDNNRSVSYLGTKEPL 64

Query: 81  KKR-QPTL--QGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKDGXXXXXXXXX------- 130
           +KR +P +   G  + N R        L  +  P+ KSLVLKDG                
Sbjct: 65  RKRTRPGVNHAGSFVGNAR--LGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVDED 122

Query: 131 ---XNSELQKKLQDAMNRREDSNEG--------LGGLAKLV----------RDTKDDIEY 169
               ++ L  KL+  +  R+   EG         GGL  L+           D+  ++E 
Sbjct: 123 DDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEVEV 182

Query: 170 APHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEPQENDDGLLPLMSIXX 229
            P R  PL + P+G+T + +++I KL+ VD+          D +   N      L ++  
Sbjct: 183 IPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTLNF 242

Query: 230 XXXXXXXXXXXXILPKNHRIHPFPKL-------RVFDEDQVENIYNGEGLNAEELEDLL 281
                          K H       +       R  D  ++E  Y G GL A+ELE LL
Sbjct: 243 DRDDNDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLL 301

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 98/216 (45%), Gaps = 44/216 (20%)

Query: 6   QDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLP 65
           Q +KENN            L   P+  L+    N +K  +NT   +   +  ++ Q +LP
Sbjct: 4   QSDKENN------------LSTIPVLALQTPNTNFVK--KNTTSTRISPLKRLQQQGKLP 49

Query: 66  LASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLGYTD-----LPRTKSLVLKD 120
           L SK+ NKS++     K           N  +++KYGS+LG  +     LP+TKSL+LKD
Sbjct: 50  LQSKNGNKSNSILISHK----------GNNTRIKKYGSILGLENPGNFKLPKTKSLILKD 99

Query: 121 GXXXXXXXXXXNSELQKKLQDAMNRREDSN--EGLGGLAKLVR-----------DTKDDI 167
                      +  L +KL++A++R ++    EG G +    +           D++ DI
Sbjct: 100 N--ESSESEEEDGLLNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHISNDDDSEIDI 157

Query: 168 EYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIR 203
                +   L Y PD +     ++I KLK+V+L  R
Sbjct: 158 INGKEKDVELSYIPDHYEVIAADEIEKLKQVNLGTR 193

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 99/219 (45%), Gaps = 53/219 (24%)

Query: 2   VGKVQDNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQ 61
           +G V+ +KENNVV    E G    P TP  LLKR++  +L P++N             GQ
Sbjct: 1   MGAVETDKENNVVGTLREKG----PATPTQLLKRTRSTLL-PKKN-------------GQ 42

Query: 62  RRLPLASKD--HNKSSAAGPVKKRQPTLQGELLSNPRKLQ----KYGSVLGYTDLPRTKS 115
           R+ PLASKD  +N+SS+   +K+          SN +KL+    + GS     +  R  S
Sbjct: 43  RQ-PLASKDKNYNRSSSYLSLKRN---------SNQKKLKPAVTRAGSTANNANR-RVTS 91

Query: 116 LVLKDGXXXXXXXXXXNSE---------LQKKLQDAMNRREDSNEGL-------GGLAKL 159
           L+LKD            S+         L  K++ A+     S EG         GL K+
Sbjct: 92  LILKDIASGDEKESASESDSEDDEESNPLALKIKQALTHSIASAEGKTGLLNGKSGLRKI 151

Query: 160 V--RDTKDDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLK 196
              RD   +IE A  R P   Y P+G+   +D D+ KLK
Sbjct: 152 FNDRDLDREIEVASVREPEKPYEPEGYEPLDDSDLEKLK 190

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 34/123 (27%)

Query: 23  LALPQTPIHLLKRS-----------QPNVLKPEENTPVKKSR---SVSPVRG----QRRL 64
           +  PQTP HLLKRS           +P  L+ +  +         ++SP R     Q R 
Sbjct: 35  ILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRF 94

Query: 65  PLASKDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSVLG-------YTDLPRTKSLV 117
           PL+ KD+N S     +K++Q         + ++L+KYGSVLG       + +L R KSLV
Sbjct: 95  PLSKKDNNNSFI---LKQQQQQF------DHKRLKKYGSVLGLGTDGNNHNNLTRIKSLV 145

Query: 118 LKD 120
           LKD
Sbjct: 146 LKD 148

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 59/150 (39%), Gaps = 28/150 (18%)

Query: 160 VRDTKDDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD--LRIRDDQDDHEDNEPQEN 217
             D +DDIEYAP R   L Y P G+T + +EDI KLK       I  D  D++ +     
Sbjct: 269 TYDEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLG 328

Query: 218 D-DGLLPLMSIXXXXXXXXXXXXXXILPKNHRIHPFPKLRVFDE---------------- 260
           D + LL L S                L     IH    +   D+                
Sbjct: 329 DPEMLLSLQSFDTQTATTSSSCASPSLYPTTPIHKDTNINTTDQKHNTVILNVHNNDNES 388

Query: 261 ---------DQVENIYNGEGLNAEELEDLL 281
                     +++ IYNG+GL+ ++L DL+
Sbjct: 389 EGEYGGEHDQEIDKIYNGDGLDEDDLNDLI 418

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 58/123 (47%), Gaps = 27/123 (21%)

Query: 23  LALPQTPIHLLKRSQPNVLK--PEENTPVKKSR------SVSPVRGQRRLPLASKDHN-K 73
              P+TP   LKR   N+LK     +T V KS+      + S +  +R  PLASKD N +
Sbjct: 9   FTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARR--PLASKDKNVR 66

Query: 74  SSAAGPVKKRQPTLQGELLSNP------------RKLQKYGSVLGYTDLP----RTKSLV 117
            +A G VK    +      S               +L+KYGSVLGY++       +K+L+
Sbjct: 67  RTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSNNTINSNASKTLI 126

Query: 118 LKD 120
           LKD
Sbjct: 127 LKD 129

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 110/266 (41%), Gaps = 66/266 (24%)

Query: 24  ALPQTPI-HLLKRSQPNVLKPEENTPVKKSRSVSPVRGQ-RRLPLASKDHNKSSAAGPVK 81
            +PQTP+  LLKR+    L        ++S+  +    +  RLPLASKD+N S  +    
Sbjct: 35  TVPQTPMDKLLKRTHSKTLSTAVFKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFI 94

Query: 82  KRQPTL----QGELLSN---PRKLQKYGSVLGYTDLPR--------TKSLVLKD------ 120
            +   L    Q  LL+N     KL+KYGS+LG  +            KSL+LKD      
Sbjct: 95  LQNNKLVLNKQLSLLNNNQTSNKLRKYGSILGVNNNGNNTNKTLNPVKSLILKDIPDNGN 154

Query: 121 -------GXXXXXXXXXXNSELQKK-------LQDA-MNRREDSNE---GL----GGLAK 158
                              + LQ K       L++A  N   DS E   GL     GL K
Sbjct: 155 ENDDDDDDDDDNIITLNLKNALQSKKEPLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQK 214

Query: 159 LVRDTKD-----------DIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKV-----DLRI 202
           L+  + +           +IE      P L Y+P+G+  + +EDI KL        +L +
Sbjct: 215 LISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNV 274

Query: 203 RDD-QDDHEDNEPQENDDGLLPLMSI 227
            D    DH +N    N+ GLL L ++
Sbjct: 275 NDSLLADHNNN----NNSGLLELENV 296

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 196 KKVDLRIRDDQDDHEDNEPQENDDGL 221
           KKV+  + D ++D EDNEP  N++GL
Sbjct: 279 KKVEFHLADQENDSEDNEPIRNNNGL 304

>CAGL0J01309g Chr10 (122339..123667) [1329 bp, 442 aa] {ON} similar
           to uniprot|P32832 Saccharomyces cerevisiae YMR091c NPL6
          Length = 442

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 54  SVSPVRGQRRLPLAS----KDHNKSSAAGPVKKRQPTLQGELLSNPRKLQKYGSV 104
           +V PVRGQ+  P AS    ++  KS+ A P +   P  Q  LLSNP  L+   SV
Sbjct: 259 TVFPVRGQKPKPTASDLKRQEKQKSATATPTE--LPKKQSPLLSNPTFLEYRNSV 311

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 aa]
           {ON} YMR019W (REAL)
          Length = 920

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 42  KPEENTPVKKSRSVSPVRGQRRLPLASKDHNKSSAAGPV 80
           + EEN  VK+    +P+R   ++PLA++ HN ++ +G V
Sbjct: 834 REEENVNVKQG---NPLRNNGKVPLATRSHNTTAFSGSV 869

>CAGL0H09746g Chr8 complement(951805..953709) [1905 bp, 634 aa]
          {ON} similar to uniprot|P40009 Saccharomyces cerevisiae
          YER005w YND1
          Length = 634

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 8  NKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVR 59
          +K+  +V+D G +GS       +H+ +   PNVL+  EN+     RSV  +R
Sbjct: 3  SKQYGIVIDAGSSGS------RVHVYEWDDPNVLRESENSTPALLRSVPEIR 48

>KLLA0C18777g Chr3 complement(1665876..1666901) [1026 bp, 341 aa]
           {ON} similar to uniprot|P25366 Saccharomyces cerevisiae
           YCR095C Cytoplasmic protein required for replication of
           Brome mosaic virus in S. cerevisiae which is a model
           system for studying replication of positive-strand RNA
           viruses in their natural hosts
          Length = 341

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 26  PQTPIHLLKRSQPNVLKPEENT-----PVKKSRSVSPVRGQR-RLPLASKDHNKSS 75
           P+ P H++       LKPEE+      P+K SRS   + G R RL    ++ N+ +
Sbjct: 236 PELPQHMMSMIHTMELKPEEDAKEHELPIKHSRSALGIFGNRYRLAFNKRERNEYT 291

>ZYRO0A09526g Chr1 complement(769311..770327) [1017 bp, 338 aa] {ON}
           weakly similar to uniprot|Q04922 Saccharomyces
           cerevisiae YDR219C Hypothetical ORF
          Length = 338

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 153 LGGLAKLVRDTKDDIEYAPHRLPPLEYAPDGHTRW-EDEDIVKLKKVDLR-IRDDQDD-H 209
           +G  + L+R      + A H L         H+ W  D     + ++DL  IR D+D+ H
Sbjct: 25  VGKCSHLLR------QLANHALLTKNVLISAHSNWIRDSLFFDMSRMDLEFIRHDEDEGH 78

Query: 210 EDNEPQENDDGLL 222
           E+ E ++ND+ LL
Sbjct: 79  EEQEKEDNDEQLL 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,412,700
Number of extensions: 1482351
Number of successful extensions: 8845
Number of sequences better than 10.0: 71
Number of HSP's gapped: 8868
Number of HSP's successfully gapped: 75
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)