Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01540g8.267ON97974869e-65
Kwal_56.237768.267ON1301052832e-33
Ecym_43038.267ON1091082596e-30
TDEL0F039408.267ON1101102588e-30
KLTH0G13574g8.267ON112632432e-27
AGR081C8.267ON1301162381e-26
SAKL0H16918g8.267ON1111112362e-26
Suva_2.2748.267ON105712343e-26
TPHA0A017708.267ON104622334e-26
KLLA0F19250g8.267ON1161132344e-26
YDR115W8.267ON105712301e-25
Skud_4.3758.267ON105692301e-25
Smik_4.3598.267ON105712273e-25
Kpol_543.428.267ON112502162e-23
KAFR0B054908.267ON85522081e-22
NCAS0B038208.267ON115932074e-22
NDAI0J013408.267ON141542095e-22
CAGL0B01793g8.267ON98501961e-20
TBLA0E044708.267ON94521916e-20
KNAG0H032208.267ON86721891e-19
Kwal_55.19547singletonON31652613.8
Skud_6.60na 1ON14759604.1
TDEL0E027205.355ON92540596.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01540g
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...   191   9e-65
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   113   2e-33
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   104   6e-30
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   103   8e-30
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    98   2e-27
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    96   1e-26
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    96   2e-26
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    95   3e-26
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    94   4e-26
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    95   4e-26
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    93   1e-25
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    93   1e-25
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    92   3e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    88   2e-23
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    85   1e-22
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    84   4e-22
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    85   5e-22
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    80   1e-20
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    78   6e-20
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    77   1e-19
Kwal_55.19547 s55 (20991..21941) [951 bp, 316 aa] {ON} [contig 1...    28   3.8  
Skud_6.60 Chr6 (112882..113322) [441 bp, 147 aa] {ON} YFL012W (R...    28   4.1  
TDEL0E02720 Chr5 complement(525987..528764) [2778 bp, 925 aa] {O...    27   6.9  

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
          similar to uniprot|Q04598 Saccharomyces cerevisiae
          YDR115W
          Length = 97

 Score =  191 bits (486), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQP 60
          MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQP
Sbjct: 1  MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQP 60

Query: 61 STLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
          STLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH
Sbjct: 61 STLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  113 bits (283), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 15/105 (14%)

Query: 8   IFQVGARRSLFTMGNWTPTTV----SPLQRLLG-----------PSPLSSGFGMGQRRWK 52
           +FQ  ARRSL TM +++P  V    SP+ ++             PS LSS FG+ Q+RWK
Sbjct: 26  LFQFSARRSLTTMSSFSPLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLFGLTQKRWK 85

Query: 53  SRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           SRGNT+QPSTLKRKRRVGFLAR +SKQGSKIL+RR+ KGRW+LTH
Sbjct: 86  SRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  104 bits (259), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 75/108 (69%), Gaps = 18/108 (16%)

Query: 5   ARNIFQVGARRSLFTM-GNWTP--------------TTVSPLQRLLGPSPLSSGFGMGQR 49
           +R++ Q   RRSL T+  +++P              T+VS  QR   PS +S  FG+ QR
Sbjct: 5   SRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQR---PSVISLVFGLNQR 61

Query: 50  RWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           RWKSRGNTFQPSTLKRKRRVGFLARARSK G KIL+RRK KGRW+LT+
Sbjct: 62  RWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  103 bits (258), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 77/110 (70%), Gaps = 13/110 (11%)

Query: 1   MWSFARNIFQVGARRSLFTMGNWTPT----TVSPLQRLLGP----SPLSS-----GFGMG 47
           M   AR   Q+ ARR+L ++ +++P       +  Q LLG     SPLSS      FG+ 
Sbjct: 1   MSFLARKPLQLNARRTLTSLSSFSPLRSLFAQNKSQGLLGVPETHSPLSSISLLFPFGIM 60

Query: 48  QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           QRRWKSRGNTFQPSTLKRKRR+GFLARARSK GS++LQRRK KGRW+LT+
Sbjct: 61  QRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 98.2 bits (243), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 49/63 (77%), Positives = 55/63 (87%), Gaps = 1/63 (1%)

Query: 36  GPSPLSSG-FGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWF 94
           G SPL S  FG  QRRWKSRGNT+QPSTLKRKRRVGFLARA+SKQG K+L+RR+ KGRW+
Sbjct: 50  GSSPLFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWY 109

Query: 95  LTH 97
           LTH
Sbjct: 110 LTH 112

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 96.3 bits (238), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 73/116 (62%), Gaps = 26/116 (22%)

Query: 1   MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLL-------------------GPSPLS 41
           M+S  R++ Q  +RR++ T+       VSP++++                     PS LS
Sbjct: 22  MFSMYRSMLQWSSRRTIMTV-------VSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLS 74

Query: 42  SGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
              G+ Q+RWKSRGNT+QPSTLKRKRRVGFLARARS+ G  IL+RR+ KGRW+LTH
Sbjct: 75  MLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 70/111 (63%), Gaps = 14/111 (12%)

Query: 1   MWSFARNIFQVGARRSLFTMGNWTPTTVSPLQRLLGPSP--------------LSSGFGM 46
           M   ++++F   ARR+  T  +++P      Q L+  +               ++   G+
Sbjct: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQALVNHNNPLLSQSQSQQPSSIMNILLGL 60

Query: 47  GQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
            QRRWKSRGNT+QPSTLKRKRRVGFLARA++KQ SKIL+ RK KGRW+LTH
Sbjct: 61  TQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 94.7 bits (234), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (81%), Gaps = 7/71 (9%)

Query: 34  LLGPSPLSS------GFG-MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86
           LL  SPL +      GFG +GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 35  LLNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94

Query: 87  RKHKGRWFLTH 97
           RK KGRWFL+H
Sbjct: 95  RKLKGRWFLSH 105

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 94.4 bits (233), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 47/62 (75%), Positives = 53/62 (85%), Gaps = 1/62 (1%)

Query: 37  PSPLSSGFGMG-QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFL 95
            S L     +G QRRWKSRGNT+QPSTLKRKRR+GFLARARSKQG+KIL+RRK KGRW+L
Sbjct: 43  ASILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYL 102

Query: 96  TH 97
           TH
Sbjct: 103 TH 104

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 94.7 bits (234), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 19/113 (16%)

Query: 4   FARNIFQVGARRSLFTMGNWTP------------TTVSPLQRLLGPSPLSSG-------F 44
             RN+ Q  ++R+L +  +++P              V+P++  L     ++G       F
Sbjct: 4   ITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLF 63

Query: 45  GMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
            + QRRWKSRGNTFQPSTLKRKRRVGFLARARS+ G +IL+RRK+KGRW+LT+
Sbjct: 64  DLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 93.2 bits (230), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (81%), Gaps = 7/71 (9%)

Query: 34  LLGPSPLSS------GFGM-GQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86
           LL  SPL +      GFG+ GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 35  LLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94

Query: 87  RKHKGRWFLTH 97
           RK KGRWFL+H
Sbjct: 95  RKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 93.2 bits (230), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (82%), Gaps = 1/69 (1%)

Query: 29  SPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRK 88
           SP  + +  + L  GF +GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+RRK
Sbjct: 38  SPPMKTMSLTALGFGF-IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRK 96

Query: 89  HKGRWFLTH 97
            KGRWFL+H
Sbjct: 97  LKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 92.0 bits (227), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 7/71 (9%)

Query: 34  LLGPSPLSS------GFG-MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86
           ++  SPL +      GFG + QRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 35  IMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94

Query: 87  RKHKGRWFLTH 97
           RK KGRWFL+H
Sbjct: 95  RKLKGRWFLSH 105

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 87.8 bits (216), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%)

Query: 48  QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           QRRWKSRGNT+QPSTLKRKR+ GFLARARS+ GSKIL+RRK KGRW+L+H
Sbjct: 63  QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa]
          {ON} Anc_8.267 YDR115W
          Length = 85

 Score = 84.7 bits (208), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%)

Query: 46 MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           GQ+RWKSRGNT+QPSTLKRKR+ GFL+RA+SKQ SKIL+ RK KGRW+L+H
Sbjct: 34 FGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 84.3 bits (207), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 61/93 (65%), Gaps = 4/93 (4%)

Query: 9   FQVGARRSLFTMGNWTPTTVSPL-QRLLGPSPLSSG---FGMGQRRWKSRGNTFQPSTLK 64
           F +G   SL  +        SP+   +L  SP+      FG+ QRRWKSRGNT+QPSTLK
Sbjct: 23  FSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLK 82

Query: 65  RKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           RKR+ GFLA+AR  Q  KIL+RR+ KGRW+LTH
Sbjct: 83  RKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 85.1 bits (209), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 47/54 (87%)

Query: 44  FGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
           F + Q+RWKSRGNT+QPSTLKRKR+ GFL+R R +Q SKIL+RRK KGRWFL+H
Sbjct: 88  FMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
          similarities with uniprot|Q04598 Saccharomyces
          cerevisiae YDR115w
          Length = 98

 Score = 80.1 bits (196), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%)

Query: 48 QRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
          QRRWKSRGNT+QPSTLKRKR+ GFLAR  +K+ +KI++RRK KGRW+LTH
Sbjct: 49 QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON}
          Anc_8.267 YDR115W
          Length = 94

 Score = 78.2 bits (191), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (86%)

Query: 46 MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97
          +  RRWKSRGNT+QPSTLKRKR+ GFL+RA+S   +KIL+RRK KGRWFL+H
Sbjct: 43 IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
          Anc_8.267 YDR115W
          Length = 86

 Score = 77.4 bits (189), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 7/72 (9%)

Query: 33 RLLGPSPL-------SSGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQ 85
          R +G S L       ++G     RRWKSRGNT+QPSTLKRKR+ GFLAR R+   SK+L+
Sbjct: 15 RAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLK 74

Query: 86 RRKHKGRWFLTH 97
          RRK KGRW+L+H
Sbjct: 75 RRKEKGRWYLSH 86

>Kwal_55.19547 s55 (20991..21941) [951 bp, 316 aa] {ON} [contig 159]
           FULL
          Length = 316

 Score = 28.1 bits (61), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 27  TVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQPSTLKRKR-RVGFLARARS 77
           T+S +  L+  +PL+S   +     KS  NT +P+T  R + R+G +  AR+
Sbjct: 217 TISQVLILITETPLNSAISLLVASKKSVSNTREPTTTVRSQLRLGLVLMART 268

>Skud_6.60 Chr6 (112882..113322) [441 bp, 147 aa] {ON} YFL012W
           (REAL)
          Length = 147

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 37  PSPLSSGFGMGQRRWKSRGNTF-------QPSTLKRKRRVGFLARARSKQGSKILQRRK 88
           P P+++G      RWK R N         +  T KR R + +L R   K+  +IL  +K
Sbjct: 59  PEPIANGAAYKLTRWKKRINCISKDLANNEVKTRKRDRVLEWLRRNLLKEDIEILSHKK 117

>TDEL0E02720 Chr5 complement(525987..528764) [2778 bp, 925 aa] {ON}
           Anc_5.355 YHR073W
          Length = 925

 Score = 27.3 bits (59), Expect = 6.9,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 27  TVSPLQRLLGPSPLSSGFGMGQRRWKSRGNTF---QPSTL 63
           TVSPLQR  G S   +  G  + R+K    TF   QP+T+
Sbjct: 696 TVSPLQRFWGKSVELNNEGTFRLRFKKSKETFEWVQPTTM 735

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.135    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,970,523
Number of extensions: 368968
Number of successful extensions: 975
Number of sequences better than 10.0: 25
Number of HSP's gapped: 973
Number of HSP's successfully gapped: 25
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)