Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01518g8.268ON27727712821e-180
KLLA0F19272g8.268ON2662568111e-108
SAKL0H16896g8.268ON2852677931e-105
TDEL0F039508.268ON2762627721e-102
KLTH0G13552g8.268ON2812607711e-102
Kwal_56.237758.268ON2812607561e-100
TPHA0J007708.268ON2782777551e-100
Smik_4.3608.268ON2852707401e-97
Skud_4.3768.268ON2852847182e-94
YDR116C (MRPL1)8.268ON2852717113e-93
Kpol_392.38.268ON2812697026e-92
Suva_2.2758.268ON2852676941e-90
Ecym_43028.268ON2752706652e-86
AGR080W8.268ON2752656601e-85
NCAS0B038108.268ON3142816552e-84
CAGL0B01815g8.268ON2902476045e-77
KAFR0B054808.268ON2802775853e-74
NDAI0J013308.268ON3142455857e-74
KNAG0H032108.268ON2852425793e-73
TBLA0I031908.268ON2412174292e-51
ZYRO0A05280g3.174ON551112780.28
CAGL0L02409g7.137ON290112711.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01518g
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   498   e-180
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   317   e-108
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   310   e-105
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   301   e-102
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   301   e-102
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   295   e-100
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   295   e-100
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   289   1e-97
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   281   2e-94
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   278   3e-93
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   275   6e-92
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   271   1e-90
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   260   2e-86
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   258   1e-85
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   256   2e-84
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   237   5e-77
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   229   3e-74
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   229   7e-74
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   227   3e-73
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   169   2e-51
ZYRO0A05280g Chr1 (430218..431873) [1656 bp, 551 aa] {ON} simila...    35   0.28 
CAGL0L02409g Chr12 (273966..274838) [873 bp, 290 aa] {ON} some s...    32   1.4  

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  498 bits (1282), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 248/277 (89%), Positives = 248/277 (89%)

Query: 1   MIGLIPSLRSQLLGSTSRCLFHTAALLRAEEAGSKLTKEQLXXXXXXXXXXXXXXXXXPA 60
           MIGLIPSLRSQLLGSTSRCLFHTAALLRAEEAGSKLTKEQL                 PA
Sbjct: 1   MIGLIPSLRSQLLGSTSRCLFHTAALLRAEEAGSKLTKEQLRKREVRRAARRKVEAKKPA 60

Query: 61  HTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLV 120
           HTHPLYMPTPLALRYLRAVEVGYPA            ADRGNPPIAGNVSLPSPLKDVLV
Sbjct: 61  HTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLV 120

Query: 121 AVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARI 180
           AVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARI
Sbjct: 121 AVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARI 180

Query: 181 LGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAV 240
           LGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAV
Sbjct: 181 LGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAV 240

Query: 241 QTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV 277
           QTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV
Sbjct: 241 QTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV 277

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  317 bits (811), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 151/256 (58%), Positives = 184/256 (71%)

Query: 21  FHTAALLRAEEAGSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYLRAVE 80
           F   +   AEE G+KLTKEQL                 PA  HPLYMP   ALRYLRA+E
Sbjct: 10  FQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIE 69

Query: 81  VGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCH 140
           VG PA            A+RG PP+ GNVS   PLKDV VAVF+NDE Q ++ +DK+  H
Sbjct: 70  VGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVH 129

Query: 141 LVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLE 200
           LVGGSD++++IK GE+ +DFDKAFATPDI  +L SQV RILGP+ +LP AK+GTVA DLE
Sbjct: 130 LVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLE 189

Query: 201 PLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILG 260
           PLIKDS  S+PFRQ+GNSISL VAK  F+D++VLENLLA Q AFK++++NQ+ K+PSIL 
Sbjct: 190 PLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILS 249

Query: 261 RTTLTTTHGPGIVIDL 276
           +TTLT+THGPGIVID 
Sbjct: 250 QTTLTSTHGPGIVIDF 265

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  310 bits (793), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 152/267 (56%), Positives = 190/267 (71%), Gaps = 3/267 (1%)

Query: 13  LGSTSRCLFHTAALLRAEE---AGSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPT 69
           +  T   LFHT   L++EE     +KL+K+QL                 PA  HPLYMP 
Sbjct: 18  ISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV 77

Query: 70  PLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ 129
             ALR+LRA EVG P             ++RG P + GN+S P PLKDV +AVF+NDE +
Sbjct: 78  TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK 137

Query: 130 LSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPM 189
           L +ARD+F CHLVGGS++I KIK+GE+P+DFDKAFATPDIA  LTSQ+ RILGP+ +LP 
Sbjct: 138 LKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPN 197

Query: 190 AKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVS 249
           AK+GTV  D+  LIKDS G++PFRQ+GN IS+AVAKC F+D QVLEN+LA Q +FK A++
Sbjct: 198 AKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALA 257

Query: 250 NQKAKRPSILGRTTLTTTHGPGIVIDL 276
           NQKAK+PSILG+TTLTTTHGPG+VID 
Sbjct: 258 NQKAKKPSILGQTTLTTTHGPGLVIDF 284

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  301 bits (772), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 185/262 (70%), Gaps = 3/262 (1%)

Query: 18  RCLFHTAALLRAEEAG---SKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALR 74
           R   HT  +LRAEEA    SKL+K+QL                     HPLYM  P+ALR
Sbjct: 14  RSFLHTGNVLRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALR 73

Query: 75  YLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMAR 134
           +LRA EVG P             A+RG P +AG+VS P PLK+V +AVFS DE QL +AR
Sbjct: 74  FLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAR 133

Query: 135 DKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGT 194
           +KF CHLVGG++II KIK GEIPVDFDKAFATPDIA  LTSQ+ARILGP+ VLP  K+GT
Sbjct: 134 EKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGT 193

Query: 195 VASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAK 254
           VA+D+  L++DS GS+PFRQ+GN+IS+AV K  FSDRQ+LEN +A   A KEA++NQ +K
Sbjct: 194 VATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSK 253

Query: 255 RPSILGRTTLTTTHGPGIVIDL 276
           + S+LG+TTL++THGPGIVID 
Sbjct: 254 KTSLLGKTTLSSTHGPGIVIDF 275

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  301 bits (771), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/260 (54%), Positives = 190/260 (73%), Gaps = 4/260 (1%)

Query: 21  FHTAALLRAEE----AGSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYL 76
            H +A LRAEE    A SKL+K+QL                 PA  HPLYMP   ALR+L
Sbjct: 21  LHVSASLRAEEPVGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFL 80

Query: 77  RAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDK 136
           RA EVG P             ++RG P ++GNVS P+ LK++ +AVF+NDEQQ  +AR+K
Sbjct: 81  RAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREK 140

Query: 137 FRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVA 196
           F CH+VGGS+++ KIKQG++P+DFDK+FATP+IA  L SQ+ RILGP+ +LP AK+GTV+
Sbjct: 141 FNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVS 200

Query: 197 SDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRP 256
            +LE LIKDS G++PFRQ+GN+IS+AV +C F+D+Q+LEN++A Q + KEA++NQKAK+P
Sbjct: 201 ENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKP 260

Query: 257 SILGRTTLTTTHGPGIVIDL 276
           S+LG+TTLT+T GPGIVID 
Sbjct: 261 SLLGQTTLTSTRGPGIVIDF 280

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/260 (53%), Positives = 183/260 (70%), Gaps = 4/260 (1%)

Query: 21  FHTAALLRAEEAGS----KLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYL 76
            H  + LRAEE  S    KL+K+QL                 PA  HPLYMP   ALR+L
Sbjct: 21  LHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFL 80

Query: 77  RAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDK 136
           RA E G P             ++RG PP++GN+S P PLKD+ +AVF+NDEQQ  +AR+K
Sbjct: 81  RAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREK 140

Query: 137 FRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVA 196
           F CHLVGGSD++ KIK+G + +DFDK+FATP+I   L SQ+ RILGP+ +LP AK+GTVA
Sbjct: 141 FGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVA 200

Query: 197 SDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRP 256
            +LEPL+K+S G++PFRQ+GN +S+AV KC F+D+Q+LEN+LA Q   KEA++ QK K+P
Sbjct: 201 ENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKP 260

Query: 257 SILGRTTLTTTHGPGIVIDL 276
           S+LG+TTLT+THGPGIVID 
Sbjct: 261 SLLGQTTLTSTHGPGIVIDF 280

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/277 (51%), Positives = 192/277 (69%), Gaps = 9/277 (3%)

Query: 8   LRSQLLGSTSRCLFHTAALLRAEEAG--------SKLTKEQLXXXXXXXXXXXXXXXXXP 59
           L++  L  T +  FH + ++R E  G        SKL+K+QL                 P
Sbjct: 2   LKANFLQVTRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMP 61

Query: 60  AHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVL 119
           A +HPLYM  P ALR+LRA EVG P             +++G+P +AG+++  +PLK+V 
Sbjct: 62  ATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVK 121

Query: 120 VAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVAR 179
           +A+F+NDE Q+ +A++KF C++VGGS++I+KIK GEI VDFDKAFATPDI QEL S VAR
Sbjct: 122 IAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VAR 180

Query: 180 ILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLA 239
           ILGP+ V P  K+GTV+ ++E LIK + GSIPFRQ GN IS+A+ KC FSDRQ+LENL++
Sbjct: 181 ILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLIS 240

Query: 240 VQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
           V+ AFK++VS QK K+PSILG+T L+TTHGPGIVID 
Sbjct: 241 VRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDF 277

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  289 bits (740), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 140/270 (51%), Positives = 183/270 (67%), Gaps = 8/270 (2%)

Query: 15  STSRCLFHTAALLRAEE--------AGSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLY 66
           ST RCL HTA  L AEE            LTK+Q                  PA T+PLY
Sbjct: 15  STRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLY 74

Query: 67  MPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSND 126
           MP  +ALRYLRA EVG P              +RG  P++G+V+ P PL+ + VA F+ND
Sbjct: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTND 134

Query: 127 EQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQV 186
           E +L   R K+  HL+GG+D++A+IK GEIPVDFDKAFATPDI   L SQVARILGP+ V
Sbjct: 135 ENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGV 194

Query: 187 LPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKE 246
           LP  K+GTV+ D+  L+++S GS+PFRQ+GNSISL V KC FSDR++L+N+++ ++AFK 
Sbjct: 195 LPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKA 254

Query: 247 AVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
           AV+NQK+K+P++L +TTL++THGPGIVID 
Sbjct: 255 AVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  281 bits (718), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 193/284 (67%), Gaps = 8/284 (2%)

Query: 1   MIGLIPSLRSQLLGSTSRCLFHTAALLRAEEAGS--------KLTKEQLXXXXXXXXXXX 52
           M+ +I + +  ++ ST RCL HTA+ L AEE  S         LTKEQ            
Sbjct: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60

Query: 53  XXXXXXPAHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLP 112
                 PA T+PLYMP  +ALRYLRA EVG P              +RG  P++G+V+ P
Sbjct: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120

Query: 113 SPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQE 172
            PL+ + VAVF+NDE +L   R+K+  HL+GG+D++++IK GEIPVDFDKA+AT DI   
Sbjct: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180

Query: 173 LTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQ 232
           L SQVARILGP+ VLP  K+GTV+ D+  L+++S GS+PFRQ+GNSISL + KC F+DR+
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240

Query: 233 VLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
           VL+N++A + AFK AVS+QK+K+P+IL +TTL++THGPGIVID 
Sbjct: 241 VLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  278 bits (711), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 177/271 (65%), Gaps = 8/271 (2%)

Query: 14  GSTSRCLFHTAALLRAEEA--------GSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPL 65
           G   RC FHTA  L A++            LTK+Q                  PA   PL
Sbjct: 14  GPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPL 73

Query: 66  YMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSN 125
           YMP   ALRYLRA EVG P              +RG  P++G+V+ P PL+ + +A F+N
Sbjct: 74  YMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTN 133

Query: 126 DEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQ 185
           DE +L   R+K+  HL+GG+D++AKIK GEI VDFDKAFATPDI   L SQVARILGP+ 
Sbjct: 134 DESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRG 193

Query: 186 VLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFK 245
           VLP  K+GTV+ D+  L+++S GS+PFRQ+GNSIS+ V KC F+DR++L+N+++ + AFK
Sbjct: 194 VLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFK 253

Query: 246 EAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
            AV NQK+K+P+IL +TTL++THGPGIVID 
Sbjct: 254 TAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  275 bits (702), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 181/269 (67%), Gaps = 10/269 (3%)

Query: 18  RCLFHTAALLRAEEAG----------SKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYM 67
           RC +H+  +L AE             SK  K++L                 PA ++PLYM
Sbjct: 12  RCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPLYM 71

Query: 68  PTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDE 127
           P   ALRYLRA EVG P             ++RGN  + GN+S  +P+KDV +AVFSND 
Sbjct: 72  PISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDP 131

Query: 128 QQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVL 187
           ++L+  +++  CHL+GG+D++ KIK G+ PVDFDKAFATPDI+  LTSQ+AR+LGP+ VL
Sbjct: 132 EKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRGVL 191

Query: 188 PMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEA 247
           P  K+GTV+ D+  LIK S G +PFRQ GNSIS++V +C FSD+Q+LEN++AV++A+   
Sbjct: 192 PTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTT 251

Query: 248 VSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
           +S+QK+K+PS+LG+TT+T+THGPGI ID 
Sbjct: 252 LSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  271 bits (694), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 136/267 (50%), Positives = 177/267 (66%), Gaps = 8/267 (2%)

Query: 18  RCLFHTAALLRAEEAGS--------KLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPT 69
           R L HTA  L AEE  +         LTK+Q                  PA T PL+MP 
Sbjct: 18  RYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPV 77

Query: 70  PLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ 129
            +ALRYLRA EVG P              +RG  PI+GNV+   PL+ V VAVF+NDE +
Sbjct: 78  TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVK 137

Query: 130 LSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPM 189
           L   R+K+   +VGG+D++AKIK  E PVDFDKAFATPDI   L SQVARILGP+ VLP 
Sbjct: 138 LKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPS 197

Query: 190 AKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVS 249
            K+GTV+ D+  L+++S GS+PFRQ+GN+ISL + KC F+DR++L+N+++ +TAF+ AV 
Sbjct: 198 VKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVD 257

Query: 250 NQKAKRPSILGRTTLTTTHGPGIVIDL 276
           NQKAK+PS+L +TTL++THGPGIVID 
Sbjct: 258 NQKAKKPSLLSKTTLSSTHGPGIVIDF 284

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  260 bits (665), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 185/270 (68%), Gaps = 5/270 (1%)

Query: 7   SLRSQLLGSTSRCLFHTAALLRAEEAGSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLY 66
           ++R  L  ++ RC     A   +  + +KL+KEQ+                     HPLY
Sbjct: 10  TVRRGLNFTSVRC-----AANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLY 64

Query: 67  MPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSND 126
           MP   A R+LRA EVG P             +D+G P ++GN+  P+PL+DV VAVF+N+
Sbjct: 65  MPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNN 124

Query: 127 EQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQV 186
           ++Q  +AR++F+CHLVGG+++I  IK G+ P+DFDKA ATPD+  +LTSQ+A +LGP+++
Sbjct: 125 KEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRL 184

Query: 187 LPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKE 246
           LP  K+GTV+ ++  LI+++  ++PFRQ+G  +S+AV KC+FSD+Q+L+N++AVQ AFK+
Sbjct: 185 LPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQ 244

Query: 247 AVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
           A+++Q+ K+ SILG+TT+T+THGPGIVID 
Sbjct: 245 ALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  258 bits (660), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 173/265 (65%), Gaps = 2/265 (0%)

Query: 15  STSRCLFHTAALLRAEEAG--SKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLA 72
           S  R L  TA  L  E A   SKL+K+QL                 PA   PLYMP   A
Sbjct: 10  SFRRGLHLTAVQLSQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQA 69

Query: 73  LRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSM 132
           LR+LRA EVG PA             D+G   ++G V+LPSP+++  VAVF+ND +Q   
Sbjct: 70  LRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAET 129

Query: 133 ARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKR 192
           AR K+ C+LVGG++++ ++K GE+ VDFDKAFATPDIA  + +++ R+LGPK +LP  K+
Sbjct: 130 ARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKK 189

Query: 193 GTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQK 252
           GTVA DL  L+ D   S PF+Q+ N ISLA+ KC FSDRQ++ENLLAVQ AF+ A+++QK
Sbjct: 190 GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQK 249

Query: 253 AKRPSILGRTTLTTTHGPGIVIDLV 277
            K+ S+ G TTLT+THGPGIVID +
Sbjct: 250 TKKTSLFGTTTLTSTHGPGIVIDFL 274

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  256 bits (655), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 178/281 (63%), Gaps = 11/281 (3%)

Query: 8   LRSQLLGSTSRCLFHTAALLRAEEAGSK-----------LTKEQLXXXXXXXXXXXXXXX 56
           L +Q   S+     H+ + + AEEA S            L+KEQL               
Sbjct: 34  LLAQCTSSSQSRGIHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEA 93

Query: 57  XXPAHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLK 116
             PA  HPLYMP   ALRY+RA EVG P+             ++G  P+ G++SLP PLK
Sbjct: 94  KRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLK 153

Query: 117 DVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQ 176
            + VAVFS +E+ L+  ++K+ CHLVGG ++I KIK GE+  DFDKAFA+ D+A  L++Q
Sbjct: 154 ALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQ 213

Query: 177 VARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLEN 236
           + + LG + +LP AK+GTV+ DLE L+ D  GS+PFRQ GN IS+ + KC FSD ++L N
Sbjct: 214 LGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRN 273

Query: 237 LLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV 277
           ++A ++A  +A+S QK+K+PSILG+TTL++THGPGIVID +
Sbjct: 274 IIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI 314

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  237 bits (604), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 164/247 (66%), Gaps = 6/247 (2%)

Query: 36  LTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXX 95
           LTKEQ                  PA+ HPLYMP PLALRYLR+ EVG P           
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 96  XXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKF--RCHLVGGSDIIAKIKQ 153
             AD+GN  +AGN+  P PLK + +A+FS+++++L   + K+  +  + GG D+IA IK 
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 154 GEIPVD-FDKAFATPDIAQELTSQVARILGPKQVLPMAKR---GTVASDLEPLIKDSFGS 209
           G+I VD  +K FATP+I   + SQ+ R+LGPK ++P  K+    TV  DL+ LI+++ G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 210 IPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHG 269
           + FRQ+GNS+S++V +C FSDR +LEN++AV+ AFK++VS+Q AK+PSILG+TT++TT G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 270 PGIVIDL 276
           PGIVID 
Sbjct: 283 PGIVIDF 289

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  229 bits (585), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 118/277 (42%), Positives = 165/277 (59%), Gaps = 10/277 (3%)

Query: 6   PSLRSQLLGS----TSRCLFHTAALLRAEEAGSKLTKEQLXXXXXXXXXXXXXXXXXPAH 61
           P+L + L G+    TSR     A++     A SK  K+Q                  PA 
Sbjct: 9   PTLPNLLFGTRSLQTSRLWLEEASV-----APSKTNKQQAKKKMLRDFLRSRKQAREPAS 63

Query: 62  THPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVLVA 121
            HPLYM  P ALR+LRAVEVG P             +++G PP+ GNV LP+PL++  V 
Sbjct: 64  NHPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVV 123

Query: 122 VFSNDEQQLSMARDKFR-CHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARI 180
           V S+D ++L   +D F+  HLVGG +++ K K  +I +DFDK  ATPDI       + ++
Sbjct: 124 VLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKM 183

Query: 181 LGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAV 240
            GPK +LP  K+GTV+ +L  L+ ++  S+PFRQ+   ISL + K EFSD+Q+LEN++A 
Sbjct: 184 FGPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIAT 243

Query: 241 QTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV 277
           + AF   +SNQK K+ S LG+TTLT+THGPGIVID +
Sbjct: 244 REAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI 280

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  229 bits (585), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 157/245 (64%)

Query: 33  GSKLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXX 92
            +KL+KEQL                 PA++HPLYM    ALR++RA EVG P        
Sbjct: 70  ATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITL 129

Query: 93  XXXXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIK 152
                +++G   + GN+ L  PLK++ +AVFS D++ L   + +F C LVGG++ +  IK
Sbjct: 130 TTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIK 189

Query: 153 QGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPF 212
            G I  +FD AFATP+I   + SQ+ + LG + +LP  K+GTV+ DL  L+    G+IPF
Sbjct: 190 DGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPF 249

Query: 213 RQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGI 272
           +Q GN+IS+ + KC FSD+ +L N++A + AFKEA++NQKAKRPSIL +TTL++THGPGI
Sbjct: 250 KQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGI 309

Query: 273 VIDLV 277
           VID V
Sbjct: 310 VIDFV 314

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  227 bits (579), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 158/242 (65%)

Query: 35  KLTKEQLXXXXXXXXXXXXXXXXXPAHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXX 94
           KLTKEQL                 PA    +Y+  P A+R LRAVEVG P          
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 95  XXXADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQG 154
              +++G PP+ G+V LP+PLK V +A FS D + L   +++    +VGG+++I ++K G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 155 EIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQ 214
           E+PV FDKAFATPDIA +L S++  +LG + +LP  K+GTV  DL  +I+   G++PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 215 KGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVI 274
           +  +++  +AKC FSDRQVL NL+A + AF+ A+ NQK+K+ SILGR+TL++THGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 275 DL 276
           DL
Sbjct: 283 DL 284

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  169 bits (429), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 132/217 (60%), Gaps = 2/217 (0%)

Query: 60  AHTHPLYMPTPLALRYLRAVEVGYPAXXXXXXXXXXXXADRGNPPIAGNVSLPSPLKDVL 119
           +  HPL M  PLALRYLRA+E G  +            A RGN P+ G ++    ++  +
Sbjct: 26  SKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPV 85

Query: 120 VAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVAR 179
           +AVF+ D +Q  +A++     ++GGS++I KI  GE  + F  AFAT D+ Q+L ++VA+
Sbjct: 86  IAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQ 143

Query: 180 ILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLA 239
            LG ++VLP  K+ TV  ++  L++D    +PF +K + IS  V KC F+D ++L NL+ 
Sbjct: 144 KLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIK 203

Query: 240 VQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276
            +   ++A+  Q  K+PS + + TLT+THGPGI IDL
Sbjct: 204 AREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>ZYRO0A05280g Chr1 (430218..431873) [1656 bp, 551 aa] {ON} similar
           to uniprot|Q6B2F0 Saccharomyces cerevisiae YOL055C THI20
           Hydroxymethylpyrimidine phosphate kinase involved in the
           last steps in thiamine biosynthesis member of a gene
           family with THI21 and THI22 functionally redundant with
           Thi21p
          Length = 551

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 12/112 (10%)

Query: 151 IKQGEIPVDFD-KAFATPDIAQELTSQVARILGPKQVLPMAKRGT-------VASDLE-- 200
           +K G IP   D K F T  +      +     GP+ +L  A  GT       +AS+L   
Sbjct: 197 VKGGHIPWGQDGKNFVTDVLYLSQEDKFVVYNGPR-ILTTATHGTGCTLASAIASNLARG 255

Query: 201 -PLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQ 251
            P+ +  +G I + Q G SIS  VA     D   + ++ AV+   +  V ++
Sbjct: 256 YPIAQAVYGGIEYVQSGVSISCQVASSHIKDNGPINHVYAVEVPLEGMVQDE 307

>CAGL0L02409g Chr12 (273966..274838) [873 bp, 290 aa] {ON} some
           similarities with uniprot|P40003 Saccharomyces
           cerevisiae YEL005c VAB2 VAC8P binding protein
          Length = 290

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 55/112 (49%), Gaps = 19/112 (16%)

Query: 100 RGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVD 159
           + N  I  +V+LP+  +D    +   +EQQ  ++   F             I++ + P+ 
Sbjct: 181 KDNSKITTDVTLPASDEDNSPDI---EEQQSKLSSLSFS------------IEKAQNPIP 225

Query: 160 FDKAFATPDIAQELTSQVARILGPKQVLPMAKRG---TVASDLEPLI-KDSF 207
            DKA  T + ++ + +   +I  P  +LPM K+    +VA D +P+I +DS+
Sbjct: 226 VDKAKNTDNSSRSIINSNVKIKNPTLILPMIKQRAQPSVALDAKPVIARDSY 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,410,477
Number of extensions: 806064
Number of successful extensions: 1771
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1780
Number of HSP's successfully gapped: 26
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)