Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01496g8.269ON56754924950.0
TDEL0F039608.269ON55855115930.0
YDR117C (TMA64)8.269ON56555215390.0
Skud_4.3778.269ON56254915060.0
Suva_2.2768.269ON56555114990.0
TPHA0J007808.269ON58355514810.0
NCAS0B038008.269ON56555614760.0
NDAI0J013108.269ON57956714550.0
Smik_4.3618.269ON56555214370.0
SAKL0H16874g8.269ON56354914270.0
KLTH0G13530g8.269ON57455914060.0
Kwal_56.237718.269ON56255213680.0
CAGL0B01837g8.269ON56955713620.0
KAFR0B054708.269ON56255113460.0
Kpol_392.28.269ON56655313411e-180
KLLA0F19294g8.269ON57055710961e-143
TBLA0I032008.269ON56355510851e-141
KNAG0H032008.269ON56156010421e-135
Ecym_43018.269ON56455810421e-135
AGR079W8.269ON5425589541e-122
Suva_10.845.230ON69548706.6
ZYRO0B09944g5.224ON503136699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01496g
         (567 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   965   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   618   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   597   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   584   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   582   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   575   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   573   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   565   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   558   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   554   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   546   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   531   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   529   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   523   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   521   e-180
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   426   e-143
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   422   e-141
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   405   e-135
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   405   e-135
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   372   e-122
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    32   6.6  
ZYRO0B09944g Chr2 (776502..778013) [1512 bp, 503 aa] {ON} weakly...    31   9.3  

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/549 (87%), Positives = 482/549 (87%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQF 240
           A                                    KAVDIDDIAEVLDEFRLEDVDQF
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQF 240

Query: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXXX 300
           LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKN   
Sbjct: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFEK 300

Query: 301 XXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCET 360
                        TIIGINKQKPELQNFQPYQI               KKDGSPQLRCET
Sbjct: 301 EGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRCET 360

Query: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420
           LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL
Sbjct: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420

Query: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMK 480
           VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMK
Sbjct: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMK 480

Query: 481 IGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLIID 540
           IGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLIID
Sbjct: 481 IGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLIID 540

Query: 541 HLNSLGIPT 549
           HLNSLGIPT
Sbjct: 541 HLNSLGIPT 549

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/551 (55%), Positives = 384/551 (69%), Gaps = 12/551 (2%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKLL +C+ QTG  +Y+F T ++KQTN++ Q   GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PIWFKEKHG LL+PTV++CW+ P LLP+VLTH FV+EERLFNGANLMLAGT+ PFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R  P  VCGIAS+  P V++A+GVVQL+LPSY SV+G+ G+AV+++HY  DGL + FK++
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQF 240
                                                  + I+D+A+VLDE  +EDVD F
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHT----EISIEDVAQVLDELSVEDVDHF 236

Query: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXXX 300
            TRALYYT THDT L +PI+ASNFISNHI  NLP VD  +VN+KK+SWKKTAKFLK+   
Sbjct: 237 FTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEK 296

Query: 301 XXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSP-QLRCE 359
                         I+G+NK K EL+NF PY+                 KD SP  +  E
Sbjct: 297 VGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK-----TSGQTASKKNSNKDSSPGMMYSE 351

Query: 360 TLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYH 419
            LYKPINL KDFIQ +DL P++ LYT  ELK+++N YI +  L DSKNKKMV+LDDLL+ 
Sbjct: 352 KLYKPINLGKDFIQCSDLPPKN-LYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFD 410

Query: 420 LVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEIVTE 478
           +  +K+K    PR VSRA I++P +AN+FT  +Q++K  D PLFKNP RG LP ++IVTE
Sbjct: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470

Query: 479 MKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLI 538
           MKIGRKV+TRVS FE F +D ++LAA LR+LCSGSTTIGET+TSPK  EV VQG HGPLI
Sbjct: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530

Query: 539 IDHLNSLGIPT 549
           ID+LN  GIPT
Sbjct: 531 IDYLNKQGIPT 541

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/552 (53%), Positives = 382/552 (69%), Gaps = 5/552 (0%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKLL T + QT N+EYSF T  IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PI FKEKH   L+PTV++CW +P LLP+VLTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R K GT+CGIASK AP+ V+A+G+V+LDLPS+D V+G+TGVAV+++H+  DGLSKVFK+ 
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK--AVDIDDIAEVLDEFRLEDVD 238
                                                K  +VD+++IAEVLD F + DVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNX 298
            F+TRALYYTLT D  LELPISASNFISNHI  NLP +DH +VNVKK+SWKK+AKFLK+ 
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 299 XXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRC 358
                          TI+G N  K EL+NF PY++               K+  S  +  
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418
            TLYKP NLAKD +++ +L      YT+Q++++A++ YI+  NLAD+K+K  VI+DDLL+
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASH-TYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419

Query: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEIVT 477
            +VNKK+K   A R+++R  I+ PLL N+FT  +QI+K  D  LFK P +G+LP+I+I+T
Sbjct: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479

Query: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537
           EMKIGRKVITRVS FE+F +D + LAA LR++CSGSTTI E+ T  K  EV VQGPHG  
Sbjct: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538

Query: 538 IIDHLNSLGIPT 549
           IIDHLN LGIP+
Sbjct: 539 IIDHLNKLGIPS 550

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/549 (52%), Positives = 381/549 (69%), Gaps = 4/549 (0%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKLL TC+ QT N EY+FPT  IKQTNF +Q  +G VYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PI FKEKH   L+PTV++CW +P LLP++LTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R K GT+CG+AS+ AP VV+A+G+V++DLPSYD VLG+TGVAV+++H+  DGLSK  KV 
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQF 240
                                                + V ++++AEVLD F + DVD F
Sbjct: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQ-VHVEELAEVLDHFSVSDVDYF 239

Query: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXXX 300
           +TRALYYTLT D  L LPIS SNFISNHI  NLP +DH +VNVKK+SW+K+AKFLK+   
Sbjct: 240 ITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHFEK 299

Query: 301 XXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCET 360
                        TI+G    K EL+NF PY++               K+     +   T
Sbjct: 300 EGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMT 359

Query: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420
           LYKP ++AKDF+++ +L  +   YT+Q++++AL+ YI++NNLAD+K+K  V++DDLL+++
Sbjct: 360 LYKPFSIAKDFLKEANLGFR-TYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNM 418

Query: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIP-LFKNPSRGNLPNIEIVTEM 479
           VNKK+K+  A R++ RA I++PLLAN+FT  +QI+K D   LFK P +G+ P I+I TEM
Sbjct: 419 VNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEM 478

Query: 480 KIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLII 539
           KIGRKVITRVS FE+F ID + LA  LR++CSGSTTIGE+ T  K  EV VQGPHG LII
Sbjct: 479 KIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLII 537

Query: 540 DHLNSLGIP 548
           DHLN+LG+P
Sbjct: 538 DHLNNLGVP 546

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/551 (52%), Positives = 375/551 (68%), Gaps = 5/551 (0%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKLL TC+ QT N+EY+FPT  IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PI FKEKH   L+PTV++CW +  LLP+VLTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R K GT+CG+AS+ AP +V+AVG+V++DLPSY  V+G+TGVAV++VH+  DGLSK FKV 
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKA--VDIDDIAEVLDEFRLEDVD 238
                                                +   ++I++IAEVLD   + DVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNX 298
            F+TRALYYTLT D  L LPISASNFISNHI  NLP +DH +VNVK++SWKK+AKFLK+ 
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 299 XXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRC 358
                          TI+G N  K EL+NF PY++               K+  S  +  
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418
            TLYKP NLAKD +++ +L P    YT+Q++++A+  YI+  NL D+K+K  V++DDLLY
Sbjct: 361 LTLYKPFNLAKDLVKEANL-PFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLY 419

Query: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLF-KNPSRGNLPNIEIVT 477
           ++VNKK+KD    R++ RA I++PLLAN+FT  +QIYK D  L  + P +G+ P I+I+T
Sbjct: 420 NMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIIT 479

Query: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537
           EMKIGRKVIT+VS FE   ID + LAA LR++CSGSTTIGE+ T  K  EV VQGPHG L
Sbjct: 480 EMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQL 538

Query: 538 IIDHLNSLGIP 548
           IIDHLN  G+P
Sbjct: 539 IIDHLNKSGVP 549

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/555 (51%), Positives = 378/555 (68%), Gaps = 8/555 (1%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK P+VKA SNLKNSE KKLL +C+ Q  + +Y+FP+ +IKQ N++ Q+  GTVYTD 
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEKH ++L+P+V+ CW +P LLP+++T+ +V+EE++ NGANLM++GT+LPFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           RL  G +CGIAS   P+VVMA+G+VQLDL SY  V+G+TGVAV ++HYL DGLS  FK+N
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-KAVDIDDIAEVLDEFRLEDVDQ 239
                                                  A   DD+AEVL+   ++ +D 
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIIDD 240

Query: 240 FLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXX 299
           F+T++LYY+LT+D KLE PISASNFISN+I  NLP VD++ VN+KKSSWKKTAKFL++  
Sbjct: 241 FITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHFE 300

Query: 300 XXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCE 359
                          I G NK+K EL++F PY+                  D    ++  
Sbjct: 301 KEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQSV 360

Query: 360 TLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYH 419
           + YKPI+L KD I+++ + P+  LYTA EL++ + +YI   NL DSKNKKM+++DDL+Y 
Sbjct: 361 SYYKPISLGKDLIRES-VAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419

Query: 420 LVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYK-GD----IPLFKNPSRGNLPNIE 474
           LV KK K++  PRL+SRA +IEP+  N+F  HFQIYK GD    +PLFK P RG++P +E
Sbjct: 420 LVYKK-KNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478

Query: 475 IVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPH 534
           IVTEMKIGRKVITRVS FE+FHID + LAA LR+LC+G+TTIGET+TSPK  EV VQGPH
Sbjct: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538

Query: 535 GPLIIDHLNSLGIPT 549
             +II HLNSL IPT
Sbjct: 539 SQVIIKHLNSLSIPT 553

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/556 (52%), Positives = 378/556 (67%), Gaps = 14/556 (2%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MF+K+PH+KALSNLKNS+ KKL  T  AQTGN +Y+ P+ ++KQTNFQ  + IGT+YTD 
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCPS-IVKQTNFQTPTTIGTIYTDE 59

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEKH   LY TV+ CW+   LLP+ L+H FV++E+LFNGANLM++GT+ PFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RLKPGTVCGIASKNAPD-VVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179
           +LK GT+CG+AS   P  VV A+G+V +DLP ++ V+G++GVAVQ++H+  D L K FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 NAX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDV 237
           +                                        A +++D+AEVLD   ++DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 238 DQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKN 297
           D F+TRALYYT+T DTKL LPISASNFIS HIN NLP VDH +VN+KKSSWKKTAKFLK+
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 298 XXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQ-- 355
                           T++G+NK K EL+NF PY++               KK+G  Q  
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGA-----KKEGDSQSG 354

Query: 356 -LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILD 414
            +   T YKPINLAKD I+++ + P   LY   E+++ +N+YI   NL D+KNKKMV+LD
Sbjct: 355 MMYSITFYKPINLAKDLIKESGM-PMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLD 413

Query: 415 DLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNI 473
           DLL+ +VNKK+ D T  R +SRA I+EP L N+FT HFQIY     PLFK+P RG+ P I
Sbjct: 414 DLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRI 473

Query: 474 EIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGP 533
           +I+TEMKIGRKVIT+VS FE F I+ + LAA LR++CSGSTTIGETMTSPK  EV VQGP
Sbjct: 474 KILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGP 533

Query: 534 HGPLIIDHLNSLGIPT 549
           HG +IIDHLN LG+PT
Sbjct: 534 HGQIIIDHLNKLGVPT 549

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/567 (52%), Positives = 379/567 (66%), Gaps = 22/567 (3%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFP-TGVIKQTNFQAQS--GIGTVY 57
           MFKK+PH+KALSNLKNS+ KKLL T + QT  + Y+F  + +IKQTNFQ  +   IGT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDADNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLP 117
           T+  N PIWFK KH +LLYPTVF CW++  +LP +L+H FV++E+LFNGANLM++GT+ P
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDSRLKPGTVCGIASKNAPD-VVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKV 176
           FDSRL PGT+CGIAS   P  +V A+GVV++++PS+D V+G+TGVAV+++H+  D L K+
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLED 236
           FK N                                        D     EVLD F+ ED
Sbjct: 181 FKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKEENRESNEPDF----EVLDHFKTED 236

Query: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296
           VD F+TR+LYYT+T DTK+ELPISASNFIS HIN NLP + H +VN+KK+SWKKTAKFLK
Sbjct: 237 VDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLK 296

Query: 297 NXXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXX--XXXKKDGSP 354
           +                T++G+NK K EL+NF PY+I                 K D   
Sbjct: 297 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKG 356

Query: 355 QLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILD 414
            +  ET YKPIN AKD ++     P   LYT QE+++ +  YI S NL D KNKKM++LD
Sbjct: 357 MMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLD 416

Query: 415 DLLYHLVNKKQKDT-TAPRLVSRATIIEPLLANSFTPHFQIY-----KGDI-----PLFK 463
           DLL+++V+K+Q +   APR + R TI+EP+LAN+FT H+QIY     KG++     PLFK
Sbjct: 417 DLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFK 476

Query: 464 NPSRGNLPNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSP 523
           +P RG+LP I+I+TEMKIGRKVIT+VS FEIF I  D LAA LR+LCSGSTTIGETMTSP
Sbjct: 477 SPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSP 536

Query: 524 KYKEVTVQGPHGPLIIDHLN-SLGIPT 549
           K  EV VQGPHG +IIDHLN   G+PT
Sbjct: 537 KTPEVQVQGPHGQIIIDHLNKKFGVPT 563

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/552 (52%), Positives = 378/552 (68%), Gaps = 5/552 (0%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKLL TC  QT N+EY+FPT +IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PI FKEKH   LYPTV++CW +P LLP+VLTHGFV+EE LFNGANLM++G++ PFDS
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R   GT+CG+A K +P VV+A+GVV+LDLPSYD V+G+TGVAV+++H+  DGL K FKV 
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK--AVDIDDIAEVLDEFRLEDVD 238
                                                K  A D++++AEVLD   + DVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNX 298
            F+TRALYY+LT D  L LPISAS FISNHI  NLP +DH +VNVKKSSWKK+AKFLK+ 
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 299 XXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRC 358
                          TI+G N  K EL+NF PY++               K   S  +  
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418
            TLYKP +LAKD +++  L   D  YT+Q+++NA+++YI+  NLAD K+K+ V++DDLL+
Sbjct: 361 LTLYKPFSLAKDLLREAKLGC-DTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLF 419

Query: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIEIVT 477
           ++VNKK+K     R+++R+ I++PLL+N+FT  +QI++ D   LF+ P +G  P I+IVT
Sbjct: 420 NMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVT 479

Query: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537
           EMKIGRKVIT+VS FE+FHID + LAA LR++CSGSTTIGE+ T  K  EV VQGPHG  
Sbjct: 480 EMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQF 538

Query: 538 IIDHLNSLGIPT 549
           IID+LN  GIP+
Sbjct: 539 IIDYLNKSGIPS 550

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/549 (51%), Positives = 364/549 (66%), Gaps = 4/549 (0%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKKDPH+KALSNLKNSE KKLLA+ R Q    +Y FPT V+KQT F+ Q+  GTVYTD 
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEKHG+L++PTVF CWS+P +LPVV TH  VVEE+L  GA+LML G V PF S
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           +   G++ G+AS  +P V+ A+G+VQLDLPSY  V+G+TGVAV ++H   DGL K FK+ 
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQF 240
                                                + V+ +D +E L+E   ED+D F
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSAEDIDHF 240

Query: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXXX 300
           LTR+LYYTLT D +L+LP++ASNF+SNHI HNLP VDH ++N+KKSSWKK+AKFLK+   
Sbjct: 241 LTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKHFEK 300

Query: 301 XXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCET 360
                         ++GINK K EL+ F PY+I                ++ S  ++  +
Sbjct: 301 ANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA---QENSNMMQAVS 357

Query: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420
           LYKPI+ AK+F +  DL P  I +TAQELK AL+ YI   NL +  +KKMV+LDD L+ +
Sbjct: 358 LYKPISSAKEFSKAVDLPPNKI-FTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLFPM 416

Query: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMK 480
           +N+  K   A R +SRA I+ P LAN+FT HFQI KGD+PLFK   +G +P I+IVTEMK
Sbjct: 417 INRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEIQIVTEMK 476

Query: 481 IGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLIID 540
           IGRKV+T+VS FE F +D + LAA LR+ CSGSTTIGETM+SPK  EVTVQGPHG ++I 
Sbjct: 477 IGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAIVIG 536

Query: 541 HLNSLGIPT 549
            LN  GIPT
Sbjct: 537 MLNEYGIPT 545

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/559 (49%), Positives = 359/559 (64%), Gaps = 11/559 (1%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+P +KALSNLKNSE K + + C+ QTG+ EY+FP+ VIKQT F+     GTV+TD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEK  +LLYPTVF CWS+  LLP+VL H +VVEE+L  GANLML GTV PFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R     +  +AS  APDVV A+G+VQ++LP Y  V+G++GVAV++VH   D L KVFKV 
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKA--------VDIDDIAEVLDEF 232
                                                K+        V+++DI+E L E 
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 233 RLEDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTA 292
           R+EDVD F TR+LYY+L HD KLE PISASNF+SNHI  NLP +DH +VN+KK+SWKKTA
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 293 KFLKNXXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXX-XXXXXXKKD 351
           KFLK                 TIIG+++ K EL+NF PY+I                +K+
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411
            +  ++  +LY+PI+  K F+  TDL P   ++T Q++K+A++ YI++ NL    NK  V
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQ-MFTQQDIKSAVDKYISAKNLVSPDNKSAV 419

Query: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNL 470
            LDDLLY LVN+  K   A R ++RA I+ P+L  +F+ HF I K D  PLFK+P +G++
Sbjct: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479

Query: 471 PNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTV 530
           P ++IVTEMKIGRKV+T+VS FE F +D DELA  LR+ CSGSTTIGE  TSPK  EVTV
Sbjct: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539

Query: 531 QGPHGPLIIDHLNSLGIPT 549
           QGPHGP +I+ LN  GIPT
Sbjct: 540 QGPHGPAVIELLNESGIPT 558

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/552 (50%), Positives = 352/552 (63%), Gaps = 9/552 (1%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+P +KALSNLKNSE KKL + CR Q    +YSFP+ VIKQT F+     GTVYTD 
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEK  +LLYPTVF+CWS+  L+P+VL H +VVEE+L  GANLML GTV PFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           R     + G+AS ++PDVV A+G+VQL+LP Y  V+G++GVAV++VH   D L K FKV 
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKA--VDIDDIAEVLDEFRLEDVD 238
                                                +   V+IDD AE L +  +EDVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNX 298
            F TRALYYTLT D+KLE+P SASNF+SNHI  NLP +DH +VN+KK+SWKKTAKFLK+ 
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 299 XXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRC 358
                          TI+G++K K EL++F PY+                    +  ++ 
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQ-----NSMMKA 355

Query: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418
             +YKP++ AK F+  TDL+P   +++ QELK A++ YIAS  L    NK  V LDDLL+
Sbjct: 356 LVIYKPMSSAKPFLCATDLSPNS-MFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLF 414

Query: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIEIVT 477
            LVN+  K   A R + RA I+ P+L  +F  HF + K D  PLFK+P +G++P I+IVT
Sbjct: 415 SLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVT 474

Query: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537
           EMKIGRKV+T+VS FE F +D DELA  LR+ CSGSTTIGET TSPK  EVTVQGPHGP 
Sbjct: 475 EMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPA 534

Query: 538 IIDHLNSLGIPT 549
           +I+ LN L IPT
Sbjct: 535 VIELLNQLAIPT 546

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/557 (50%), Positives = 361/557 (64%), Gaps = 14/557 (2%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+PH+KALSNLKNSE KKL   CR QT N+EYSF +  IKQTNF+  + IGT+YTD 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
            N PIWFKEKH   LYPTV ACW  P L+PVVLTH  V+E+ +FNGANLM++GT+ PFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           RL  GTVCGIA K  P++++AVG+VQ++LPS+  V+G+TGVAVQ+VH+L D L KVFKV 
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 AX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVD 238
                                                  +  ++DD+AEVLDE RLED+D
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDID 240

Query: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLP-SVDHEKVNVKKSSWKKTAKFLKN 297
            F+TRALYYT++ DTKLE P SASNF+SNHINHNLP   +  +VN+KKSSWKKTAKFLK+
Sbjct: 241 YFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLKH 300

Query: 298 XXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLR 357
                           TI+ +NK K E++ F PY +               K      ++
Sbjct: 301 FEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TIK 356

Query: 358 CETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLL 417
             TLYKPINLAKDFI    + P   LY   E+K  +N YI   +L D K+KK V++DD+L
Sbjct: 357 IVTLYKPINLAKDFISSNKV-PLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDML 415

Query: 418 YHLVNKKQKD-TTAPRLVSRATIIEPLLANSFTPHFQIYK----GDIPLFKNPSRGNLPN 472
             ++ KK++D  T  R++ RA I++P+L N+F  ++ +++       PL K P +G  P 
Sbjct: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475

Query: 473 IEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSP-KYKEVTVQ 531
           I IVTEMKIGRKVIT+VS FE+F ID +E AA +R+ CSGSTTIGET +S  K  EV VQ
Sbjct: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQ 535

Query: 532 GPHGPLIIDHLNSLGIP 548
           GPHG LI+ +LN LGIP
Sbjct: 536 GPHGQLIMSYLNDLGIP 552

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/551 (49%), Positives = 352/551 (63%), Gaps = 7/551 (1%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQ-TGNQEYSFPTGVIKQTNFQAQSGIGTVYTD 59
           MFKK+P +KALS LKNS+ KKL+ + +AQ   +++ S     I QTNF + +  GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  ADNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFD 119
           +++ PI FK KH + LYPT F  WS+ GLL  V TH  VVE  +FNGA+LM+AGTV PFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179
           S L  GT+C +A+K APDV +AVG+V+L+LP Y  VLGKTGVAV+++H+  D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 NAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQ 239
                                                  +   DDIAEVLDE  +EDVD 
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVEDVDY 240

Query: 240 FLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXX 299
           F+ RALY+T+  D  L LP+ AS F+SNHI  NLP VDH+KVN+K++SWKKTAKFLK   
Sbjct: 241 FIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFLKYFE 300

Query: 300 XXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCE 359
                          I+G+NK K EL+NF PY+I                +  S  +   
Sbjct: 301 KEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVS--VSSV 358

Query: 360 TLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYH 419
            LYKPINL + FI++++++    +YT+ E++N +NDYI   NL D K+KKMV+LDDLL+ 
Sbjct: 359 NLYKPINLGQKFIKESNISGGP-MYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDDLLFA 417

Query: 420 LVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIEIVTE 478
           +VN+K ++   PR++ RA I+EPL+AN+F  +FQ+YKGD  PLFKNP +G  P I+IVTE
Sbjct: 418 MVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKIDIVTE 477

Query: 479 MKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLI 538
           MKIGRKV+TRVS FE F I  +ELAA LR+LCSGSTTI E  T  K  EV VQGPHG LI
Sbjct: 478 MKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEVQVQGPHGQLI 535

Query: 539 IDHLNSLGIPT 549
           IDH N  GIP+
Sbjct: 536 IDHFNKSGIPS 546

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  521 bits (1341), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 283/553 (51%), Positives = 358/553 (64%), Gaps = 7/553 (1%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK PH+K+LSNLKNSE KKLL +C+AQTG+ +Y+FPT VIKQTNF AQ+ +G +YTD 
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +  P+WFKEKH  LL+PTV+ CW  P LLP+VLTH  V+ E +FNGANLM++GT+ PFDS
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           RL P T+CGIA++N P+ ++AVGVVQLD+PSY SV+GKTGVAV ++HY  DG+S  FK+ 
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDE---FRLEDV 237
                                                  +  +D++E+  E     +ED+
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 238 DQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKN 297
           D F+TR+LYYTLT+D KL  PI +S+FISNHI  NLP VDH  VN+KK+SWKK++KFLK+
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 298 XXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLR 357
                           TI+G NK+K EL+ F+PY+I               +++    + 
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSN-RQESENMMY 359

Query: 358 CETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLL 417
               Y P   AK F+  T+L P    YTA ELKNA+ +YI    L D KN KM  LDD L
Sbjct: 360 SLVFYSPKGSAKQFMTLTEL-PYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418

Query: 418 YHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNIEIV 476
           Y +   K K T  PR ++RA +IE    N+FT  +Q++K D  PL KNP RG+ P I+IV
Sbjct: 419 YDMCYTK-KSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477

Query: 477 TEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGP 536
           TEMKIGRK++TRVS FE F ID D LA  LRRLCSGSTTIGET TSPK  EV VQGPH  
Sbjct: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSK 537

Query: 537 LIIDHLNSLGIPT 549
           +IIDHLNSL IPT
Sbjct: 538 IIIDHLNSLSIPT 550

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 240/557 (43%), Positives = 324/557 (58%), Gaps = 12/557 (2%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MF K+PH+K LSNLKNS+ KKL +T + Q  N+EY+ PT VIKQT+FQ  +  G++YTD 
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  DNKPIWFKEKHGNLLYPTVFACWS-HPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFD 119
            NKPIWFK K  + LYPT+F+ W+    LLP++LTH FV+E+ +  GA LML GTV PF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179
           S +K G++ GIAS   P +V A+G+ ++DL     V+G  G+AV++VHYL DGL K FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 NAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVD---IDDIAEVLDEFRLED 236
                                                 ++     +++IA+ L+E  +ED
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296
           VD  L RA+ Y++  D K+ LPI AS FISNH+  NLP VD   VN+KKSSWKK  K LK
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299

Query: 297 NXXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQ-IXXXXXXXXXXXXXXXKKDGSPQ 355
                            T+I +NK   +L N + Y+ +                K+    
Sbjct: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359

Query: 356 LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDD 415
              E LYKP++  + FI     +     YT QELK  L+ Y+A+NNL D +NK +V  DD
Sbjct: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419

Query: 416 LLYHLVNKKQKDTTAPRLVSRATIIEP-LLANSFTPHFQIYK--GDIPLFKNPSRGNLPN 472
            LY + N+  ++    + ++R  I+ P  L+ +F  + QIYK  G+ PL K P +G +P 
Sbjct: 420 TLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGE-PLLKVPEKGPIPT 477

Query: 473 IEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQG 532
           +EIVTE KIGRKVITRV+ FE F ID +ELAA LR+ CSGSTTIGE+  S K  EV VQG
Sbjct: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEVQVQG 536

Query: 533 PHGPLIIDHLNSLGIPT 549
           PHG ++I  LN  GIPT
Sbjct: 537 PHGSIVISILNDYGIPT 553

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  422 bits (1085), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 221/555 (39%), Positives = 324/555 (58%), Gaps = 16/555 (2%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+  +  LSNLKNSE++ +  TCR    N EY FP   +KQT F++    G +YTD+
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N PIWFK+K+ N + PTV+  W +P  +P++ TH F++E ++FNGANLM+ GTV P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
           RLKPG +CGIAS   P  ++A+G+   D+ + D+ LGKTGVAV+++H+  D L+ +FK+ 
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK------AVDIDDIAEVLDEFRL 234
                                                         + DD+AE L++ R+
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 235 EDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKF 294
           ED+D FLT++LYYT+T +T L+LPI +S F+S ++  NLP+VDH +VN+KKSSWKKTAKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 295 LKNXXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSP 354
           LK+                TI G NK+KP+L+ F PY+I               K+D   
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRI----GKPAGALPSKDKQDNKN 356

Query: 355 QLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILD 414
            L+  TLY P            L  +   +T+ E+ +A+  YIA  NLA+ K+K  + +D
Sbjct: 357 FLKVVTLYSPKKKNDSCWTALGLTSKS-YFTSAEITSAIQGYIAKKNLANPKDKAKISMD 415

Query: 415 DLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGD-IPLFKNPSRGNLPNI 473
           D+L+ LV    K   A R + R+ ++EP+L N+F  + Q++  D I L K+P +G+ P +
Sbjct: 416 DVLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTV 474

Query: 474 EIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGP 533
           ++VTE     KVITRVS FE+F+ID  +++  L+ LCSGST+I E    P   EV VQGP
Sbjct: 475 KMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEEL---PNGSEVQVQGP 531

Query: 534 HGPLIIDHLNSLGIP 548
           HG +++++    GIP
Sbjct: 532 HGDIVMEYFEKHGIP 546

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  405 bits (1042), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/560 (40%), Positives = 330/560 (58%), Gaps = 26/560 (4%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK PH+K LSNLKNSE +KL    + Q G  E+ F    +KQTNFQ+ + +GT+Y + 
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  DNKPI--WFKEKHGN-LLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLP 117
           +  P+  +FKEKHG+  L+P+V+ACWSHPGLLP++LTH  V+E+ LFNGANLM++GT+ P
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQL--VHYLPDGLS 174
           FD + L  G  CGIA+  +PDV++AVG +++DL  +++        V +   H+  DGL+
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KVFKVNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRL 234
             F++                                        V +DD+AEVL+   +
Sbjct: 181 DAFRLK-------LDIPDKLESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLETLSV 233

Query: 235 EDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLP-SVDHEKVNVKKSSWKKTAK 293
           EDVD F+TRALYYTLT + KL LPI+ASNF+S H+   LP  +D  +VNVKKSSWKKTAK
Sbjct: 234 EDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAK 293

Query: 294 FLKNXXXXXXXXXXXXXXXXTIIGINKQKPE--LQNFQPYQIXXXXXXXXXXXXXXXKKD 351
           +LK+                 ++G    K    L++F PY +               +  
Sbjct: 294 YLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKS----QTT 349

Query: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411
             P +   T ++P + A+  +    L  Q   ++  E++  LN+YI +N LA   N KMV
Sbjct: 350 NGPVMFAVTSFQPDSTAQTALP---LGGQR-YFSGPEIREVLNEYITANKLAQPNNPKMV 405

Query: 412 ILDDLLYHLVNK-KQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGN 469
           +L+D L+ +V K  ++  T  R+++R  I+E ++   F   +Q++K  D PL K+P +G 
Sbjct: 406 LLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGE 465

Query: 470 LPNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVT 529
            P + I+TEMKIGRKV+TRV  F+  +I + E AA LR+LCS STTIG+T+++P   E+ 
Sbjct: 466 PPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQ 525

Query: 530 VQGPHGPLIIDHLNSLGIPT 549
           VQG HGPLIIDHL  LG+P+
Sbjct: 526 VQGAHGPLIIDHLRELGVPS 545

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  405 bits (1042), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/558 (39%), Positives = 317/558 (56%), Gaps = 17/558 (3%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK P +K+ SNLKNSE KKLL   RAQ  NQE+ F T ++KQ  F+  +  GT++TD 
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           DNKPI+FKEKH   L PT+  CW +PGLL VVLTH  V++ +L NGA+LML GT+ PF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
               G + G+AS   P VV A+GV QL+L     V+G+TGVAV+++H + DGL +VFK++
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 ---------AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDE 231
                    +                                    +   + ++AE L+E
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 232 FRLEDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKT 291
             +E VD FLT+A+YYTL  D  L+LPI ASNFI+NH+  NLP +   +V++K+SSW + 
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 292 AKFLKNXXXXXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKD 351
           +KFLK                 T++ +NK K E+++FQPY+                K +
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSKNN 354

Query: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411
               +     Y+P+N AK  +     NP  +L  A+++K  LN Y+    L ++ +++++
Sbjct: 355 DKHDVEVVVYYQPLNTAKATLHALGNNPNAML-KAKDIKAILNKYVTEKKLVNATDERII 413

Query: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLP 471
           +LDD L+ L  KK   + + R V RA + + +L+ SFT  F I+K   PL   P +    
Sbjct: 414 LLDDTLFSLAYKKSA-SDSTRKVLRAKMFDLILSTSFTEVFFIFKDGKPLSSKPLKSKNR 472

Query: 472 NIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQ 531
           N+ ++TEMKI RK++TR+S FEI+ +D +EL+  LR+ CSGS+T+ E  T     EV VQ
Sbjct: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532

Query: 532 GPHGPLIIDHLNSLGIPT 549
           GPHG   I+ LN  GIP+
Sbjct: 533 GPHGNTAINILNEHGIPS 550

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  372 bits (954), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/558 (38%), Positives = 301/558 (53%), Gaps = 40/558 (7%)

Query: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60
           MFKK+P++   SN KNSE K+L A+ R Q   + Y F +  IK   F+ QS +GTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120
           +N P+WF+ KH     PTV++CW HP LLPVV TH  VVE +L  GA+LML GTV PF S
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180
             + G V GIAS  AP VV AVG+ ++DL    +V   TGVAV+++H   DGL +VFKV 
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAVDIDDIAEVLDEFRLEDVDQF 240
                                                K    + +AE L+   +EDVD  
Sbjct: 181 -------------REAPEASEAKGASPEAREPEAEPPKTAPGEGLAEELERLTMEDVDHL 227

Query: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNXXX 300
           LTRA+YYT+  D +L+LP++AS FI+ H+  NLP +D  +V VK+SSW K AK LK+   
Sbjct: 228 LTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHFEA 287

Query: 301 XXXXXXXXXXXXXTIIGINKQKPELQNFQPYQIXXXXXXXXXXXXXXXKKDGSPQLRCET 360
                        T++ +N     L++F+PY+                 K+ S     E 
Sbjct: 288 QGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGS-------KNSSTTQSLEI 340

Query: 361 LYKPINLAKDFIQQTDLNPQ---------DILYTAQELKNALNDYIASNNLADSKNKKMV 411
           +Y        ++    L PQ         D L +A+++++ L  Y+A+    D  +K M+
Sbjct: 341 VY-------HYVPNRTLLPQLNGLGISGGDAL-SAKDIRDRLEQYVAARKCVDPYDKSML 392

Query: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLP 471
            LDD L  L++K     T PR + R   +  LL+ SF+ +F + +GD PL K P +G  P
Sbjct: 393 RLDDTLAQLLHKNVNADT-PRSLPRPEALAALLSRSFSEYFVVMRGDAPLSK-PQKGRAP 450

Query: 472 NIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQ 531
            I++  E KI +KV+T+VS FE++ +D +ELAA LR  CSGSTTI +   + K  EV VQ
Sbjct: 451 PIKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT-KAVEVQVQ 509

Query: 532 GPHGPLIIDHLNSLGIPT 549
           GPH   I+  LN  GIP+
Sbjct: 510 GPHEATIVSILNKHGIPS 527

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
           YLR006C (REAL)
          Length = 695

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 438 TIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLPNIEIVTEMKIGRKV 485
           T   P+LANS TPH+ IY     +   P    LPN+   T  K+  K+
Sbjct: 441 TPTSPILANSQTPHYSIYNAPFAVSSPPDP--LPNLFTTTSEKVFPKI 486

>ZYRO0B09944g Chr2 (776502..778013) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P47084 Saccharomyces cerevisiae
           YJR003C Hypothetical ORF
          Length = 503

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 22/136 (16%)

Query: 389 LKNALNDYIASNNLADSKNKKMVILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLA--N 446
           LK+     I   N+   +N K  +LD L+ H++  K  +   P L    T +EP L    
Sbjct: 161 LKSLAQCMILLQNIDHKQNIKQDVLDVLVGHILEGKISNALQPLLQYGTTSLEPFLERIE 220

Query: 447 SFTPH--FQIYKGDIPLFKNPSRGNLPNIEIVTEMKIGRKVITRVSRFE--IFHIDE--- 499
             TP+  +QIYK            N P   + TE  +  K++  + +F+  +F  +E   
Sbjct: 221 ELTPYQIYQIYK------------NFPLDSLKTEEGLFFKIVNTLGKFQKPVFSQEEVQT 268

Query: 500 -DELAATLRRLCSGST 514
            DE   +L+     S 
Sbjct: 269 SDEFKKSLQEFGEFSV 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,362,495
Number of extensions: 2229768
Number of successful extensions: 6533
Number of sequences better than 10.0: 25
Number of HSP's gapped: 6608
Number of HSP's successfully gapped: 42
Length of query: 567
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 452
Effective length of database: 40,294,809
Effective search space: 18213253668
Effective search space used: 18213253668
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)