Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01562g8.266ON27727714740.0
TDEL0F039308.266ON2802755602e-70
Kwal_56.237778.266ON2672434687e-57
SAKL0H16940g8.266ON3032734282e-50
KLTH0G13596g8.266ON2672604219e-50
AGR082C8.266ON2662523713e-42
Kpol_392.48.266ON2812793488e-39
KLLA0F19228g8.266ON3052363105e-33
Ecym_43048.266ON2892672958e-31
NDAI0B020108.266ON2812742912e-30
NCAS0B050408.266ON2732762842e-29
YLR091W (GEP5)8.266ON2932132521e-24
Smik_12.1508.266ON2922132406e-23
Suva_10.1758.266ON2992742391e-22
Skud_12.1598.266ON2942682353e-22
KAFR0B027408.266ON2562582315e-22
KNAG0G020608.266ON2862861651e-12
TPHA0J007608.266ON2492291136e-06
ZYRO0E01254g2.627ON65295683.8
SAKL0C02486g1.77aON50984684.0
NDAI0B040402.198ON70287684.3
Skud_4.5068.470ON61166675.2
NDAI0H015707.171ON41452658.2
NOTE: 1 genes in the same pillar as ZYRO0C01562g were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01562g
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   572   0.0  
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   220   2e-70
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   184   7e-57
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   169   2e-50
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   166   9e-50
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   147   3e-42
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   138   8e-39
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   124   5e-33
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   118   8e-31
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   116   2e-30
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   114   2e-29
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   101   1e-24
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    97   6e-23
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    97   1e-22
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    95   3e-22
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    94   5e-22
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    68   1e-12
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    48   6e-06
ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON...    31   3.8  
SAKL0C02486g Chr3 complement(226824..228353) [1530 bp, 509 aa] {...    31   4.0  
NDAI0B04040 Chr2 (1025150..1027258) [2109 bp, 702 aa] {ON} Anc_2...    31   4.3  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    30   5.2  
NDAI0H01570 Chr8 complement(379794..381038) [1245 bp, 414 aa] {O...    30   8.2  

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/277 (100%), Positives = 277/277 (100%)

Query: 1   MVSSNLQELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYL 60
           MVSSNLQELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYL
Sbjct: 1   MVSSNLQELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYL 60

Query: 61  EALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGK 120
           EALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGK
Sbjct: 61  EALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGK 120

Query: 121 ELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIV 180
           ELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIV
Sbjct: 121 ELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIV 180

Query: 181 EIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMRR 240
           EIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMRR
Sbjct: 181 EIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMRR 240

Query: 241 LYQRASRRAYVVTNEGKDPNGLQVPEFRPGEILQMSI 277
           LYQRASRRAYVVTNEGKDPNGLQVPEFRPGEILQMSI
Sbjct: 241 LYQRASRRAYVVTNEGKDPNGLQVPEFRPGEILQMSI 277

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  220 bits (560), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 172/275 (62%), Gaps = 8/275 (2%)

Query: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLV--AQDISEFEKHNDH----KYL 60
           Q+L+  L +++ +LPLH +T  +L    +    K++++  A+ +S  E         K L
Sbjct: 3   QQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIKAL 62

Query: 61  EALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGK 120
           E++I  THF+W +PLP  LK FQ ++ ++  HWPYE  RS+L+M  PR  S  Y W D  
Sbjct: 63  ESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSS 122

Query: 121 ELALSNLRFEKHRWADENII-ERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPI 179
           +  LS   + K+ W ++NI+ ++L+  Q   L HS+F  Y FLK++ RLC N R +P+PI
Sbjct: 123 KTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNGRNLPIPI 182

Query: 180 VEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMR 239
           VEIP+RP+GND+A  RI+NLFK K A  + +LA EN  LS  +E +L EII+ + +R  R
Sbjct: 183 VEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDASSRKQR 242

Query: 240 RLYQRASRRAYVVT-NEGKDPNGLQVPEFRPGEIL 273
           RLYQ + +RAYV+  ++G+  N L +P FRP  +L
Sbjct: 243 RLYQASCKRAYVMEYDDGEHGNELSLPHFRPSSLL 277

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  184 bits (468), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 147/243 (60%), Gaps = 9/243 (3%)

Query: 17  IRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQKTHFLWDNPLP 76
           + +LPL + T K++E   R    +SL   +   ++E   D+K LE +I  T+F W+N +P
Sbjct: 8   LEKLPLDVRTLKLIE--KRLERAESLRFLELARQYEAKKDYKTLENIIHHTYFSWENEIP 65

Query: 77  PFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHRWAD 136
             +K F+ ++ EL + WPYE  R++L M +P+ +S  +LW  G    L+ +R+  + W  
Sbjct: 66  QHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGSYGWNR 125

Query: 137 ENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRI 196
           E   ERL+  + T   H IF  + FL+   +LC N + + VPIVEIP++P+G ++AD RI
Sbjct: 126 EGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRI 185

Query: 197 RNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEII-------TKSETRSMRRLYQRASRRA 249
           +NLFKRK A VW +LA +N  LS  NE LL +II        ++ +R ++RLYQRA R A
Sbjct: 186 KNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGA 245

Query: 250 YVV 252
           YV+
Sbjct: 246 YVI 248

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  169 bits (428), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 146/273 (53%), Gaps = 37/273 (13%)

Query: 20  LPLHIETQKVLEFYCRNSSYKSL-LVAQDISEFEKHNDHKYLEALIQKTHFLWDNPLPPF 78
           LPL   T  +LE   +  S   L  + Q + +++ + + K LE ++  T+F W+N  P  
Sbjct: 14  LPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLH 73

Query: 79  LKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHRWADEN 138
           +++F+  + +L  HWPYE  R LLSMS P + S  ++W D  +  LS++RFE++ W   +
Sbjct: 74  IQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRND 133

Query: 139 IIERL------------------------------SPEQGTQLLHSIFHQYFFLKSHARL 168
            +E+L                              S  + T L H IF  Y FLK + +L
Sbjct: 134 PLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNPKL 193

Query: 169 CYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGE 228
           C   +K+P+PIVEIP++P+G D+   RIRNLFKRK A  W LLA EN  LS  NE LL +
Sbjct: 194 CKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEALLLD 253

Query: 229 II------TKSETRSMRRLYQRASRRAYVVTNE 255
           II      T    R ++RLYQRA + +YV+  +
Sbjct: 254 IIASPHHSTSVSNRKIKRLYQRACKHSYVICED 286

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  166 bits (421), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 147/260 (56%), Gaps = 13/260 (5%)

Query: 15  RSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISE-FEKHNDHKYLEALIQKTHFLWDN 73
           R++ +LPL I T ++LE      S       Q++++ +      K LE+++  T+F W N
Sbjct: 6   RALEKLPLDIRTLELLERKLLKKSLPGF---QELAQQYTADGSSKSLESIVHLTYFHWCN 62

Query: 74  PLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHR 133
              P +K+F+ ++ EL +HWPYE+ RS+LSM  P+ +S  +LW       LS + +EK+ 
Sbjct: 63  EDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKTQSIRFLWSSNSPKVLSKMSYEKYA 122

Query: 134 WADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVAD 193
              E    RL+  Q T   H +F  + FLKS   LC   + + VPIVEIP++P+G ++ +
Sbjct: 123 HDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPE 182

Query: 194 CRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITK-------SETRSMRRLYQRAS 246
            R+RNLFKRK A VW +LA ++  LS +NE  L +II         S  R ++RLYQRA 
Sbjct: 183 VRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRAC 242

Query: 247 RRAYVVTNEGKDPNGLQVPE 266
           R AY +  E     GL++ E
Sbjct: 243 RGAYTI--EQHPVLGLEIKE 260

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  147 bits (371), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 145/252 (57%), Gaps = 8/252 (3%)

Query: 13  LSRSIRQLPLHIETQKVLEFYC--RNSSYKS--LLVAQDISEFEKHNDHKYLEALIQKTH 68
           + R + +LPLH  T +V+  Y   + + Y +  + + + +++F +   H+ L+ L+   H
Sbjct: 5   IQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLVFHVH 64

Query: 69  FLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLR 128
           F      P  L+  + + +EL   WPYE   SLL++S+ R +S   LW DG+E  L  ++
Sbjct: 65  FQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQ 124

Query: 129 FEKHRWADE-NIIER--LSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLR 185
           + +H W  E ++ ER  L+  Q  ++LH +F QY FLK    L ++ R++P+P+VEI + 
Sbjct: 125 YCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPAL-WSVRRLPIPVVEIGMT 183

Query: 186 PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSETRSMRRLYQRA 245
           P+G D+ D R+  LFK KT  V  LL  E+  L+   E+ +  II +  TR+MRR+Y RA
Sbjct: 184 PLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAECPTRAMRRIYLRA 243

Query: 246 SRRAYVVTNEGK 257
            RRAYV+  + +
Sbjct: 244 CRRAYVLDADAQ 255

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  138 bits (348), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 153/279 (54%), Gaps = 17/279 (6%)

Query: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSS------YKSLLVAQDISEFEK--HNDHK 58
           + L P L  S+ +LPLH  T  +LE     +       Y  +L   +IS+      N+ +
Sbjct: 9   KRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESR 68

Query: 59  YLEALIQKTHFLWDNP-LPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWR 117
            LE +++KTH +W+N   P  L++F+ ++ EL +HWPYE+   +L+M+ P   S  YL  
Sbjct: 69  ALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCL 128

Query: 118 DGKELALSNLRFE-KHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIP 176
           +  +   +  + +  ++W +     +L+ EQ   + + IF Q FFLK H  +   N+ + 
Sbjct: 129 NNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNM- 187

Query: 177 VPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKS-ET 235
           VPIVE+PL+P+G D+  CRI+NLF +K   +W LL+  +  +S  +E+++  I+  + + 
Sbjct: 188 VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNILEDTKDN 247

Query: 236 RSMRRLYQRASRRAYVVTNEGKDPNGLQVPEFRPGEILQ 274
           R + RLY+R+ + +YV      D N +++  +R    LQ
Sbjct: 248 RRINRLYRRSLKNSYVF----DDTNPIEI-TYRYASFLQ 281

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  124 bits (310), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 120/236 (50%), Gaps = 28/236 (11%)

Query: 48  ISEFEKHNDHKYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNP 107
           ++ F ++   K LE L+   HF   N  P  +   + Y  EL   WPYE Q S+L M +P
Sbjct: 41  LNSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDP 100

Query: 108 RKESQGYLWRDGKELALSNLRFEKHRW--------ADENIIE-----------------R 142
              SQ  LW    + AL  L F +H+W         +E +I+                 R
Sbjct: 101 NLTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLR 160

Query: 143 LSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKR 202
           L  E+  + L  IF  Y+FLK++ +LC   +K+  PIVEI ++P G D+AD RI NLFK+
Sbjct: 161 LPAEKIKETLRQIFEHYYFLKTNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKK 219

Query: 203 KTAVVWNLLAWENRPLSTRNEQLLGEIITKSE-TRSMRRLYQRASRRAYVVTNEGK 257
           K  ++ +LL  +N  L++  E +L  I+   +  R  +RLY+  + R+Y+   +GK
Sbjct: 220 KVKLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLF-KDGK 274

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  118 bits (295), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 17  IRQLPLHIETQKVLE---FYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQKTHFLWDN 73
           + +LPLH  T+KV+           +K + V + I+ +    +  YL  +I   +F   N
Sbjct: 12  VSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVYFRILN 71

Query: 74  PLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHR 133
           P    +++F+ Y KEL   WPYE    LLS   P K+S  YLW       L  +R+++H 
Sbjct: 72  PKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMRYDRHL 131

Query: 134 W----------------------------ADENIIERLSPEQGTQLLHSIFHQYFFLKSH 165
           W                             D+N    L   +   LL  IF  Y F+KS 
Sbjct: 132 WLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNT---LGETERIALLKLIFSHYLFVKSR 188

Query: 166 ARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQL 225
             LC  ++ +P+PIVE+ + P+G D+ D RI NLF++++      L  +  PLS   E L
Sbjct: 189 PTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVESL 247

Query: 226 LGEIITKSETRSMRRLYQRASRRAYVV 252
           L  II + + RSM RLY+ +   AY +
Sbjct: 248 LHSIIKECD-RSMGRLYKWSCNGAYTM 273

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  116 bits (291), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 132/274 (48%), Gaps = 29/274 (10%)

Query: 8   ELIPALSRSIRQLPLHIETQKVLEFYC--RN----SSYKSLLVAQDISEFEKHN------ 55
           +L   L  S++ LPLH  T   LE  C  RN     S+K  L+   I+ +EK        
Sbjct: 7   KLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTL-INSYEKAQASGQSK 65

Query: 56  -DHKYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGY 114
             +K LE++I  T+F W N L   LK FQ  +  L   WP+ Y   +    + +K S   
Sbjct: 66  LSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI----DSKKNSIIL 121

Query: 115 LWRDGKELALSNLRFEKHRWADENIIERLSPEQGT--QLLHSIFHQYFFLKSHARLCYNN 172
            W        ++    +   +  N  + L P++     +   I+  Y FL  +  LC N 
Sbjct: 122 TWNKSS----NSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCSNG 177

Query: 173 RKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITK 232
           +++P PIVEIP+  MG D+   RI NL + K A  WN LA  N  L+  NE  L EII  
Sbjct: 178 KRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEIING 237

Query: 233 S---ETRSMRRLYQRASRRAYVVTNEGKDPNGLQ 263
           S   ++R +R+LY+RA   +YV+ NE  D N ++
Sbjct: 238 SSAIKSRQLRKLYRRACSNSYVIKNE--DDNNIE 269

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  114 bits (284), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 140/276 (50%), Gaps = 35/276 (12%)

Query: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKS------LLVAQDISEFEKHNDH--- 57
           + +   L RS+  +PLH +T  +LE   + ++ KS      + + Q + ++E++N     
Sbjct: 3   KSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQEDK 62

Query: 58  ----KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQG 113
               K LE++   T+F+W+NP+P  L+ FQ  ++ L  +WP  Y R +    + +++S  
Sbjct: 63  RGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSII 118

Query: 114 YLW---RDGKELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCY 170
             W    +G  L    +          N I+  +  +   +   IF  Y FL  +AR+  
Sbjct: 119 VQWAKSNNGDALLKGTM----------NHIQPGASAEELLMFKKIFQHYIFLTLNARITS 168

Query: 171 NNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEII 230
           N +++  P+V +P+  MG  +   R++NLF++K +   N L   N  L+  N   L EII
Sbjct: 169 NAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLDEII 228

Query: 231 T---KSETRSMRRLYQRASRRAYVVTNEGKDPNGLQ 263
               ++ +RS+RRLYQRAS+ A+V+   G+ P  +Q
Sbjct: 229 NADYENTSRSLRRLYQRASKNAHVIA--GESPESIQ 262

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  101 bits (252), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 113/213 (53%), Gaps = 20/213 (9%)

Query: 58  KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSL---LSMSNPRKESQG- 113
           K LE++I +THF W+NPLP     FQ ++  L  HWP+E  R L   ++++N +  S   
Sbjct: 67  KALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSS 126

Query: 114 -YLWRDGKELALSNLRFEKHRWADE---------NIIERLSPEQGTQLLHSIFHQYFFLK 163
             +W     + L N+   K+ W              ++  +PE+   L++S+ + Y FL 
Sbjct: 127 RSVWLKADWITLFNV---KNPWVQTPPSLMRLSGTDLDTFTPER-IFLINSLGNHYKFLI 182

Query: 164 SHARLCYNNRKIPVPIVEIPLRPMGNDVADCR-IRNLFKRKTAVVWNLLAWENRPLSTRN 222
           +++ L YN++K P P V+IP+R    +V+  + I  LF R+ + ++  L  EN PLS  N
Sbjct: 183 ANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSPEN 242

Query: 223 EQLLGEII-TKSETRSMRRLYQRASRRAYVVTN 254
           E  L  +   ++  R +RRLY RA  RAY  TN
Sbjct: 243 ELALTAVFYDETVERRLRRLYMRACARAYTTTN 275

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 97.1 bits (240), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 107/213 (50%), Gaps = 20/213 (9%)

Query: 58  KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYL-- 115
           K LE++I +THF W+NP P     FQ ++  L  HWP+E  R L+      K     +  
Sbjct: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126

Query: 116 ---WRDGKELALSNLRFEKHRWA---------DENIIERLSPEQGTQLLHSIFHQYFFLK 163
              W       L  +   K+ W           E  ++  +PE+   L++S+ +QY FL 
Sbjct: 127 KTTWLKADWATLFQV---KNPWVQTPPTPKNLSETDLDAFTPERAF-LVNSLGNQYKFLI 182

Query: 164 SHARLCYNNRKIPVPIVEIPLRPMGNDVADCR-IRNLFKRKTAVVWNLLAWENRPLSTRN 222
           +++ L YN++K P P V+IP+R    +V+  + I  LF R+ A ++  L  EN PLS  N
Sbjct: 183 ANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPAN 242

Query: 223 EQLLGEIIT-KSETRSMRRLYQRASRRAYVVTN 254
           +  L  I   K+  R  +RLY RA  RAY +TN
Sbjct: 243 DIALMAIFNDKTMDRRFKRLYMRACARAYTITN 275

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 125/274 (45%), Gaps = 32/274 (11%)

Query: 17  IRQLPLHIETQKVLEFYCRN--SSYKSLLVAQDISE----FEK-------HNDHKYLEAL 63
           I  LPLH  T+  L     +  S +K   +A  ++E    +EK           K LE++
Sbjct: 13  IDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQDLRTSLKALESI 72

Query: 64  IQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELA 123
           + +THF W+NP P     FQ ++  L +HWP+E  RSL+     +      L   G  L 
Sbjct: 73  VYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTSKGNWLK 132

Query: 124 L--SNLRFEKHRWA-------------DENIIERLSP--EQGTQLLHSIFHQYFFLKSHA 166
              + L   K+ W               +N I  L     + T L+ S+ + Y FL +++
Sbjct: 133 ADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKSLGNHYKFLVTNS 192

Query: 167 RLCYNNRKIPVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQL 225
            L YN++K P P+V+IP+R  +G      +I  LF R+ A ++  L  EN PLST NE  
Sbjct: 193 HLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFVENPPLSTANELA 252

Query: 226 LGEIITKSE-TRSMRRLYQRASRRAYVVTNEGKD 258
           L  +       R   RLY RA  RAY + N   D
Sbjct: 253 LMTVFDDGTLERRHTRLYMRACARAYTIANADSD 286

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 95.1 bits (235), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/268 (31%), Positives = 122/268 (45%), Gaps = 30/268 (11%)

Query: 17  IRQLPLHIETQKVLE--FYCRNSSYKSLLVAQDISE----FEK-------HNDHKYLEAL 63
           I  LPLH  T+  L        S YK   +A  ++E    +EK           K LE++
Sbjct: 13  IESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQDLRTSLKALESI 72

Query: 64  IQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELA 123
           I +THF W+NP P     FQ +H  L +HWP+E  RSL+            +   G  L 
Sbjct: 73  IFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMASKGTWLK 132

Query: 124 L--SNLRFEKHRWADE------------NIIERLSPEQGTQLLHSIFHQYFFLKSHARLC 169
              + L   K+ W                 ++  +PE+ T L++S+ + Y FL +++ L 
Sbjct: 133 ADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPER-TFLVNSLGNHYKFLVANSHLS 191

Query: 170 YNNRKIPVPIVEIPLR-PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNE-QLLG 227
           YN++K P P V+IP+R  +G      +I  LF R+   ++  L  EN PLS  NE  L+ 
Sbjct: 192 YNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPPLSADNELALMA 251

Query: 228 EIITKSETRSMRRLYQRASRRAYVVTNE 255
                S  R  +RLY RA  RAY   N 
Sbjct: 252 VFHDDSLDRRHKRLYMRACARAYTTVNS 279

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 93.6 bits (231), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 127/258 (49%), Gaps = 24/258 (9%)

Query: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQK 66
           +E+   ++ +I  LPLH +T   L+   + +   ++ + +D+  +E     K+LE++I +
Sbjct: 14  KEVRDKITNAIEGLPLHQKTLLQLQDTLKRNDALAIPLLRDVVSYETTGKSKFLESIIYR 73

Query: 67  THFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSN 126
            +F W N +P  LK     ++ L ++WP E      + + P   S    W   K  A+  
Sbjct: 74  LYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKN-AEPEAISLRNAWMRNKATAVD- 131

Query: 127 LRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLK-SHARLCYNNRKIPVPIVEIPLR 185
                           LS   G  ++  I + + +L+ +  RLC   +K+ +PI+E+PL 
Sbjct: 132 ----------------LSTSDG--VIKPILNHFRYLRVNEDRLC--KKKVGLPILEVPLN 171

Query: 186 PMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKSE-TRSMRRLYQR 244
             G ++ +CR+ NL K++ A V   L  +N  LS + E  L  II  S+ TR+++R+Y R
Sbjct: 172 VFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLR 231

Query: 245 ASRRAYVVTNEGKDPNGL 262
           +  RAY   +  KD + +
Sbjct: 232 SCSRAYTGESNPKDSSNI 249

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 110/286 (38%), Gaps = 44/286 (15%)

Query: 12  ALSRSIRQLPLHIETQKVLEFYCRNSS--------YKSLLVAQDISEFEKHNDHKYLEAL 63
            L R +R LPLH  T   L  +   +          ++L    D+   +KH  +K L  L
Sbjct: 7   GLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTL 66

Query: 64  IQKTHFLWDNP------LPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWR 117
           + + +  WDN       LPP L  F+     L   WP E   SL   S     +  + W 
Sbjct: 67  LLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSL-KQSTKGHATLKHAWV 125

Query: 118 DGKELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNR---- 173
              + AL  + F+    A  N      P  G   L     Q     SH +L YNN     
Sbjct: 126 TNNKHAL-QMSFDA---AAAN------PTSGNIELRGSLRQIL---SHYQLLYNNMRMFG 172

Query: 174 --KIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPL-STRNEQLLGEII 230
             K+ VP+ EIPL   G ++  CR  NL +RK   V  +L  E   L +T     L  II
Sbjct: 173 KIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAII 232

Query: 231 TKS---------ETRSMRRLYQRASRRAYVVTNEGKDPNGLQVPEF 267
                         R +RRLY+RA    Y + +  ++     V  F
Sbjct: 233 AGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVHSF 278

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 45/229 (19%)

Query: 16  SIRQLPLHIETQKVLEF-----YCRNSSYKSLLVAQDISEFEKH--NDHKYLEALIQKTH 68
            + +LPLH  T  +L+        +NS    LL   + +   K      K L+ +I KTH
Sbjct: 24  GLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIFKTH 83

Query: 69  FLWDNPLPPF--LKRFQLYHKELTNHWPYEYQRSLLSMSN--PRKESQGYLWRD--GKEL 122
            +++N    +  LK F+L +  LT++WPYE    L + +   P  ++  YLW +     L
Sbjct: 84  LIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNSDNL 143

Query: 123 ALSNLRFEK-------HRWADEN------IIERLSPEQGT------------QLLHSIFH 157
           A    +F K       +++  E       + ER + E  T             L   +F 
Sbjct: 144 AFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIEINLFGELFK 203

Query: 158 QYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAV 206
           Q  ++ +         K+ +PIV +PL  +G  +   R+ N FK+K  V
Sbjct: 204 QLHYINTI-------NKLQIPIVILPLNALGLKIPKSRLYNKFKKKLQV 245

>ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON}
           similar to uniprot|P25298 Saccharomyces cerevisiae
           YMR061W RNA14 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends bridges interaction between Rna15p and
           Hrp1p in the CF I complex
          Length = 652

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 39/95 (41%), Gaps = 28/95 (29%)

Query: 196 IRNLFKRKTAV-------VWN-LLAWENRPLSTRNEQLLGEIITKSETRSMRRLYQRAS- 246
           IR L+KR   V       +WN    WE    S    + +GE+   SE    R LYQ  S 
Sbjct: 187 IRTLYKRMLCVPFENIEKMWNRYTEWEQDVNSLTARKFIGEL--SSEYMKARSLYQEWSH 244

Query: 247 -----RRAYVV------------TNEGKDPNGLQV 264
                RR+Y V            T EG DP+ LQ+
Sbjct: 245 ITKGLRRSYPVSVSTANKNNVPQTGEGMDPSQLQI 279

>SAKL0C02486g Chr3 complement(226824..228353) [1530 bp, 509 aa] {ON}
           conserved hypothetical protein
          Length = 509

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 34/84 (40%), Gaps = 12/84 (14%)

Query: 12  ALSRSIRQLP-----LHIETQKVLEFYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQK 66
            LS    QLP     LH    KV  F C  S Y+     +D   F      K +  ++  
Sbjct: 182 CLSCDAFQLPHDKDALHQSVAKVASFLCELSMYE-----RDYMHFSAST--KAISGMLLA 234

Query: 67  THFLWDNPLPPFLKRFQLYHKELT 90
           +H L D   P F+ +  L H+ LT
Sbjct: 235 SHMLGDTRFPDFISKRLLDHENLT 258

>NDAI0B04040 Chr2 (1025150..1027258) [2109 bp, 702 aa] {ON}
           Anc_2.198 YOR087W
          Length = 702

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 197 RNLFKRKTAVVWNLL---AWEN----RPL---------STRNEQLLGEIITKSETRSMRR 240
           RNL K ++ +++ +L    W N    R L         S  +++L   II K ETR +  
Sbjct: 117 RNLLKYRSVIIFAILRVVKWNNELALRELHDSELYEMRSLASQKLCKMIIDKEETRDLDF 176

Query: 241 LYQRASRRAYVVTNEGKDPNGLQVPEF 267
           L+ +   R YV+  + KD   +   E 
Sbjct: 177 LFMQLLLRKYVINEKDKDMEPMNAVEL 203

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 50  EFEKHNDHKYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRK 109
           EF+     +    +   +  +W NPL    ++FQ Y   + N++PY    S+ S+S  R 
Sbjct: 123 EFQDGGSTQNRNTIAGNSEKVWQNPLQATSRQFQ-YPNTMMNNYPY---SSINSISGSRL 178

Query: 110 ESQGYL 115
            S G++
Sbjct: 179 HSPGFM 184

>NDAI0H01570 Chr8 complement(379794..381038) [1245 bp, 414 aa] {ON}
           Anc_7.171 YIR008C
          Length = 414

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 60  LEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKES 111
           L+  I+K H      L PF+++FQ++   + NH     +R   S+ N  +ES
Sbjct: 363 LQNEIEKDHNSEKTTLQPFIEKFQIFVNSVINHEVENVKRGHDSLENENRES 414

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,169,987
Number of extensions: 1302201
Number of successful extensions: 3167
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3205
Number of HSP's successfully gapped: 39
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)