Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01474g8.270ON59959930200.0
TDEL0F039708.270ON6194358851e-110
Skud_4.3788.270ON6524468771e-109
YDR118W (APC4)8.270ON6524908501e-105
Suva_2.2778.270ON6494778491e-105
Smik_4.3628.270ON6484488341e-102
Kpol_392.18.270ON4244167011e-85
KAFR0B054608.270ON6104856506e-76
KNAG0H031908.270ON6224775931e-67
TPHA0J007908.270ON6854645873e-66
NCAS0B037908.270ON6124785526e-62
SAKL0H16852g8.270ON6444245091e-55
CAGL0B01859g8.270ON6224195045e-55
NDAI0J012708.270ON7354865017e-54
TBLA0C045708.270ON6084724861e-52
Kwal_56.237668.270ON7404154532e-47
KLTH0G13508g8.270ON6454164466e-47
AGR078C8.270ON7153471475e-09
Ecym_43008.270ON7153431323e-07
KLLA0F19316g8.270ON6712921000.002
KLLA0B12848g2.452ON361144800.33
CAGL0M13409g5.49ON152775752.0
Kpol_1066.58.464ON497100714.7
Skud_8.1695.416ON58474715.4
TDEL0H003707.534ON465123706.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01474g
         (599 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...  1167   0.0  
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   345   e-110
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   342   e-109
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   332   e-105
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   331   e-105
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   325   e-102
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   274   1e-85
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   254   6e-76
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   233   1e-67
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   230   3e-66
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   217   6e-62
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   200   1e-55
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   198   5e-55
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   197   7e-54
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   191   1e-52
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   179   2e-47
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   176   6e-47
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    61   5e-09
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    55   3e-07
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    43   0.002
KLLA0B12848g Chr2 (1122397..1123482) [1086 bp, 361 aa] {ON} simi...    35   0.33 
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    33   2.0  
Kpol_1066.5 s1066 complement(6994..8487) [1494 bp, 497 aa] {ON} ...    32   4.7  
Skud_8.169 Chr8 (302088..303842) [1755 bp, 584 aa] {ON} YHR108W ...    32   5.4  
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    32   6.8  

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/599 (95%), Positives = 571/599 (95%)

Query: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60
           MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI
Sbjct: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60

Query: 61  FYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120
           FYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP
Sbjct: 61  FYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120

Query: 121 KMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISIQ 180
           KMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISIQ
Sbjct: 121 KMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISIQ 180

Query: 181 LAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQD 240
           LAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQD
Sbjct: 181 LAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQD 240

Query: 241 HIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKN 300
           HIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKN
Sbjct: 241 HIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKN 300

Query: 301 LKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXXXXIDCLQ 360
           LKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGN               IDCLQ
Sbjct: 301 LKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPLLPPIDCLQ 360

Query: 361 FFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPDTASYLQ 420
           FFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPDTASYLQ
Sbjct: 361 FFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPDTASYLQ 420

Query: 421 LRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKINISHEAHNKMNDIFCDLM 480
           LRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKINISHEAHNKMNDIFCDLM
Sbjct: 421 LRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKINISHEAHNKMNDIFCDLM 480

Query: 481 DLTVIKTNNPTGTATGLENGLILLATKSQVILLDPQSLMILAQLPLQIPLTYLEKEREFV 540
           DLTVIKTNNPTGTATGLENGLILLATKSQVILLDPQSLMILAQLPLQIPLTYLEKEREFV
Sbjct: 481 DLTVIKTNNPTGTATGLENGLILLATKSQVILLDPQSLMILAQLPLQIPLTYLEKEREFV 540

Query: 541 XXXXXXXXXXXXXQDMITRAYWQHTTLQLELQGSQQGPIKTAIDYQVTPNGDQWSLAVL 599
                        QDMITRAYWQHTTLQLELQGSQQGPIKTAIDYQVTPNGDQWSLAVL
Sbjct: 541 SSTTTMATSTTTTQDMITRAYWQHTTLQLELQGSQQGPIKTAIDYQVTPNGDQWSLAVL 599

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  345 bits (885), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/435 (42%), Positives = 279/435 (64%), Gaps = 21/435 (4%)

Query: 4   DYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYK 63
           DY  YNP+Y LY K+F +G S+ R+AD+A+IAT+ VRD++ +A +QWDPITGK +++FYK
Sbjct: 7   DYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYK 66

Query: 64  DGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMV 123
           DG  RIYD F++G+L++LLR S       IWDRIEL   E   K    DH V   MPKM+
Sbjct: 67  DGNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFK---FDHFVLNSMPKMI 123

Query: 124 KFARDSRQLCVVPYTLPSDVWRPQAADD-----TNALLDAHVIRCHDS-LSVMFDGEFTI 177
           +FARD+RQ+ ++PY  P+  WR    ++        +LD H++   D+ L +M DG+F  
Sbjct: 124 RFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLVLMLDGDFI- 182

Query: 178 SIQLAAIPS-PLVK--FVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234
            ++LAA PS P +K   V+ +  Y  FY+D +VE   L  L++   +++L+++ I ++QL
Sbjct: 183 -LRLAAGPSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQL 241

Query: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294
           + YLQDH++LI+RDL+ PY EFL + C  AF GY++L E+L  L+L G ++ ELE+W   
Sbjct: 242 NHYLQDHLDLIKRDLVAPYTEFLTKICDAAF-GYEILHEELESLLLGGGLSVELENWFCY 300

Query: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXXX 354
           ++GEKN K+W+K+G + Y KT+Q+LTL+ +PACER+I L +RC                 
Sbjct: 301 TVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTD 360

Query: 355 XIDCL------QFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDN 408
             +        Q +L++ +E I  +S+Q+ L  +FL WFDDR+ E++DEDYK + ++  N
Sbjct: 361 SSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSN 420

Query: 409 SSLGPDTASYLQLRL 423
             +G   A+YL LR+
Sbjct: 421 CKIGYQIATYLDLRI 435

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  342 bits (877), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 177/446 (39%), Positives = 271/446 (60%), Gaps = 18/446 (4%)

Query: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64
           ++DYNP +P++  + T+G ++HR++D ARIA I VR+++ VA Y WD  +GKFLSIF+KD
Sbjct: 9   FIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKD 68

Query: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVK 124
           GTVRI+D F+ GRLVS LR  S     GIWDRI L   +      +  ++V +++PK+++
Sbjct: 69  GTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPL---KREYDSETFAYNVIDILPKLIR 125

Query: 125 FARDSRQLCVVPYTLPSDVWRPQAADD--TNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180
           F +DS+++ +VPYT P+ +WR    DD  +  +LD HVI    +D +++ F+G++TI + 
Sbjct: 126 FVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLP 185

Query: 181 LAAIPSP--LVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRY 237
           +  I +   L   V  Q   Y  FY DGSV   +L  L++   S+ LL  ++ +++L  Y
Sbjct: 186 MDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGY 245

Query: 238 LQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMG 297
           L  H+ELI R+L+ PY +F++R C  A+ GY+ L+ +L  L L+G+V+ +LEDWL NS+G
Sbjct: 246 LLAHVELINRELITPYLDFVKRICDEAY-GYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304

Query: 298 EKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXXXXID 357
           EKNLK+W+ LG +AY KT Q+LTL  +P CER+I   ++  G                + 
Sbjct: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLT 364

Query: 358 CLQFFLK-------NVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSS 410
            ++  LK       N L++I +L   + L   F  WF+DR+ E +DEDYKL+F   D+  
Sbjct: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424

Query: 411 LGPDTASYLQLRLRNSSPEFSSVSDL 436
            G D  +Y    L   S E SSV ++
Sbjct: 425 FGYDLLTYFDKILSYRSTESSSVINM 450

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  332 bits (850), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/490 (36%), Positives = 288/490 (58%), Gaps = 23/490 (4%)

Query: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64
           ++DYNP++P++  +  +G +++R++D AR+A I +R+++ VA Y WD  TGKFLSIF+KD
Sbjct: 9   FIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKD 68

Query: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVK 124
           GT+RI+D F+ GRLVS LR  S     GIWDRI L + E N +D++   ++ + +PK+++
Sbjct: 69  GTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRY-EPNNRDFAC--NIIDDLPKLIR 125

Query: 125 FARDSRQLCVVPYTLPSDVWRPQAAD--DTNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180
           F +DS+++ +VPYT P+ +WR    D  D+N  LD HV+    +D ++V F+G++ + + 
Sbjct: 126 FVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLS 185

Query: 181 LAAI--PSPLVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRY 237
           +  I   + L   +  Q   Y  FY+DG+V+  +L  L++   S+ LL  ++ +++L  Y
Sbjct: 186 VDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGY 245

Query: 238 LQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMG 297
           +  H+E I R+L  PY +F++R C  A+ GY  L+ +L  L L+G+++ +LEDWL NS+G
Sbjct: 246 MLTHLEFINRELATPYLDFVKRLCDEAY-GYGKLKSELEALFLLGEISCDLEDWLCNSVG 304

Query: 298 EKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXXXXID 357
           EKN KRW+ LG +AY KT+Q+LTL  +PACER+I   ++                   + 
Sbjct: 305 EKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLT 364

Query: 358 CLQFFLKN-------VLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSS 410
            ++  LK+        L +I  L   + L   F  WF+DR+ E++DEDYKL+F   D+  
Sbjct: 365 AVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLY 424

Query: 411 LGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKINISHEAHN 470
            G D  SY    L     E SS+ D    +    D ++S+  +  D   S +N SH   +
Sbjct: 425 FGYDLLSYFDRILSKKGTEPSSIID----VKLYRDLINSMSDMEKDIAQSNVN-SHIQQH 479

Query: 471 KMNDIFCDLM 480
            + D+  D+ 
Sbjct: 480 ILVDLKTDVF 489

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  331 bits (849), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/477 (38%), Positives = 286/477 (59%), Gaps = 22/477 (4%)

Query: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60
           M+  ++DYNP +P++  +  +G ++HR++D AR+A I VR+++ VA Y WD  TGKFLSI
Sbjct: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60

Query: 61  FYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120
           F+KDGT+RI+D F+ GRLVS LR        GIWDRI L +   N    +  ++V +++P
Sbjct: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSN---RNFANNVIDVLP 117

Query: 121 KMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNAL--LDAHVI--RCHDSLSVMFDGEFT 176
           K+++F +DS+++ + PYT P+ +WR    DD      LD HVI    +D ++V F+G++ 
Sbjct: 118 KLIRFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYA 177

Query: 177 ISIQLAAIPSP--LVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQ 233
           I + ++ I +   L   V  Q+  Y  FY DG+V  F+L  L++   S+ LL+ ++ +++
Sbjct: 178 ILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKE 237

Query: 234 LHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLV 293
           L  YL  HIE I R+L  PY +F++R C  A+ GY  L+ +L  L L+G+V  +L+DWL 
Sbjct: 238 LIGYLLAHIEFINRELTTPYMDFVKRICDEAY-GYSKLKSELKCLFLLGEVPSDLDDWLC 296

Query: 294 NSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXX 353
           N++GEKN KRW+ LG +AY KT+QV TLA +P CER+I   Q+  G              
Sbjct: 297 NAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXX 356

Query: 354 XXIDCLQFFLKN-------VLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLH 406
             +  ++  LK         L++I  L   + L   FL WF+DR+ E +DEDYK +F   
Sbjct: 357 XDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFE 416

Query: 407 DNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDALTSKIN 463
           D+   G D  ++ +  L + + E SSV D    +    D ++S+ ++  D   + +N
Sbjct: 417 DDPYFGYDLLNFFEKFLSDRNTESSSVID----MKLYRDLINSMTAMEKDIAKNNVN 469

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  325 bits (834), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 168/448 (37%), Positives = 266/448 (59%), Gaps = 23/448 (5%)

Query: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64
           ++DYNP +P++  +  +G +++R++D AR+A I +R+++ VA Y WD +TGKFLSIF+KD
Sbjct: 9   FIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKD 68

Query: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVK 124
           GT+RI+D F+ GRLVS LR  S     G WDRI L   E    + ++ +++ + +PK+++
Sbjct: 69  GTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPL---ESESGNGNLAYNIIDYLPKLIR 125

Query: 125 FARDSRQLCVVPYTLPSDVWRPQAAD--DTNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180
           + +DS+++ +VPYT P+ +WR    D  + N  LD H+I    HD ++V F+G++ I + 
Sbjct: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVP 185

Query: 181 LAAIPSPLVKFVSAQHQ-----YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLH 235
           + A  +   +FV +  +     Y  FY DG+V   +L  L++   S+ +LK ++ +++L 
Sbjct: 186 VGADENE--RFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELI 243

Query: 236 RYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNS 295
            YL +HIE I R+L+ PY EF+ R C  A+ GYD L  +L  L L+G+V+ +LEDWL NS
Sbjct: 244 GYLLNHIEFINRELVTPYLEFVNRLCDEAY-GYDKLISELECLFLLGEVSCDLEDWLCNS 302

Query: 296 MGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXXXXXXXXX 355
           +GEKN KRW+ LG +AY KT Q+LTL  +PACER+I   ++  G                
Sbjct: 303 VGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSD 362

Query: 356 IDCLQFFLKN-------VLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDN 408
           +  +   LKN        L++I  L   + L  +F  W +DR+ E +DEDYKL+    D+
Sbjct: 363 LTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDD 422

Query: 409 SSLGPDTASYLQLRLRNSSPEFSSVSDL 436
              G D  +Y    + N   E S V ++
Sbjct: 423 PYFGYDLLTYFH-NISNRGAETSPVLNM 449

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  274 bits (701), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 146/416 (35%), Positives = 246/416 (59%), Gaps = 22/416 (5%)

Query: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64
           Y  YNP + LYV +  +G +V+R+ D +++A I ++D   VAGY+WD  +G+F+S+F  D
Sbjct: 11  YSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTD 70

Query: 65  GTVRIYDGFRSGRLVSLLRASSNGAV-SGIWDRIEL-LHSEENIKDWSIDHDVTEMMPKM 122
           GT+RIYD F++GRLVS +R+SS   V S +WDR E  + S+  +     D ++ E +P +
Sbjct: 71  GTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQL----FDSNIIECLPTL 126

Query: 123 VKFARDSRQLCVVPYTLPSDVWR--PQAADDTNA------LLDAHVIR--CHDSLSVMFD 172
           +KF +DSR + ++ Y  P+  WR   + + DT+       LLD H+      D+ +++ +
Sbjct: 127 IKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILN 186

Query: 173 GEFTIS-IQLAAIPSPLVKFVSAQH--QYLAFYQDGSVERFDLANLVKDPFSLRLLKNVI 229
           G + I+ I +  I    V  +   H  +Y++FY++G   + +  NL+    S  LL N++
Sbjct: 187 GVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246

Query: 230 TMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAF-GGYDLLREQLIDLMLVGDVTPEL 288
            +R L+RY+ DH++LI+R+L+ PY +F+++ C  A+ GG   L ++L  L+L G++  E 
Sbjct: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306

Query: 289 EDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG--NXXXXXX 346
           +DWLVN +G++N K+WRKLG D + K +++LTLA +P+CER +   +R  G  N      
Sbjct: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYMKTD 366

Query: 347 XXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLR 402
                     +     ++N +  I SL++Q +    F +W +D++ E  DEDYK R
Sbjct: 367 TDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNR 422

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  254 bits (650), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 149/485 (30%), Positives = 267/485 (55%), Gaps = 29/485 (5%)

Query: 2   DQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIF 61
           ++ Y  YN   PLY ++  +G  V+R +D+  IA  I++    VAG  WD I+GK+LSIF
Sbjct: 8   ERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIF 67

Query: 62  YKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPK 121
           ++DG++RI D F+ G+LV+ LR          WDRIE   + E +K +  + ++ ++MP 
Sbjct: 68  FRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNE-MKQF--NKNIVDLMPS 124

Query: 122 MVKFARDSRQLCVVPYTLPSDVWRPQAAD-DTNALLDAHVIRCH--DSLSVMFDGEFTIS 178
           +++F   + +L ++PYT  +  WR   A    N ++D H +     DS  ++ +G++ ++
Sbjct: 125 LIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184

Query: 179 IQL------AAIPS-PLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITM 231
           ++         +P+  L+K  SA   Y   Y+DGS  + D ++ +     + LL+ ++++
Sbjct: 185 LKTPETDLSEKVPACSLIK--SANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSL 242

Query: 232 RQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDW 291
           + + +Y ++H++L++R +++PY +FLE+ C GAFG   L+ E  I  +L G ++ EL+DW
Sbjct: 243 KDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLL-GTISDELQDW 301

Query: 292 LVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG-------NXXXX 344
           L  S+G+KN+ +WR L  DAY +T ++ T+A + ACER+I L +RC G            
Sbjct: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361

Query: 345 XXXXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFN 404
                      +  LQ  LK+++      +++  +L  FL W +DRV E +D+DYK + +
Sbjct: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421

Query: 405 LHDNSS----LGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILIDA-LT 459
           +  NS+    LG  +  YL    +  S +  +   + H+L      +S +++  I+  L 
Sbjct: 422 ITQNSNTCYKLGK-SFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILE 480

Query: 460 SKINI 464
           +KI I
Sbjct: 481 NKIAI 485

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 146/477 (30%), Positives = 243/477 (50%), Gaps = 20/477 (4%)

Query: 3   QDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFY 62
           Q Y + N V PLYV + T+   V+R  DD+ IA+  +RD SQV  YQWD I G+ +S+ +
Sbjct: 10  QFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMF 69

Query: 63  KDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKM 122
           +DG++RI D     +LV+LLR    G    +WDRI L    +++ +W  D  +T+ +P++
Sbjct: 70  QDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSM-EWDPDI-ITQSLPRL 127

Query: 123 VKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180
           VKF        + PY   +  WR   +     +LD H +  +  D+L  + +GE+ + + 
Sbjct: 128 VKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLT 187

Query: 181 ------LAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234
                  + +   + +  S +H Y  +Y+ G V + DL   V+D  +++LL+  +  +  
Sbjct: 188 GPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDY 247

Query: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294
             Y   H+E IQ + ++PY EF+ER C+ AFG  + L+E L D  LVG +  EL DWLV 
Sbjct: 248 LGYFLAHLEPIQTECVEPYQEFIERLCEDAFGK-EKLQESLTDHFLVGSMDEELRDWLVY 306

Query: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQR-----CTGNXXXXXXXXX 349
           S+GE+NL+ W+ L   AY +T QV+ +  +P  ERLI L ++      T           
Sbjct: 307 SLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDS 366

Query: 350 XXXXXXIDCL---QFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLH 406
                  D L   Q  L+ VL+ +  L+   + +  FL W ++ ++ +I++DY   FN+ 
Sbjct: 367 LEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVS 426

Query: 407 DNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILI-DALTSKI 462
           +    G    S L L L  +    +   +    +    D +  +D++ + D L SK+
Sbjct: 427 ECGKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKV 483

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  230 bits (587), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/464 (29%), Positives = 243/464 (52%), Gaps = 28/464 (6%)

Query: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64
           Y   NP+Y LY  +  +G ++  ++D + +ATI ++D S V  + WD ITGKFL   + D
Sbjct: 11  YYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFND 70

Query: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHS-EENIKDWSIDHDVTEMMPKMV 123
           G++R+YD F+ GRLVS  R+         WDRI +  + ++ +K +  D+D+T  MP +V
Sbjct: 71  GSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIF--DYDLTNSMPTLV 128

Query: 124 KFARDSRQLCVVPYTLPSDVWRPQAAD------------DTNALLDAHVIRCH---DSLS 168
           KF +D + L +VP    +  WR    D             T+ +LD H++      D+ +
Sbjct: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFA 188

Query: 169 VMFDGEFTIS-IQLAA-IPSPLVKFVSA-QHQYLAFYQDGSVERFDLANLVKDPFSLRLL 225
           V+ +G + +S I +    P+ ++K V A Q +YL FY++ S    D+     +   + LL
Sbjct: 189 VLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRVNLL 248

Query: 226 KNVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVT 285
            N I +R     L++ IE+I+++L+ P++ F+   C  A+ GYD L   + +L+L G+++
Sbjct: 249 NNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEIS 308

Query: 286 PELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG------ 339
            E EDWL+N++GE+NL++W+ LG +   K +Q+L+L  +P  E+ I   +R         
Sbjct: 309 EEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYITAMR 368

Query: 340 -NXXXXXXXXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDED 398
            +               I  L   LK  ++ I  L++ +     F+DW  + +   IDE+
Sbjct: 369 LSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYLIIDEN 428

Query: 399 YKLRFNLHDNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLAS 442
           YK + +L  ++S   D   Y+ L+ ++ +    +V D   + A+
Sbjct: 429 YKSKLSLSSSNSYPFDIQKYINLQFKDHNKAILTVVDEFETYAN 472

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  217 bits (552), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 140/478 (29%), Positives = 243/478 (50%), Gaps = 38/478 (7%)

Query: 1   MDQDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSI 60
           + ++ V YNP YP  + + + GF+V R  DD +I  I++R+M  V    W+     +L++
Sbjct: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63

Query: 61  FYKDGTVRIYDGFRSGRLVSLLR---ASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTE 117
            + DG+ RI+D FR G+L++LLR          +GIW ++E+    +   +   D D++ 
Sbjct: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEV---RQKPNEGEFDRDISG 120

Query: 118 MMPKMVKFARDSRQLCVVPYTLPSDVWRP-QAADDTNALLDAHVIRCHDSLS----VMFD 172
           +MP  +KF  ++ QL VVPY +    WR      + N ++D H+   H+S +    +M +
Sbjct: 121 LMPSPIKFVNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHM--AHNSNTDEYLLMIN 178

Query: 173 GEFTISIQLAAI----PSPLVKFVSAQHQ--YLAFYQDGSVERFDLANLVKDPFSLRLLK 226
           G + ++IQ  +      + L K +  +    +  FY+D      DL  L++    + LL 
Sbjct: 179 GVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLN 238

Query: 227 NVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTP 286
            +  M+QLHRY+ DH+++I  DL +P D+FLE          D L + L   +L G +  
Sbjct: 239 VLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKD-LSKSLKSFILYGLMAK 295

Query: 287 ELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXX 346
            L  WL N +GEKNLK+W++L    Y K +Q+++LA LPA E+L  L  RC         
Sbjct: 296 SLNHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEA----LVV 351

Query: 347 XXXXXXXXXIDCLQFF--LKNVLEAIAS--------LSSQQRLLGSFLDWFDDRVRESID 396
                    +  L++F  LK    A+ +         S +++    F+ W  D + E +D
Sbjct: 352 AIALPASGHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVD 411

Query: 397 EDYKLRFNLHDNSSLGPDTASYLQLRLRNSSPEFSS-VSDLTHS-LASTTDCVSSLDS 452
           EDY  + N+ ++ S+ P     +    ++++ E S+  +DL+ + L S +D + ++DS
Sbjct: 412 EDYVPKLNICEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDS 469

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  200 bits (509), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/424 (29%), Positives = 214/424 (50%), Gaps = 39/424 (9%)

Query: 8   YNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTV 67
           +NPV  L++    +G +V+R  D  RIAT+ V+D   +  YQW+   G+  ++ + +G +
Sbjct: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79

Query: 68  RIYDGFRSGRLVS--LLRASSNGAVSGIW--DRIELLHSEENIKDWSIDHDVTEMMPKMV 123
           R+YD   +G+ V   +L  S    +   W  D         N+     DH++T +MP++V
Sbjct: 80  RLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNV----FDHEITSLMPRLV 135

Query: 124 KFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISIQLAA 183
           KF +DSRQL ++P  +   V R    D   + +          + +  DG F +S  +AA
Sbjct: 136 KFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAA 195

Query: 184 -------------IPSPLVKFVSAQH-QYLAFYQDGSVER--FDLANLVKDPFSLRLLKN 227
                        +P+ +   +   + +YL    D  +++  FD  N      +  ++  
Sbjct: 196 LVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNC---NLTREMISC 252

Query: 228 VITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPE 287
              +R LH+ L + + L++ +L++PY +F+ER   GA+ G DL+ + L +L+  G V PE
Sbjct: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVL-GAYEG-DLIGD-LTELLFTGSVPPE 309

Query: 288 LEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXX 347
           LEDWL N++G+KNL+RW+KL +  Y   ++++ L  +P CERLI  G+R  G        
Sbjct: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLI 369

Query: 348 XXXXXXXXIDCL---------QFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDED 398
                   ++ L         Q  L+N++ +I  ++    L  +F+DWF D V E++DED
Sbjct: 370 GLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429

Query: 399 YKLR 402
           YK +
Sbjct: 430 YKRK 433

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  198 bits (504), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/419 (31%), Positives = 214/419 (51%), Gaps = 29/419 (6%)

Query: 5   YVDYNPVYPLY-VKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYK 63
           ++ YNP Y L+ + +      + R +D+  I  I VR++  +  Y WDPI GK+L++F K
Sbjct: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69

Query: 64  DGTVRIYDGFRSGRLVSLLRA-----SSNGAV--SGIWDRIELLHSEENIKDWSI-DHDV 115
           DG+VRIYD F  G+L+S LR       SN       +WDRI +  S  +  +  I ++D+
Sbjct: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSS--ELRIPNNDL 127

Query: 116 TEMMPKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHV-IRCHDS-LSVMFDG 173
           TE MP +VKF +D++Q+ ++P    + +WR    ++   ++D H+   C  + ++++ +G
Sbjct: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWR-SIGNNEKKVVDVHLGYSCSSAQVTILING 186

Query: 174 EFTISIQLA-------AIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLK 226
           E+ I   ++        IP  L K    +  Y   + D S  + DL  ++ +   L L++
Sbjct: 187 EYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIE 246

Query: 227 NVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTP 286
             I M      ++DH  LI++ +L PY EFLE    G     D+L      L L+G++  
Sbjct: 247 TQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI--GGINDLDVLER----LFLIGELDT 300

Query: 287 ELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXX-X 345
           +L +W   ++ EKNLK+W +LG + Y    QVL +  +P CERL+ L  R  G       
Sbjct: 301 KLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDL 360

Query: 346 XXXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGS-FLDWFDDRVRESIDEDYKLRF 403
                     I  LQ FL  VL+ +A L+  +      FL W  D+V ESI+ +YK  F
Sbjct: 361 QESQETSLLDISELQSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINNEYKSVF 419

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  197 bits (501), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 125/486 (25%), Positives = 231/486 (47%), Gaps = 77/486 (15%)

Query: 9   NPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTVR 68
           NP +PLY+ + +      R  D  +I+ II+R+M  V    WD  TGK+L+I + DGT R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 69  IYDGFRSGRLVSLLRASSN--------GAVSGIWDRIELLHSEENIKDWSIDHDVTEMMP 120
           IYD F+ G+L++L+R   N           + IWDR+ +L+S   I++   +HD+T++MP
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNS---IQELEFNHDITKLMP 144

Query: 121 KMVKFARDSRQLCVVPYTL--PSDVWRP----------------------QAADDTNALL 156
            ++KF +DS  + +VPY+     ++WR                       Q  + +   L
Sbjct: 145 TLIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYL 204

Query: 157 DAHVIRC--HDSLSVMFDGEFTISIQLAAIPS----PLVKFV--SAQHQYLAFYQDGSVE 208
           D H+I     D  ++  +G + I++    I +     +V+ +  +    Y  F+++GS+ 
Sbjct: 205 DLHIIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIR 264

Query: 209 RFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIELIQRDLLQPYDEFLERCC--QGAFG 266
               ++       + LL+  + + ++ +Y Q H++LI + LL+ + +FL      +   G
Sbjct: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324

Query: 267 GYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPA 326
           G + + +QL   +L G+++ EL +WL  S+GEKNLK+W++L  + Y K++Q+ +LA +PA
Sbjct: 325 GGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384

Query: 327 CERLISLGQRC--------------------------------TGNXXXXXXXXXXXXXX 354
           CE  + L Q+C                                                 
Sbjct: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLE 444

Query: 355 XIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPD 414
            I+ LQ F    L+ +  +S  ++    FL W  + +  ++DED+  + + + N  +  D
Sbjct: 445 LIEILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLD 504

Query: 415 TASYLQ 420
            +++L 
Sbjct: 505 LSNFLN 510

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  191 bits (486), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/472 (27%), Positives = 227/472 (48%), Gaps = 20/472 (4%)

Query: 9   NPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTVR 68
           NP  PL + +   G  V R AD + I    +R+ + +  YQW+   G +++IF++ GTV 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 69  IYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128
           IYDG ++ RL+++L        +GIWDR       +N KD   D D+T  MP +++  RD
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDR--YYFPNDNEKDI-FDSDITLYMPTLIQIIRD 129

Query: 129 SRQLCVVPYTLPSDVWRPQAADD-TNALLDAHVIR--CHDSLSVMFDGEFTISIQLAAIP 185
             ++C   Y  P   WR +  +   N  LD H++     DS + + +GE  +     +  
Sbjct: 130 KEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTS 189

Query: 186 SPLVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIEL 244
              +  +  ++  ++ FYQD +V   D  +L++   +  L+ + I +  L +YL++HI  
Sbjct: 190 GRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249

Query: 245 IQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKNLKRW 304
           I+ ++  P++EFL      A    +++ E LI +++ G ++ ELE+W+ N++G KNL RW
Sbjct: 250 IKDNMSTPFNEFLTSVKGEA--TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRW 307

Query: 305 RKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXXXXXXX------XXXXXXXIDC 358
             LG   Y K + ++TL  +PACER + L  R  G                      I+ 
Sbjct: 308 ATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIEN 367

Query: 359 LQF----FLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSSLGPD 414
           ++     F+K  L  +  L  Q++L   FL WF + VR  + ++      L  N +   D
Sbjct: 368 VKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDEAVSGNILVKNVNNCRD 427

Query: 415 TASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILID-ALTSKINIS 465
              YL+  +       + ++     L    + ++ L+   ++ AL+  I+I 
Sbjct: 428 IVEYLEWSMGGGPNRVTELTQFEKELEVVQENLNLLNQDFVEPALSVAISIG 479

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  179 bits (453), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 127/415 (30%), Positives = 194/415 (46%), Gaps = 31/415 (7%)

Query: 6   VDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDG 65
           V +NP   LY+    +  +V+R+ D  +IA + +RD  ++ G QW+    K  ++F  +G
Sbjct: 19  VVWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNG 78

Query: 66  TVRIYDGFRSGRLVSLLRASSNGAVSGI------WDRIELLHSEENIKDWSIDHDVTEMM 119
            VRIYD    G L  ++     G  + +      W  +E     E+ +   +D D+T +M
Sbjct: 79  VVRIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYR--GLDFDITTLM 136

Query: 120 PKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLS----VMFDGEF 175
           P MV+  RDS+QL + P  L    W            DA +   HD  S    V  DG+ 
Sbjct: 137 PGMVRLVRDSKQLSLAPLDLGKLSWL------DGKYGDAAIFLAHDCESTEYMVAIDGQL 190

Query: 176 TISIQLAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLH 235
           ++           +        +LA  +DG+++   L   ++      L+K+   +R L 
Sbjct: 191 SLRFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLC 249

Query: 236 RYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNS 295
           RYL +++ L   +L++PY  FL R   GA+ G DL   +L D++L G +  +LE+WL NS
Sbjct: 250 RYLAENVSLCHTELIEPYRVFLTRL-MGAYEGDDL-ATRLRDILLTGYIPDDLEEWLCNS 307

Query: 296 MGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNXXX----------XX 345
           +G+KN KRW++L T  Y     VLTLA +PACERLI   +R  G                
Sbjct: 308 VGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAG 367

Query: 346 XXXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYK 400
                     I   Q  L+  L  I  L+    L   F +WF D V E++DEDYK
Sbjct: 368 ELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK 422

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  176 bits (446), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 128/416 (30%), Positives = 192/416 (46%), Gaps = 33/416 (7%)

Query: 6   VDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDG 65
           V +NP   LY+    +  SV+R  D  RIA + +R   Q+ G QW+   GK  ++F+ +G
Sbjct: 19  VVWNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNG 78

Query: 66  TVRIYDGFRSGRL---VSLLRASSNGAVS---GIWDRIELLHSEENIKDWSIDHDVTEMM 119
            VRIYD    G L   V L+    +  V+    +W   +     +  K  +I+  +T+ +
Sbjct: 79  AVRIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIE--ITKQL 136

Query: 120 PKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFDGEFTISI 179
           P MV+  RD++QL VVP       W      D  A+   H  +  D L +  DG  ++ +
Sbjct: 137 PGMVRLVRDAKQLSVVPLETGKLRWLADPGKDA-AIFLGHDEKSGDYL-MTVDGLLSVRV 194

Query: 180 QLAAIPSPLVKFVSAQHQ-----YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234
                PS + K      Q     ++    DG+V+   L   +       L++    +R L
Sbjct: 195 -----PSGIKKMHKILRQGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQIRFL 248

Query: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294
             YL ++I + + DL++PY +FL R      GG   L  +  D++L G +  +LEDWL N
Sbjct: 249 CSYLTENINMCKTDLIEPYRQFLTRIADAYEGGE--LASRFRDIILSGYIPEDLEDWLCN 306

Query: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG----------NXXXX 344
           S+G+KN KRW++L T  Y     VL LA +PACERLI   ++  G               
Sbjct: 307 SIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASP 366

Query: 345 XXXXXXXXXXXIDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYK 400
                      I   Q  L   LE +  L+   RL   F DWF D V E++DEDYK
Sbjct: 367 QEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 75/347 (21%), Positives = 138/347 (39%), Gaps = 47/347 (13%)

Query: 23  FSVHRMADDARIATIIVR--DMSQVAGYQWDPITGKFLSIFYKDGTVRIY---------D 71
            S+ R  D  R+  I +R     ++   QW+P  G+  ++  + G+V+IY         +
Sbjct: 35  LSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTE 94

Query: 72  GFRSGRLVS---LLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128
           G     LV    L R  +      +W+RI+    E    ++  D  + + +P++ + +  
Sbjct: 95  GSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGEF--DSPLVQWLPRLTEMSIS 152

Query: 129 SR-QLCVVPYTLPSDVWRPQ-AADDTNALLDAHVIRCHDSLSVMFDGEFTISI-QLAAIP 185
           ++ +L   P       W    AAD++N  L          LS+  DG F     + +  P
Sbjct: 153 AQGKLLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSI--DGTFNFRYGEKSKFP 210

Query: 186 SPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFS-----LRLLKNVITMRQLHRYLQD 240
           + +   +     +  F  D   E + L  +++  F+       L+K    ++ L +Y++D
Sbjct: 211 TKVTSILPGNENHYVFIND---EDWQL-QVIRLEFTEYHQVHELMKCCSHIQFLLKYIRD 266

Query: 241 HIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLML-VGDV-------TPELEDWL 292
           +  LI   L++P+           F G     EQ    M  + DV          +E+W 
Sbjct: 267 NHRLIGTKLMEPH---------ATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWF 317

Query: 293 VNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG 339
              +G      W++     +  +  VL    +PACERLI   +R  G
Sbjct: 318 TLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLG 364

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/343 (20%), Positives = 140/343 (40%), Gaps = 41/343 (11%)

Query: 24  SVHRMADDARIATIIVRDMS--QVAGYQWDPITGKFLSIFYKDGTVRIYDGFRS------ 75
           ++ R  D  ++ +I +R  S  ++   Q +P  G   ++  + G+V++Y G +       
Sbjct: 36  NIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDP 95

Query: 76  -------GRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128
                  G +V L R         +W+RI+   S    K    D  +T+ +PK+ +    
Sbjct: 96  TDGADMVGTIV-LGRGEWFNMEQFVWNRIKW-KSRGAFKG-DFDTVLTQWLPKLTEMNVS 152

Query: 129 SR-QLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLS----VMFDGEFTISI-QLA 182
            + +L   P       W    +++     ++++   +D+ +    V  DG F     +  
Sbjct: 153 PQGKLTCTPLEFEGPEWNASLSEN-----ESNMFLTYDNATRKVMVSIDGTFNFRYGEKN 207

Query: 183 AIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSL-----RLLKNVITMRQLHRY 237
             P+ +   +S       F  D   E + L  ++K  F+       L+K    ++ L +Y
Sbjct: 208 KFPTKVTNILSGNANNYVFLND---EDWQL-QIIKLEFTESHQMHELMKCCSQIQFLMKY 263

Query: 238 LQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVG-DVTPELEDWLVNSM 296
           L+D+ ++I   L++P+  F+             L + L D+  +G      +E+W    +
Sbjct: 264 LRDNHKIIGVKLMEPHATFINSLFPDEQASR--LLKGLKDVFYLGYSAEKNIENWFTLKL 321

Query: 297 GEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG 339
           G   +  W++     +  +  +L    +PACERLI   +R  G
Sbjct: 322 GRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 126/292 (43%), Gaps = 38/292 (13%)

Query: 55  GKFLSIFYKDGTVRIYDGFRSGR-LVSLLRASSNGAVSGIWDRIELLHSEENIKDWSI-D 112
           G  L   Y  GTV IY   R GR LV  L     GA +       L+ S++    +S+ D
Sbjct: 68  GNDLFCCYNSGTVSIY---REGRELVKQLTFIPKGAKTKCILCDNLVPSDDR---YSLSD 121

Query: 113 HDVTEMMPKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFD 172
            ++   MPK+ K+     +L      L S++ + +  D   A+ D+      + L +  +
Sbjct: 122 GNLLNSMPKLNKWDMIKNEL-DNELILNSELGKKKPIDIFMAI-DSKT----NKLILSIE 175

Query: 173 GEFTISI-QLAAIPSPLVKFVS-AQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVIT 230
           G   I + +   +P  + + +  +  +Y+   +D S +  DL   ++DP   +L+K    
Sbjct: 176 GTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLT-FLQDPNIYKLIKTTQE 234

Query: 231 MRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQ----LIDLMLVG---- 282
              L RYL+     ++  L +PY EF+E           LL+E+    L +L  +G    
Sbjct: 235 YSALLRYLKQLHRHLRMKLTEPYFEFVE----------TLLKEEHKNALQELFYIGVTKL 284

Query: 283 DVTPELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLG 334
           +V  EL +  + +     L +W  L  D    ++ ++    +P  ER+I L 
Sbjct: 285 EVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLA 333

>KLLA0B12848g Chr2 (1122397..1123482) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q03175 Saccharomyces cerevisiae YMR101C SRT1
           Cis-prenyltransferase involved in dolichol synthesis and
           weakly similar to YBR002C uniprot|P35196 Saccharomyces
           cerevisiae YBR002C RER2 Cis- prenyltransferase involved
           in dolichol synthesis; participates in endoplasmic
           reticulum (ER) protein sorting
          Length = 361

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 32/144 (22%)

Query: 356 IDCLQFFLKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRF------------ 403
           +    F ++N   +   +++   LLG ++D F +R   + DE Y +R             
Sbjct: 128 VSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATNAKDELYGIRLRVVGDLSLLSEE 187

Query: 404 ------NLHDNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTD-CVSSLDSILID 456
                 N    +  G +   YL L        ++S +D+ HS+  TTD C++S + I   
Sbjct: 188 LLKKIRNAEKLTRDGQEFVLYLAL-------PYTSRNDIAHSMQVTTDKCINSNEDITEQ 240

Query: 457 ALTSKINISHEAHNKMNDIFCDLM 480
           ALT  +     ++       CDL+
Sbjct: 241 ALTDNMYFEQYSNK------CDLL 258

>CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 aa]
            {ON} similar to uniprot|P38873 Saccharomyces cerevisiae
            YHR186c
          Length = 1527

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 11/75 (14%)

Query: 51   DPITGKFLSIFYKDGTVRIYDGFRSGRLVSLLRASSNGAVSGIW---------DRIELLH 101
            D + G      + DGT+R+YD     RL  + R    G   G W            EL+ 
Sbjct: 1326 DQVAGNIFVAGFSDGTIRVYDRRTDPRLAMVRRWRGGGGKPGAWINNVHMQRGGYRELVS 1385

Query: 102  SEEN--IKDWSIDHD 114
               N  ++ W I HD
Sbjct: 1386 GSTNGVVELWDIRHD 1400

>Kpol_1066.5 s1066 complement(6994..8487) [1494 bp, 497 aa] {ON}
           complement(6994..8487) [1494 nt, 498 aa]
          Length = 497

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 168 SVMFDGEFTISIQLAAIPSPLVKFVSAQHQYLAFYQDGSVERFD------LANLVKDPFS 221
           S ++  E  I  +L    +P VK +  ++Q +A + + S+   D        N V   FS
Sbjct: 153 STLYQSEEVIDPKLRKSSTPFVKSIIPRYQSMADFIECSISSTDQKSVSSFINEVTTFFS 212

Query: 222 -LRLLKNVITMRQLHRYLQDHIEL----IQRDLLQPYDEF 256
            L+  K V+T RQ    L+ H++     I    L+P+  F
Sbjct: 213 RLKYSKKVVTSRQFKESLEQHLQKFELQITEMFLKPFQLF 252

>Skud_8.169 Chr8 (302088..303842) [1755 bp, 584 aa] {ON} YHR108W
           (REAL)
          Length = 584

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 436 LTHSLASTTDCVSSLDSILIDALTSKIN------ISHEAHNKMNDIFCDLMDLTVIKTNN 489
           L  S  + T+ ++ +D   +D   S++N       S  A +  ND+ CDL DL++  T +
Sbjct: 339 LQQSSGALTNEINLIDFNDLDETPSQVNNTNGAGTSAGAESSANDLLCDLTDLSISNTPS 398

Query: 490 PTGTATGLENGLIL 503
              T+ GL   ++L
Sbjct: 399 AAQTSFGLGGDIVL 412

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 30/123 (24%)

Query: 13  PLYVKQFT-RGFSVHRMADDARIATIIVRDMSQ----------VAGYQWDPITGKFLSIF 61
           P+Y   ++ RGF V   + D  +    +R  +Q          V+G +++   GKFL   
Sbjct: 351 PIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSC 410

Query: 62  YKDGTVRIYDG----------FRSGRLVSLLRASSNGA-VSGIWDRIELLHSEENIKDWS 110
             D  + +Y G            + ++++L   + +G+ VS  WDR        ++K W+
Sbjct: 411 GYDKNINVYSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDR--------SVKSWN 462

Query: 111 IDH 113
           +D+
Sbjct: 463 VDN 465

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,380,661
Number of extensions: 2429998
Number of successful extensions: 7120
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7243
Number of HSP's successfully gapped: 34
Length of query: 599
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 484
Effective length of database: 40,294,809
Effective search space: 19502687556
Effective search space used: 19502687556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)