Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0C01430g8.272ON59059028690.0
TDEL0F039908.272ON63158518740.0
SAKL0H16808g8.272ON65759717880.0
Kpol_543.448.272ON64359717820.0
KLTH0G13464g8.272ON59359316070.0
KLLA0A04631g8.272ON57958716030.0
Kwal_56.237548.272ON58960015680.0
TPHA0A017508.272ON63660215470.0
AGR076C8.272ON68651014500.0
TBLA0F030408.272ON90659214350.0
Kwal_26.6669singletonON59054013271e-177
Ecym_42988.272ON67861110591e-136
KLLA0F17776gna 1ON5535237801e-95
SAKL0C02178gsingletonON5655647713e-94
SAKL0E04246gna 1ON5655627495e-91
YDR119W (VBA4)8.272ON7685014717e-50
Kwal_26.6697singletonON5775524585e-49
Suva_4.553na 2ON5625484498e-48
Skud_2.423na 2ON5605244462e-47
TDEL0C00120singletonON5695384374e-46
Skud_4.3798.272ON7594904444e-46
TDEL0A024902.473ON5544884347e-46
Smik_4.3638.272ON7654904373e-45
NCAS0A078102.473ON5685814294e-45
KLTH0E16720gsingletonON5745394294e-45
CAGL0J01375g2.473ON5645044199e-44
KNAG0E025602.473ON5784914121e-42
Suva_2.2798.272ON7755354134e-42
NDAI0H022002.473ON5714604075e-42
ZYRO0G03234g2.473ON5624684058e-42
Smik_13.2722.473ON5614863995e-41
SAKL0A07480gsingletonON5735363989e-41
TPHA0G031502.473ON6005433874e-39
YMR088C (VBA1)2.473ON5624683854e-39
Skud_13.2442.473ON5625463837e-39
SAKL0E02992g2.473ON5704623837e-39
Suva_13.2652.473ON5614653821e-38
YBR293W (VBA2)na 2ON4744683771e-38
KLTH0H05456gna 3ON5685453775e-38
KLLA0F13684g2.473ON5714703723e-37
ZYRO0A00330gsingletonON5765483689e-37
Smik_2.434na 2ON4744583612e-36
Kpol_467.242.473ON3703603518e-36
KLTH0D05434g2.473ON5765033476e-34
Kwal_14.1585na 3ON5704573451e-33
Kwal_26.77552.473ON5594613361e-32
Ecym_73992.473ON5634863174e-30
ABL040W2.473ON5674943165e-30
KLTH0B10142gsingletonON5684972519e-22
ZYRO0G21868gna 3ON6201642464e-21
ZYRO0G21890gsingletonON5761142429e-21
KLTH0B00132gsingletonON5684932232e-18
SAKL0A00726gsingletonON5984832215e-18
TDEL0G03260singletonON6124842126e-17
NDAI0J012808.272ON6945372063e-16
KNAG0K01020singletonON5995111982e-15
KLTH0D16962gsingletonON5714711965e-15
Kwal_14.728singletonON5684541947e-15
Smik_11.368singletonON5804971903e-14
Skud_16.503singletonON5434721893e-14
KLTH0B00594gsingletonON6184921877e-14
CAGL0B02079gna 4ON6241711842e-13
YKR105C (VBA5)singletonON5825501832e-13
Smik_17.11singletonON5444571813e-13
YPR198W (SGE1)singletonON5435111795e-13
KLTH0C10142gsingletonON5734371795e-13
KLTH0C10120gsingletonON6511711771e-12
Kwal_26.9616singletonON5623361771e-12
SAKL0B12716gsingletonON6325081742e-12
KLLA0D19941gsingletonON6114921715e-12
SAKL0C05588gsingletonON6771771725e-12
NCAS0C03460na 4ON6304521715e-12
Skud_18.3singletonON5904831691e-11
Smik_16.81na 4ON6255061681e-11
Smik_6.22singletonON6365671653e-11
SAKL0A08228gsingletonON5691931643e-11
SAKL0F00198gsingletonON5375081617e-11
Skud_6.14singletonON6364751601e-10
KLLA0E09879gsingletonON6305451554e-10
KLTH0D18150gsingletonON6074441511e-09
Skud_7.560na 4ON6421671502e-09
Kwal_56.22298singletonON6104431466e-09
KLTH0B00110gsingletonON6274461449e-09
Skud_18.6singletonON6104931403e-08
CAGL0I07447g3.84ON5702121377e-08
TPHA0A006203.84ON6342311323e-07
Kpol_1053.243.84ON6202101297e-07
SAKL0C11066gsingletonON5802331242e-06
KNAG0K006303.84ON6182151233e-06
YGR224W (AZR1)na 4ON6131921224e-06
KLLA0D19945gsingletonON6444361216e-06
CAGL0E04092gna 5ON6454451216e-06
Suva_10.9singletonON6375111199e-06
TDEL0G05000singletonON1861571131e-05
Kwal_14.722singletonON6114901181e-05
KLLA0C12309g3.84ON5691491172e-05
NDAI0H00140na 5ON6325061162e-05
KNAG0J02980singletonON6364421162e-05
TBLA0B083103.84ON6382111153e-05
Skud_6.16na 6ON5494131153e-05
AFR343C3.84ON5712091153e-05
KLLA0A10439gsingletonON6344631153e-05
NCAS0I025203.84ON5872251143e-05
ZYRO0A01474g2.242ON5382301134e-05
Suva_9.712.241ON5612101117e-05
NCAS0C047603.84ON6072331127e-05
Smik_6.24na 6ON5444281117e-05
YIL120W (QDR1)2.242ON5632161118e-05
TPHA0K02330singletonON6312201118e-05
TDEL0D06610singletonON4974081101e-04
KAFR0C014803.84ON5771531101e-04
TDEL0H01600singletonON6041231101e-04
Skud_8.3na 5ON6314321091e-04
KNAG0E01160singletonON5722281091e-04
YOL103W (ITR2)3.84ON6092221091e-04
ZYRO0B06688g3.84ON5932381092e-04
ZYRO0G07414gsingletonON7074401092e-04
Smik_8.1na 5ON6274431092e-04
Suva_13.4678.843ON5431091082e-04
Smik_15.543.84ON6111291072e-04
Kpol_1003.112.241ON5811911072e-04
KNAG0H031808.272ON677781072e-04
NDAI0A071103.84ON6021291073e-04
KLTH0G00198gna 5ON4582191063e-04
YHL040C (ARN1)na 5ON6274601073e-04
YCL073C (GEX1)singletonON6154641073e-04
TDEL0D054003.84ON5851491073e-04
Suva_8.12na 5ON6334401073e-04
Skud_13.258.843ON537761063e-04
Suva_15.623.84ON6092241063e-04
Skud_15.513.84ON5871291063e-04
TBLA0C01040singletonON6694401064e-04
Smik_21.4singletonON6052871055e-04
Kpol_541.168.843ON5283031046e-04
TBLA0E038002.242ON6082011046e-04
Kwal_26.7984na 7ON6121191046e-04
KLTH0G11154gna 8ON5721271046e-04
SAKL0C09350g3.84ON5782131037e-04
KAFR0J009302.242ON5661741038e-04
KLTH0C09372g3.84ON6081491039e-04
Kwal_27.102458.843ON5153531020.001
NCAS0G029902.242ON5812281020.001
CAGL0G08624g2.242ON5832171020.001
KAFR0B054508.272ON6252701020.001
YKR106W (GEX2)singletonON6154641020.001
Kwal_23.48142.241ON5292211010.001
TPHA0C047908.843ON556791010.001
KLTH0G09504gna 9ON6242191010.001
TDEL0C045802.241ON5572371010.001
Kwal_56.227243.84ON5781521010.001
KNAG0I019102.242ON5981751010.001
TDEL0B005508.843ON537901000.001
Smik_4.7743.84ON5841501010.002
SAKL0F00792gsingletonON6174591000.002
TBLA0E01970singletonON5781341000.002
TPHA0C031002.241ON6021451000.002
Suva_13.278.843ON553317990.002
TBLA0D03280singletonON58076990.002
Suva_26.1singletonON534122990.002
KLTH0G09350g2.241ON563145980.003
TBLA0F00470singletonON732113980.003
NDAI0B037702.242ON571168980.003
TDEL0H04480na 8ON570125980.003
YHL047C (ARN2)singletonON62081970.005
KAFR0I01560singletonON632442960.005
KAFR0B039408.843ON547426960.005
Suva_4.2singletonON570150960.005
KNAG0E01170singletonON573174960.005
Smik_14.2622.242ON561174960.006
Skud_14.2672.242ON562172950.007
TBLA0H00750singletonON484161940.008
KLTH0D06710gna 7ON611118940.009
YNL065W (AQR1)2.242ON586172940.009
SAKL0E06864gna 8ON573127940.009
NCAS0B037808.272ON589209940.010
Ecym_7258na 7ON638164940.010
Suva_10.11singletonON540415930.011
NDAI0D010202.242ON592172930.011
SAKL0G06600gsingletonON62981930.012
KLLA0E09021gna 8ON56698930.013
Smik_13.188.843ON545122930.013
Skud_9.482.241ON599203930.014
Suva_2.6743.84ON579150920.015
YML116W (ATR1)8.843ON54275920.015
SAKL0F00440gsingletonON544237920.016
YDR497C (ITR1)3.84ON584150920.016
YOL158C (ENB1)singletonON606119920.017
TBLA0E037902.241ON550170920.017
TBLA0D032708.843ON55079910.019
TPHA0B00180singletonON633545910.020
KAFR0J016202.242ON570220910.023
KLTH0G18854g8.22ON50271900.024
NCAS0B064802.241ON587270900.024
Kpol_543.55.469ON566127900.029
Kpol_416.5singletonON607223890.033
CAGL0H06017gsingletonON557105890.034
Suva_14.2762.242ON562172890.037
CAGL0J09944g2.242ON59295890.038
YOR378Wna 10ON51550890.039
Skud_4.7713.84ON584182890.041
ABL210CsingletonON478116880.041
AGL069Cna 7ON594165890.042
Skud_15.545na 10ON51650880.042
Smik_15.560na 10ON51650880.045
TBLA0F01600singletonON567154880.046
Kpol_416.6singletonON597512880.047
Kwal_23.5241na 11ON591466880.051
SAKL0D01386g8.843ON52148880.052
KLLA0C18931gna 12ON55381880.053
Kpol_495.213.109ON108584880.058
TDEL0B019008.446ON687168870.058
YMR279C8.843ON54089870.059
TBLA0C01160singletonON60079870.061
Klac_YGOB_Anc_2.2412.241ON602198870.065
KAFR0K00100singletonON529144870.070
CAGL0B02343g8.843ON53782860.072
Smik_11.369singletonON16884830.075
KLLA0F03311g2.242ON542118860.080
Smik_9.492.242ON542209860.087
Suva_9.702.242ON565202850.095
Smik_9.482.241ON591206850.10
TDEL0C045902.242ON529172850.11
Kpol_513.33singletonON626247840.14
Skud_5.24na 13ON62778840.14
KLTH0C10560gna 10ON515418840.14
Kpol_358.4na 13ON61786840.16
Kwal_47.18976na 14ON534227830.17
Suva_5.2na 13ON627464830.19
Suva_8.435na 10ON51550830.20
SAKL0H12518g8.446ON730168830.20
TDEL0H00130singletonON62178830.21
TDEL0A033305.469ON549127820.22
KLTH0G09372g2.242ON551175820.23
YIL121W (QDR2)2.241ON542139820.24
KAFR0B03930singletonON55588820.28
Smik_5.22na 13ON62878820.28
SAKL0C12122gna 11ON61182820.28
KLLA0C19272gsingletonON62381810.30
NCAS0C036002.242ON572206810.31
TDEL0B039906.155ON48194810.33
TBLA0A04910singletonON575208810.34
KLLA0B14861gsingletonON587127810.36
TBLA0G025502.242ON613170810.36
Kwal_23.6547na 10ON51150800.37
KLTH0H16214gsingletonON55156800.40
KNAG0C046205.469ON546195800.42
KAFR0C02660singletonON591295800.43
KNAG0J002608.843ON550266800.44
Kwal_23.48242.242ON55395790.50
Ecym_6024na 15ON489216790.51
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0C01430g
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...  1109   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   726   0.0  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   693   0.0  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   691   0.0  
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   623   0.0  
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   622   0.0  
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   608   0.0  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   600   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   563   0.0  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   557   0.0  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   515   e-177
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   412   e-136
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   305   1e-95
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   301   3e-94
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   293   5e-91
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...   186   7e-50
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   181   5e-49
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...   177   8e-48
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   176   2e-47
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        172   4e-46
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   175   4e-46
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   171   7e-46
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   172   3e-45
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   169   4e-45
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   169   4e-45
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   166   9e-44
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   163   1e-42
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   163   4e-42
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   161   5e-42
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   160   8e-42
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   158   5e-41
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   157   9e-41
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   153   4e-39
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   152   4e-39
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   152   7e-39
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   152   7e-39
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   151   1e-38
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...   149   1e-38
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   149   5e-38
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   147   3e-37
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   146   9e-37
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   143   2e-36
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   139   8e-36
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...   138   6e-34
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   137   1e-33
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...   134   1e-32
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   126   4e-30
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...   126   5e-30
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...   101   9e-22
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    99   4e-21
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    98   9e-21
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    91   2e-18
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    90   5e-18
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               86   6e-17
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    84   3e-16
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    81   2e-15
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    80   5e-15
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    79   7e-15
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    78   3e-14
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    77   3e-14
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    77   7e-14
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    75   2e-13
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    75   2e-13
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    74   3e-13
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    74   5e-13
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    74   5e-13
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    73   1e-12
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    73   1e-12
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    72   2e-12
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    70   5e-12
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    71   5e-12
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    70   5e-12
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    70   1e-11
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    69   1e-11
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    68   3e-11
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    68   3e-11
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    67   7e-11
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    66   1e-10
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    64   4e-10
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    63   1e-09
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    62   2e-09
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    61   6e-09
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    60   9e-09
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    59   3e-08
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    57   7e-08
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    55   3e-07
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    54   7e-07
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    52   2e-06
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    52   3e-06
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    52   4e-06
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    51   6e-06
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    51   6e-06
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    50   9e-06
TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON}                48   1e-05
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    50   1e-05
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    50   2e-05
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       49   2e-05
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              49   2e-05
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    49   3e-05
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    49   3e-05
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    49   3e-05
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    49   3e-05
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    49   3e-05
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    48   4e-05
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    47   7e-05
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      48   7e-05
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    47   7e-05
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    47   8e-05
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              47   8e-05
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    47   1e-04
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    47   1e-04
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    47   1e-04
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    47   1e-04
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               47   1e-04
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    47   1e-04
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    47   2e-04
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    47   2e-04
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    47   2e-04
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    46   2e-04
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    46   2e-04
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    46   2e-04
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    46   2e-04
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    46   3e-04
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    45   3e-04
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    46   3e-04
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    46   3e-04
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    46   3e-04
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    46   3e-04
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    45   3e-04
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    45   3e-04
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    45   3e-04
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               45   4e-04
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     45   5e-04
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    45   6e-04
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    45   6e-04
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    45   6e-04
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    45   6e-04
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    44   7e-04
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    44   8e-04
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    44   9e-04
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    44   0.001
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    44   0.001
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    44   0.001
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    44   0.001
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    44   0.001
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    44   0.001
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    44   0.001
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    44   0.001
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    44   0.001
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    44   0.001
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    44   0.001
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    43   0.001
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    44   0.002
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    43   0.002
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    43   0.002
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    43   0.002
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    43   0.002
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    43   0.002
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        43   0.002
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    42   0.003
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               42   0.003
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    42   0.003
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    42   0.003
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    42   0.005
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      42   0.005
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    42   0.005
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       42   0.005
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               42   0.005
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    42   0.006
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    41   0.007
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    41   0.008
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    41   0.009
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    41   0.009
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    41   0.009
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    41   0.010
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    41   0.010
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    40   0.011
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    40   0.011
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    40   0.012
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    40   0.013
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    40   0.013
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    40   0.014
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    40   0.015
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    40   0.015
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    40   0.016
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    40   0.016
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    40   0.017
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    40   0.017
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    40   0.019
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       40   0.020
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    40   0.023
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    39   0.024
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    39   0.024
Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON} ...    39   0.029
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    39   0.033
CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {...    39   0.034
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    39   0.037
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    39   0.038
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    39   0.039
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    39   0.041
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    39   0.041
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...    39   0.042
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    39   0.042
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    39   0.045
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    39   0.046
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    39   0.047
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    39   0.051
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    39   0.052
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    39   0.053
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    39   0.058
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    38   0.058
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...    38   0.059
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    38   0.061
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    38   0.065
KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON}      38   0.070
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...    38   0.072
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    37   0.075
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    38   0.080
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    38   0.087
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    37   0.095
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    37   0.10 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    37   0.11 
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    37   0.14 
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    37   0.14 
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    37   0.14 
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    37   0.16 
Kwal_47.18976 s47 (1049766..1051370) [1605 bp, 534 aa] {ON} YKL2...    37   0.17 
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       37   0.19 
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    37   0.20 
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    37   0.20 
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       37   0.21 
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    36   0.22 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    36   0.23 
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    36   0.24 
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    36   0.28 
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    36   0.28 
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    36   0.28 
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    36   0.30 
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    36   0.31 
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    36   0.33 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    36   0.34 
KLLA0B14861g Chr2 complement(1305927..1307690) [1764 bp, 587 aa]...    36   0.36 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.36 
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    35   0.37 
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    35   0.40 
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    35   0.42 
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}               35   0.43 
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    35   0.44 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    35   0.50 
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    35   0.51 
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               35   0.56 
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    35   0.57 
TDEL0C00450 Chr3 (65197..66762) [1566 bp, 521 aa] {ON} Anc_8.22 ...    35   0.61 
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843       35   0.62 
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               35   0.63 
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        35   0.63 
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...    35   0.65 
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...    35   0.77 
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    35   0.78 
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    35   0.78 
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    35   0.87 
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...    34   0.88 
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    34   0.94 
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...    34   0.95 
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    34   0.98 
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    34   1.0  
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    34   1.1  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                34   1.1  
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    34   1.1  
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    34   1.1  
AFR333W Chr6 (1041317..1042819) [1503 bp, 500 aa] {ON} Non-synte...    34   1.1  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 34   1.3  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    34   1.3  
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               34   1.3  
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    34   1.3  
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    34   1.4  
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    34   1.4  
CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} simil...    34   1.5  
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    33   1.5  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...    33   1.5  
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    33   1.5  
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    33   1.5  
CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {...    33   1.5  
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    33   1.6  
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               33   1.6  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                33   1.7  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    33   1.8  
KLTH0G02024g Chr7 complement(156778..158406) [1629 bp, 542 aa] {...    33   1.9  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               33   1.9  
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      33   1.9  
YOR306C Chr15 complement(889867..891432) [1566 bp, 521 aa] {ON} ...    33   2.0  
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    33   2.1  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   2.1  
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    33   2.1  
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    33   2.2  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    33   2.2  
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    33   2.3  
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    33   2.6  
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    33   2.6  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    33   2.7  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    33   2.8  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    33   2.9  
Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON...    33   2.9  
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    33   3.0  
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    33   3.1  
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     33   3.1  
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    33   3.2  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    32   3.4  
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    32   3.6  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    32   4.2  
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    32   4.2  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    32   4.5  
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    32   4.8  
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    32   4.8  
KAFR0C00180 Chr3 (24352..26028) [1677 bp, 558 aa] {ON}                 32   5.0  
Suva_8.358 Chr8 complement(630597..632165) [1569 bp, 522 aa] {ON...    32   5.3  
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    32   5.3  
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    32   5.4  
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    32   5.4  
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    32   5.8  
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    32   6.2  
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    32   6.3  
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    32   6.8  
SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {...    32   7.1  
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    32   7.4  
KAFR0J02120 Chr10 (406812..408752) [1941 bp, 646 aa] {ON}              32   7.4  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         31   7.5  
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    31   7.7  
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    31   7.7  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    32   7.7  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    31   7.8  
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    31   7.8  
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     31   8.1  
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    31   8.5  
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    31   9.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                 31   9.3  
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               31   9.4  
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    31   9.6  

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 1109 bits (2869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/590 (93%), Positives = 549/590 (93%)

Query: 1   METNNSKNDLTSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDN 60
           METNNSKNDLTSRTNFLNPVRDDILQDASTDIPGFVA            CQGTDYGSIDN
Sbjct: 1   METNNSKNDLTSRTNFLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDN 60

Query: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120
           EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA
Sbjct: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120

Query: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXX 180
           TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFIS   
Sbjct: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISGIG 180

Query: 181 XXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
              VTSMCSITISDIVPLRDRALYQGMCNFFFGLGTAC      WFSDHGGGWRMAFLIQ
Sbjct: 181 GGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWRMAFLIQ 240

Query: 241 VPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGG 300
           VPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIG                 GG
Sbjct: 241 VPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVTASLGG 300

Query: 301 KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMA 360
           KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMA
Sbjct: 301 KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMA 360

Query: 361 MMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCT 420
           MMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCT
Sbjct: 361 MMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCT 420

Query: 421 LSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISY 480
           LSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISY
Sbjct: 421 LSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISY 480

Query: 481 AFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSA 540
           AFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSA
Sbjct: 481 AFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSA 540

Query: 541 PEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590
           PEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN
Sbjct: 541 PEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/585 (62%), Positives = 435/585 (74%), Gaps = 13/585 (2%)

Query: 13  RTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNEDDSRDGVASSP 72
             + L P++ +ILQD STD+PGFVA                 YGSI +  D  D  +  P
Sbjct: 45  EASLLLPIKPEILQDPSTDLPGFVAEEIGQQEEV-----ANGYGSITDPHDG-DNKSERP 98

Query: 73  VPPD------KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLS 126
           V         +L VI LSMYLGIFLAA D T+VST  AH+ASEFN+L ++SWIAT+YLLS
Sbjct: 99  VSTAEEISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLS 158

Query: 127 SATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTS 186
           SATFQPLYGK+SDIFGRK LL+  N+ FL+GCLMCGL+ SFW LV ARF++      +TS
Sbjct: 159 SATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTS 218

Query: 187 MCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSAL 246
           M SITI+D+VPLR+RA+YQG+CN F+GLGTAC      WFSD+ GGWRMAFLIQVPLSA+
Sbjct: 219 MSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAI 278

Query: 247 SSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFN 306
           S L+I + +KLP +    N   SIK KLL++DW+G                 GGKEIA+ 
Sbjct: 279 SLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGKEIAYG 338

Query: 307 SKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSY 366
           S+TF  + I S L+C  FI VEL  A DPILPL FL  RSVLGSS SNWFCMMA MTTSY
Sbjct: 339 SRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVLGSSLSNWFCMMATMTTSY 398

Query: 367 YLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH 426
           YLPIY+SGVLNM+PT VGKRLMPNFFS A GSLGAGYYMK+T KYYW ++ FC +++LG 
Sbjct: 399 YLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQ 458

Query: 427 LQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTG 486
           LQI L+ P I TWRQ+ILL++PG G SVLITVALLAMIAAVPH H AATTSISYAFRS G
Sbjct: 459 LQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAATTSISYAFRSAG 518

Query: 487 STLGVSIGGAIFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIR 545
            TLGVSIGGAIFR+SL+ L +R VL++  K HP++ELL+II+KAS+SSEWVH SAP+FIR
Sbjct: 519 CTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAPDFIR 578

Query: 546 PTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590
            TL+ CYH ACK+TFLFC +CSI TL S SIIKE KLH+SLDRK 
Sbjct: 579 QTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLDRKE 623

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/597 (57%), Positives = 427/597 (71%), Gaps = 18/597 (3%)

Query: 11  TSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYG-------------S 57
           T  T FL P+R +++ D ++D+PGFVA             Q    G             +
Sbjct: 48  TETTPFLQPIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTVATAKT 107

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS 117
           ID E  S +   ++ + P ++ +I  SMYLGIFLA+ D T+VST++AHIASEFNE+P IS
Sbjct: 108 IDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHIS 167

Query: 118 WIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFIS 177
           WIATAYLLSSATFQPLYGK+SDIFGRKPLL+ +N++F +GCL+CGL+P  W LV  RFI+
Sbjct: 168 WIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIA 227

Query: 178 XXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAF 237
                 +TSM SIT SDIVPLR+RALYQG+CNFFFGLGTAC      WFS+HGGGWR+AF
Sbjct: 228 GIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWRVAF 287

Query: 238 LIQVPLSALSSLLIAVFMKLPPRSK----RVNSPASIKNKLLSVDWIGXXXXXXXXXXXX 293
           LIQ+PL A+S  LI  +++LP   K    + +    I  KL  +DW G            
Sbjct: 288 LIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLVVFLLLFM 347

Query: 294 XXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS 353
                GGKE+ F S  F ALC+   +  A F+ VE Y +KDPILP++FL+NR++LGSS +
Sbjct: 348 LASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLKNRTILGSSLA 407

Query: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYW 413
           NWF MM MMTTSY+LP+Y++GVLNM PT +GKR +P+FFSTALGSLGAGYYMK+TGKY W
Sbjct: 408 NWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGKYKW 467

Query: 414 LTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA 473
           L + FC L+++G LQI+L++P+IA WRQ+ILLVIPGFG SVLITV LLAMIAAVPH H A
Sbjct: 468 LLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQA 527

Query: 474 ATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKASKS 532
           ATTSISYAFRSTG TLGVSIGGAIFR+SL  LL R V+K A DKHPR+EL +II+ A+ S
Sbjct: 528 ATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHS 587

Query: 533 SEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRK 589
           S+++HDSAPEF+R  LI  YHFAC++T+ FC       L S   +KEYKLH S+DR+
Sbjct: 588 SDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKLHTSMDRQ 644

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/597 (57%), Positives = 432/597 (72%), Gaps = 13/597 (2%)

Query: 2   ETNN-SKNDLTSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDN 60
           ET+  +K D     + L P+RD++LQD ST++PGF+A             +   YG+I++
Sbjct: 48  ETSQLTKED--DENSVLLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRSGHYGAIES 105

Query: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120
              S  G   S     +L +I LSMYLGIFLAA D T+VST++AHIASEFNELPRISW+A
Sbjct: 106 RRISSKGTELSTA---RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVA 162

Query: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXX 180
           TAYLLSSATFQP+YGK+SDIFGRK +L+  NI F VG L+CGL+PSF  LV  RFI+   
Sbjct: 163 TAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIG 222

Query: 181 XXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
              +TSM SIT SDIVPLR+RALYQG+CNF+FGLGTA       WFSD   GWRM+FLIQ
Sbjct: 223 GGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMSFLIQ 282

Query: 241 VPLSALSSLLIAVFMKLPPRSK------RVNSPASIKNKLLSVDWIGXXXXXXXXXXXXX 294
           +P++  S++LI +F++LP  SK        N  ++IK +L +VDWIG             
Sbjct: 283 LPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMI 342

Query: 295 XXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSN 354
               GGKEI + S  F+ LC+ + +    F   EL  AKDPILPL FL++RSVLGSS SN
Sbjct: 343 TASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSN 402

Query: 355 WFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWL 414
           WFCMMA+MT SYYLPIY++GVLNM PT +GKR++PNFFSTA GSLGAGYYMK+TGKYYW 
Sbjct: 403 WFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYWF 462

Query: 415 TVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAA 474
            + FC L+ +G LQI  ++PDI+ ++Q+ L+ IPG G SVLITVALLAMIAAVPHNH A 
Sbjct: 463 VISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAV 522

Query: 475 TTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSS 533
           TTSISYAFRSTG TLGVSIGGAIFR+SL+ LL  KVLKF + +H   EL+ II+KAS+S+
Sbjct: 523 TTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQST 582

Query: 534 EWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590
           EWV +S+P FI+ TLI CYHFACK+ F+FC LC+I    S++IIKE++LH +LDR N
Sbjct: 583 EWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHRLHNTLDRDN 639

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/593 (52%), Positives = 400/593 (67%), Gaps = 20/593 (3%)

Query: 11  TSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGS-----IDNEDDSR 65
           +  +  L PV  D +QD STD+PGFVA             QG  YGS     I +E++  
Sbjct: 4   SEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSENERE 63

Query: 66  D---------GVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI 116
           D         G A   +P  ++L+I  SM+LGIFLAA DGT+VST++ HI SEFN L + 
Sbjct: 64  DAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKA 123

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           SWIAT+YLLSS+T QPLYGKLSD  GRKPLL+ +N VF +GCL+CGL+ S W +V  RFI
Sbjct: 124 SWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFI 183

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA 236
           S      +TS+ ++ +SD+VPLRDRA+YQG+CNF FGLGTA       +F D    WR+A
Sbjct: 184 SGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGAYFRD----WRLA 239

Query: 237 FLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXX 296
           F++Q P+S LS +LI V+++LPPR+   N       +L  +DW G               
Sbjct: 240 FILQCPISVLSGILIVVYLELPPRASASNKDC-WSARLRRLDWAGATSLIAFLFLFMLTS 298

Query: 297 XXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWF 356
             GG  +A+ S+ F A+C  + +  A F+ VEL  A DP+LP++FLR+RSVLGSS +NWF
Sbjct: 299 SMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLGSSLANWF 358

Query: 357 CMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTV 416
           CMM+MMTT++YLP+Y+S VL M  T VGKR MP+FFS A GSLGAG YMKRTGKYY+  +
Sbjct: 359 CMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGKYYYFLL 418

Query: 417 GFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATT 476
            FC L++ G +QI L+ P +  WRQ++L V+PGFG SVLITV LLAMIAAVPH HHAATT
Sbjct: 419 AFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIAAVPHEHHAATT 478

Query: 477 SISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKASKSSEW 535
           SISYAFRSTG+TLGVS+G A+FR SL  LL  KV++FA D H  +EL  II  A++SS+W
Sbjct: 479 SISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSERELRGIIASAARSSDW 538

Query: 536 VHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDR 588
           VH SAP F+R TL+ CYHFA + TF FC    +    S SIIKE+KLH S+ R
Sbjct: 539 VHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEHKLHTSIKR 591

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/587 (54%), Positives = 412/587 (70%), Gaps = 19/587 (3%)

Query: 11  TSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNEDDSRDGVAS 70
           + RT+ L PVR+ +  + S  +P +V                     +++ED++R+G+  
Sbjct: 4   SDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHL-----------LESEDEAREGLQV 52

Query: 71  SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATF 130
           S +   +L +I  SM LG FLAA D T+V+T+++HIASEFNEL  ISWIATAYLLSSATF
Sbjct: 53  SEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATF 112

Query: 131 QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSI 190
           QPLYGK+SDIFGR+PL++++N+ F++GCL+CGL+ + W LV  RFI+      VTS+ SI
Sbjct: 113 QPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSI 172

Query: 191 TISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL 250
           T SDIVPLR RALYQG+ NFFFGLG A       WFS+   GWRMAFL+QVPL A+S +L
Sbjct: 173 TASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMAFLVQVPLCAISLVL 232

Query: 251 IAVFMKLPPRSKRV-------NSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEI 303
           I +F+KLPP  K +       +    IK+KL  +DW+G                 GGKEI
Sbjct: 233 IIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEI 292

Query: 304 AFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMT 363
            +NS  F  L + + L+   FI VELY + DPILP+ FL NRS+LG+SF+NWFCMM+ +T
Sbjct: 293 PYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGASFANWFCMMSGVT 352

Query: 364 TSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSL 423
            ++Y+P+Y+S V N+ PT +GKR+ PNFFSTA GS+GAGYYMK+TG+YY   + F  L +
Sbjct: 353 LAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKFTGLMV 412

Query: 424 LGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFR 483
           LG LQ+ LMKPDI+TWRQ+ILL +P FG SVLITV LLAMIAAVPH H AATTSISYAFR
Sbjct: 413 LGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAATTSISYAFR 472

Query: 484 STGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVHDSAPE 542
           STGSTLGVS+G A+FR  L+G L   V+KF +DK+ ++ LL II++AS+SSE+VH +AP+
Sbjct: 473 STGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPK 532

Query: 543 FIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRK 589
           FI+ TLI CY  ACK TF FC L SI    S  +IKEYKLH S++RK
Sbjct: 533 FIQATLIQCYEQACKSTFAFCFLISIFAWISCGVIKEYKLHTSMERK 579

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/600 (51%), Positives = 399/600 (66%), Gaps = 36/600 (6%)

Query: 12  SRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNED-------DS 64
            RT+FL P+  D++QD ST + GFVA             +  DY S    D       D 
Sbjct: 5   ERTSFLAPIDKDVIQDPSTGLAGFVANEV----------EQQDYNSRTGHDSYGATAVDD 54

Query: 65  RDGVASS---PVPPD----------KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN 111
           R   ++      PP           ++ +I +SM+LGIFLAA DGT+VST++  I SEFN
Sbjct: 55  RTATSARCDLTFPPSETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFN 114

Query: 112 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171
            L ++SWIAT+YLLSS+T QPLYGKLSD  GRKPLL+ +N+VF +GCL+CG++ S W +V
Sbjct: 115 SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVV 174

Query: 172 GARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG 231
             RF+S      +T + S+ ISD+VPLR+RA+YQG+CNF FGLGTA        F D   
Sbjct: 175 VGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--- 231

Query: 232 GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXX 291
            WRMAF IQ P+S  S  LI  +++LPPR +  +      +KL  +DW G          
Sbjct: 232 -WRMAFTIQCPISLASCALIVSYLELPPRHED-DKDRHWTSKLRDLDWAGVVTLVCFLFL 289

Query: 292 XXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSS 351
                  GGKEIA++S  F  LC+ + +  + F  VELY A DP+LP++FL+ RSVLGSS
Sbjct: 290 FMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSVLGSS 349

Query: 352 FSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411
            +NWF MM+M+TT+YYLP+Y++ VLNM PT +GKR +P+FFS A GSLGAG YMKRTGKY
Sbjct: 350 LANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKY 409

Query: 412 YWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNH 471
           YW  + FC + +LG L+INL+ P    W+Q++LLV+P FG SVLITV LLAMI+AVPH H
Sbjct: 410 YWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEH 469

Query: 472 HAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA-DKHPRKELLEIIEKAS 530
           HAATTSISYAFRSTG+TLGVSIG AIFR +LN LL  KVL+FA D+HPR+ELL II  A+
Sbjct: 470 HAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAA 529

Query: 531 KSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRKN 590
            S+ WVH  APEF+R TL+ CYH+A K TF FC +  I   AS SII+E+ LH +L R  
Sbjct: 530 HSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQEHTLHTTLKRDK 589

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/602 (51%), Positives = 401/602 (66%), Gaps = 29/602 (4%)

Query: 13  RTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXC-----QGTDYGSIDNE---DDS 64
           ++  L+ +R ++LQD+S  +PGFVA                  Q  DYGS+ N    D+ 
Sbjct: 26  KSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQHHDYGSVANSIILDND 85

Query: 65  RDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYL 124
           ++ ++     P +L +   SMYLGIFL+A D T+VST++A I SEFNELPRISWIATAYL
Sbjct: 86  KNNLS-----PTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYL 140

Query: 125 LSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXV 184
           LSSATFQPLYGK+SDIFGRK +L   N+ F +GCL+CG   SFW LV  RFIS      +
Sbjct: 141 LSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGI 200

Query: 185 TSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLS 244
           TSM +IT+SDI+PLR+RALYQG+CNF++GLG A       WF++  G WR AFL QVPLS
Sbjct: 201 TSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGSWRGAFLFQVPLS 260

Query: 245 ALSSLLIAVFMKLPPRSKRVNSPASIKN-------------KLLSVDWIGXXXXXXXXXX 291
            +S++ + V+++LP  SK      ++ N             KL ++DW G          
Sbjct: 261 VISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLS 320

Query: 292 XXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSS 351
                  GG +I+  S TF+ L + S  +   FI +EL  AKDPILPL FL++RSVLGSS
Sbjct: 321 FMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPILPLVFLKDRSVLGSS 380

Query: 352 FSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411
            SNWF MM +MT SYYLPIY++ V+ +    VGKR +PNFFS A GSLGAGYYMK+TGKY
Sbjct: 381 LSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGKY 440

Query: 412 YWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNH 471
           YW    FC + ++G LQI L+   I+ WRQ++L  +PG G +VLIT+ALL+MI AVPH +
Sbjct: 441 YWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGAAVLITIALLSMIVAVPHEY 500

Query: 472 HAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADK---HPRKELLEIIEK 528
            A TTSISYAFRSTG TLGVSIG A+FR SLN  L  K+L+   +   +  KELL+II+ 
Sbjct: 501 QAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGNYSEKELLQIIDH 560

Query: 529 ASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDR 588
           ASKS +WVH+ AP F + T++ CYH+ACK  FLFC +CS+  L SIS+IKE+KLH+SLDR
Sbjct: 561 ASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLSISMIKEHKLHSSLDR 620

Query: 589 KN 590
           K 
Sbjct: 621 KE 622

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/510 (57%), Positives = 359/510 (70%), Gaps = 9/510 (1%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           V+  SM LG+FLAA DGT+V+T++ HIASEFNELPRISWIATAYLLSSATFQPLYGKLSD
Sbjct: 141 VVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 200

Query: 140 IFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLR 199
           IFGR+PLL+ +N+VF +G L+CG++ + W LV  RF++      +TSMCSIT +DIVPLR
Sbjct: 201 IFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLR 260

Query: 200 DRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPP 259
            RALYQG+CN FFGLGTAC       F+D   GWRMAFL+QVPL+ LS+  I +F+ LP 
Sbjct: 261 SRALYQGICNVFFGLGTACGGLVGGLFADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK 320

Query: 260 --RSKRVNSPASI--KNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCI 315
              + +     SI    KL  VDW G                  G+++      FV + +
Sbjct: 321 PVDAHKGAGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILL 380

Query: 316 GSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGV 375
             S    +FI  ELY A DPILP+ FL NRSVL +S SNWFCMM MMTT +Y+P+YY+ V
Sbjct: 381 SGS----YFIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASV 436

Query: 376 LNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPD 435
           LNM PT +GKR++P+FFSTA GSLGAGYYMKRTGKYYW  + FC + +LG +QI+ + P 
Sbjct: 437 LNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPS 496

Query: 436 IATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGG 495
           I+TWRQ+ L +IPGFG +VL+TV LLA+I AVP  H AATTSISYAFRSTGSTLGVSIGG
Sbjct: 497 ISTWRQYCLYMIPGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGG 556

Query: 496 AIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHF 554
           AIFR  L+  L  K++   + +HP  ELL IIEKA+ S+EWVH  APEF R  LI CYH+
Sbjct: 557 AIFRNGLSNQLYSKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHY 616

Query: 555 ACKDTFLFCTLCSIGTLASISIIKEYKLHA 584
           A + TF FC  C +    +   I EYKLHA
Sbjct: 617 AGRYTFHFCLACMVLATVACCFIVEYKLHA 646

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/592 (50%), Positives = 391/592 (66%), Gaps = 14/592 (2%)

Query: 3   TNNSKNDLTSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNED 62
           T  + N+L S +  L P+RD+ +QDASTDI GFVA             +  + G      
Sbjct: 318 TGTTNNNLDS-SQILKPIRDEFIQDASTDIAGFVAGELEEIEEEAREAREGEEGEALITS 376

Query: 63  DSRDGVASSPVPPD------KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI 116
            +  G    P+ P       K+ +I  SMYLG+FLAA D T+VST+MAHI SEFN++P++
Sbjct: 377 TASYGTL--PIEPSVEMSNMKMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKV 434

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
            W+AT+YLLSSA FQPLYGKLSDIFGRK LL+ +N++F  GC++CG++ S   LV  RF+
Sbjct: 435 PWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFV 494

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA 236
           +      +TSM +IT+SDIVPLR RA+YQG+CNFFFGLGTA        F DH  GWRM 
Sbjct: 495 AGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMV 554

Query: 237 FLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXX-XXXXXXXX 295
           F  QVP+S LS+LLI  F+ +P R K  N   S+  KL+ VDW+G               
Sbjct: 555 FWSQVPVSGLSTLLICSFLVVP-RIK--NYEVSLGRKLMRVDWLGSISMILWLTSFLLIT 611

Query: 296 XXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNW 355
              GG  +  +S  F  L + SS++   F+  EL+ A DP+LPL FL NRSVLG+S  N+
Sbjct: 612 TMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNF 671

Query: 356 FCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLT 415
           FC+M  MT  +YLPIY++ VL+++PT +GKR+ PNF  TALGSLGAG YMK+TGKYYW  
Sbjct: 672 FCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFV 731

Query: 416 VGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAAT 475
           V F  +S LGH  + L+   ++   Q++L+V+PG G S++I VALLAMIAAVPH H AAT
Sbjct: 732 VLFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAAT 791

Query: 476 TSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSE 534
           TSISYAFRSTG TLGV++G ++F ++L   L   VL++ + +HPRKELL II+KAS S+E
Sbjct: 792 TSISYAFRSTGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTE 851

Query: 535 WVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASL 586
           WVH  AP FIR TLI CY  AC D F+FCT C++    S+++I+E +L   L
Sbjct: 852 WVHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAISLALIREERLATGL 903

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  515 bits (1327), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 259/540 (47%), Positives = 358/540 (66%), Gaps = 17/540 (3%)

Query: 60  NEDDSRDGVAS---------SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110
           N D +R+G  S         S +   ++ +I+ SM+LGIFLAA D T+VST++ HI SE 
Sbjct: 53  NLDKARNGNDSATDFSSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSEL 112

Query: 111 NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL 170
           N++P +S +AT+Y+ S A FQPL+GK SD+FGRKPLL+ +N++F  GCL CGL+ + W L
Sbjct: 113 NDMPNVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWL 172

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHG 230
           +  R ++      +TSMC+I I+DIVPLR+RA+YQG  N F+ LGTAC       FS++G
Sbjct: 173 ILGRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYG 232

Query: 231 GGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXX 290
            GWRMAF+IQ+P   LS++ I V++ L    + +   +S+  KL  +DW+G         
Sbjct: 233 NGWRMAFMIQLPFCFLSTISIIVYLDLSDDKQDLGR-SSLYCKLRLIDWLGALTLVTFLL 291

Query: 291 XXXXXXXXGGKEIAFNSKTFVALCIG---SSLACAFFIGVELYGAKDPILPLSFLRNRSV 347
                   GG+ + + S  F  LC+    S LA A+   VE++ A DPILP+SFLRN++V
Sbjct: 292 LFLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAY---VEIFLANDPILPISFLRNKNV 348

Query: 348 LGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKR 407
           LGSS +NWFCMM MMT +YYLPIY+S V N  P +VGK+ +P+FFS ALGS G  YY+++
Sbjct: 349 LGSSLANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQK 408

Query: 408 TGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAV 467
            G YY L +  C + + G LQI  + P++  WRQ+ILL +PGFG S+LITV LLAMIAAV
Sbjct: 409 NGTYYRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAV 468

Query: 468 PHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEII 526
           PH H AATTS+SYAFR+TG  +G S+ GAIF+ +L   ++  V+KF  D+H +KEL  +I
Sbjct: 469 PHKHQAATTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVI 528

Query: 527 EKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASL 586
           EKA +SS+WV++ +PEF+   L+ CY  AC  TF FC LC + T+ S S I E  L  +L
Sbjct: 529 EKALRSSDWVNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEINLPTTL 588

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  412 bits (1059), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 236/611 (38%), Positives = 342/611 (55%), Gaps = 50/611 (8%)

Query: 16  FLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNED----DSRDGVASS 71
           FL  +  +++QD S+  PGFV              Q    GS  ++     +S  G  S+
Sbjct: 65  FLTRIDKNVIQDTSSGRPGFV--------INKLEVQELSLGSAGSQSTTILNSSYGSTST 116

Query: 72  PVPPD----------------------------KLLVITLSMYLGIFLAAADGTLVSTIM 103
            V PD                            +   I  S+ +G+FL + DGT++ST++
Sbjct: 117 TVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLL 176

Query: 104 AHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL 163
            +IASEF  LP ISWIA +YLLS+  FQPLYGKLSDIFGRK +L+ +N++F +GCL+CG 
Sbjct: 177 DYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGT 236

Query: 164 TPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXX 223
            P+ W L+  RF++      +TSM SI ISDIVPLR RA YQ + N  + LG        
Sbjct: 237 APTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMG 296

Query: 224 XWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPP----RSKRVNSPASIKNKLLSVDW 279
            W +++GG WR+ FL+QV  + +S   I  F+ LP         + +  S+K KL  +DW
Sbjct: 297 GWLAEYGG-WRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDW 355

Query: 280 IGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPL 339
           +G                       F     + + +       +F+  EL  A DPIL +
Sbjct: 356 LGTFCLVIFLASLTLTCSLVDLNFNFLLLLILLMFVSG----YYFVYHELNIAADPILSV 411

Query: 340 SFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSL 399
             L +R+VL SS +N+FCM+  + T +Y+P+Y++ VL M P  +GKR + +F  T++GS 
Sbjct: 412 HLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSF 471

Query: 400 GAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVA 459
           G GYY+KR GKY       C + +LG LQI L+KP I+TWRQ++LL+IP    + + T  
Sbjct: 472 GTGYYIKRRGKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSL 531

Query: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADK-HP 518
           L+++IAAVP+ +  A  SISY FRSTG+ LG S+GG IFR SL  LL+  ++    + HP
Sbjct: 532 LISLIAAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHP 591

Query: 519 RKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIK 578
           + +LL II+KA+ S++WVH  +PE+  P LI CYH+ CK  F F  +C + T  S   +K
Sbjct: 592 KSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLK 651

Query: 579 EYKLHASLDRK 589
           EY +HAS  ++
Sbjct: 652 EYPVHASQPQE 662

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  305 bits (780), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 190/523 (36%), Positives = 280/523 (53%), Gaps = 17/523 (3%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  ++++G +LAA D T+V+T++  IASE +   ++SWIAT+YLLS + FQPLYGKLSD+
Sbjct: 34  IVFALFVGSYLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 141 FGRKPLLMLNNIVFLVGCLMCG--LTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           FGRKPLL+ +N+ F  GC++CG   T S W L   RFI+      + S+ +IT SDI+PL
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPL 153

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLP 258
           R R +YQGM N  F LG A        F     GWR AFL QVPLS LS  LI  F+ LP
Sbjct: 154 RQRGVYQGMGNIVFALGCASGSLIGA-FLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLP 212

Query: 259 PRS------KRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA 312
             S         N   +  +    VD+ G                           T+  
Sbjct: 213 AGSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWAL 272

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFL-RNRSVLGSSFSNWFCMMAMMTTSYYLPIY 371
             +G +LA   F+  EL    +P++P+  L  NR+VL SS +NWF  M+    +YY+P++
Sbjct: 273 FIVGLALAGYTFVSTEL-SVHNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVF 331

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL 431
           +  V ++ P  +G R + NFF  A+GS+  G YMKRTGKY  L+    T+++ G L + L
Sbjct: 332 WQTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYL 391

Query: 432 --MKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTL 489
                +     ++ +L +PG GY+ ++T+ LL++IA+V  +H A  TSI YAFR+ GSTL
Sbjct: 392 STYNTEPKGLLEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGSTL 451

Query: 490 GVSIGGAIFRQSLNGLLSRKVLK---FADKHPRKELLEIIEKASKSSEWVHDSAPEFIRP 546
           GVS  G I++  L   L R +++     DK+   +L +  +   +++ +     P     
Sbjct: 452 GVSFAGLIYQSKLQTSLLRNIVENKTLNDKYSTHQLRKWCQTLLENNSFDVSFDPLLESL 511

Query: 547 TLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLHASLDRK 589
             I  +    +    F  L SI  L S   I+E+ LH  + R+
Sbjct: 512 AKIS-FQGGSRLVLGFAVLASILGLLSSLFIREHVLHTDIQRR 553

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  301 bits (771), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 199/564 (35%), Positives = 302/564 (53%), Gaps = 42/564 (7%)

Query: 53  TDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE 112
           T+   +D  ++S    + S +PP K+ +  L++ +G FL+A D T+V+T++  IAS+ + 
Sbjct: 17  TETALVDTGEEST--TSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDA 74

Query: 113 LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG--LTPSFWGL 170
             ++SWIATAYLLS + FQPLYGKLSDIFGRK LL+L+N+ F +GC +CG   T + W L
Sbjct: 75  SSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVL 134

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHG 230
              RF++        ++ +IT SDI+PLR R +YQG+ N  F LG A            G
Sbjct: 135 STGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVL-QQG 193

Query: 231 GGWRMAFLIQVPLSALSSLLIAVFMKLPP-------------RSKRVNSPASIKNKLLSV 277
            GWR AFL+QVP++ + +L+IAV + LP              R KR+      +     V
Sbjct: 194 IGWRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEM----V 249

Query: 278 DWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPIL 337
           D++G                        ++  ++ L +  + +   F   E    ++P++
Sbjct: 250 DFVGSFTLIASMILLMTAISLLSDPTQLSTSLWLLLGVLLTASSLQFAYTEC-TTRNPMV 308

Query: 338 PLSFL-RNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTAL 396
           PL  L  NR+V  SSF+NWF  M   T  YY+P+++  V    P  +G R M NF   A 
Sbjct: 309 PLRLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGVRSMSNFVGIAS 368

Query: 397 GSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL--MKPDIATWRQFILLVIPGFGYSV 454
           GS+ AG YMKRTGKY+  +V   +L  +G L +     K       +++L+ +PGFGY+ 
Sbjct: 369 GSMLAGMYMKRTGKYWSFSVATNSLFAVGVLSLFAFSFKGSPQGVVEYLLMFLPGFGYAT 428

Query: 455 LITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK-- 512
           ++TV LLA+IA+V   H A  TSI YAFR+TGSTLGV++   I++  L   L   VL   
Sbjct: 429 MLTVTLLALIASVSVEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQSRLYNNVLTDG 488

Query: 513 -FADKHPRKELLE----IIEKASKSSEWVHDSAPEFIRPTLIGCYHFA--CKDTFLFCTL 565
               ++  + L++    I++  S    + H  A E +R      + F+  C   F F  +
Sbjct: 489 PLLAQYGSRRLMDWCQSILQDNSFDISFDHRLA-ELVRQG----FQFSNQCALGFAF-VV 542

Query: 566 CSIGTLASISIIKEYKLHASLDRK 589
           C +G L+S   ++E+ LH S+ RK
Sbjct: 543 CVLGVLSS-CFMREHVLHTSVSRK 565

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  293 bits (749), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 202/562 (35%), Positives = 298/562 (53%), Gaps = 43/562 (7%)

Query: 57  SIDNEDDSRDGVASSPVPPD-KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPR 115
            I   D S D  A+  V  + K  +I ++++LG FL+A D T+VST++  IAS+ +   +
Sbjct: 18  EIPTFDSSYDAAANHSVLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQ 77

Query: 116 ISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG--LTPSFWGLVGA 173
           +SWIAT+YLLS + FQPLYGKLSDIFGRK LL+ +N+VF +GC +CG   T + W L   
Sbjct: 78  MSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSAG 137

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           RFI+      +T++ +IT SDI+PLR R +YQG+ N  F LG A            G GW
Sbjct: 138 RFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGA-VLQQGIGW 196

Query: 234 RMAFLIQVPLSALSSLLIAVFMKLPPRS----------KRVNSPASIKNKLLSVDWIGXX 283
           R AFLIQVP++ +S LLI   ++LP  S           R N+    K   + +D++G  
Sbjct: 197 RWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQWSKVTKM-IDFVGSI 255

Query: 284 XXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFL- 342
                                 +  ++V L +  +  CA F+  E     +P++PL  L 
Sbjct: 256 TLVMSMLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFVHTEC-TIHNPMVPLRLLW 314

Query: 343 RNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAG 402
            NR+V  SSF+NWF  M+     YY+P+++  V    P  +G R + NF   A GS+ AG
Sbjct: 315 ENRTVFASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGFRSISNFVGIATGSMLAG 374

Query: 403 YYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWR-------QFILLVIPGFGYSVL 455
            YMK TGKY+  ++    L   G L +        T+R       +++L+ +PGFGY+ +
Sbjct: 375 VYMKCTGKYWNFSLVTNILYFTGILSLF-----ACTFRNTPQGVLEYLLMFLPGFGYATM 429

Query: 456 ITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVL---- 511
           +TV LLA+IA+V   H A  TSI YAFR+TGSTLGVS+ G I++ SL   L R +L    
Sbjct: 430 LTVTLLALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQYKLYRDILGDQT 489

Query: 512 ---KFADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFC-TLCS 567
              K+     RK   EI++  S  + +    A E  R      + F+ +    F    C+
Sbjct: 490 LLGKYGQDQLRKWCKEILQDNSFDTSFDQRLAKEVHRG-----FQFSSECALGFALAACT 544

Query: 568 IGTLASISIIKEYKLHASLDRK 589
           +G + S   ++E+ L  ++  K
Sbjct: 545 LGVVLS-CFMREHVLGKTVPSK 565

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score =  186 bits (471), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 142/501 (28%), Positives = 244/501 (48%), Gaps = 19/501 (3%)

Query: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           +F  A D +++  I + IASEF+EL R+S + +AYLLS+A  Q ++ KLS I   K LL 
Sbjct: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLC 318

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMC 208
           +    F++G  +   +  FW  + AR ++      + ++ S  ++      D        
Sbjct: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378

Query: 209 NFFFGLGTACXXXXXXWF-SDHGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVNS 266
              F +G          F S HG GWR AFLI VP   + +S+++A    +        +
Sbjct: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPT 438

Query: 267 PA---SIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACA- 322
           P      KN LLS D                        +  N+    AL     + C  
Sbjct: 439 PTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLK-NNTMIQALLFSVIIVCGI 497

Query: 323 -FFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPT 381
            FF+        + ++ +S   ++ ++ +     FC  A+M    +   Y+  VLN++  
Sbjct: 498 LFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTL 557

Query: 382 RVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQ 441
           ++ +RL P FFS  LG     Y+ K  G+ + L       +LL ++ +  +  ++  W+Q
Sbjct: 558 QLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSLNLPVWKQ 617

Query: 442 FILLVIPGFGYSVLITVALLAMIAAVPHNHHAA-----TTSISYAFRSTGSTLGVSIGGA 496
           +I L +P  G S+++T     +++ + H +H       + SI Y F + G T+G+S+GG 
Sbjct: 618 YICLSLPFLGSSMILT-----LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGY 672

Query: 497 IFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFA 555
           +F ++L  L+  KV+ F+ + + +K+LL+II+ A++SS+WVH+SAP+F+  TLI CY  A
Sbjct: 673 VFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQA 732

Query: 556 CKDTFLFCTLCSIGTLASISI 576
           C++ F   TL    T+ +I I
Sbjct: 733 CRNVFKLSTLFFTITVVAIFI 753

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  181 bits (458), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 146/552 (26%), Positives = 255/552 (46%), Gaps = 32/552 (5%)

Query: 55  YGSIDNEDDSRDGVA-SSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNEL 113
           Y SI  E+ + + +A SS    +++L+I  +++  +FL+  D T+ ++I   I +EF ++
Sbjct: 21  YASIQTEETTTEPLAPSSWTERNRILLIETALFTNVFLSGLDSTITASIYQLIGNEFEDV 80

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
              SWI TAYL++  +FQPLYG  SD  GR+  L   N +F +GCL CGLT + + L+  
Sbjct: 81  KVSSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGCGLTSTIYSLIIM 140

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R ++      + ++ +I  SDI+P + R +YQ   N   G G           +    GW
Sbjct: 141 RAVTGIGGGGLITLSTIVNSDIIPAKKRGMYQSFQNILVGTGAVVGASCGGEIASS-MGW 199

Query: 234 RMAFLIQVPLSALSSLLIAVFMK---LPPRSKRVNSPASIKNKLLSVDWIGXX-----XX 285
           R  FL+QVP+S   +++  +F++   +  ++ R  +  S  +K+  +D++G         
Sbjct: 200 RWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGALPSNVSKIKKIDFLGAFLLISGLV 259

Query: 286 XXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR 345
                         GK    + ++ +AL + ++++   F  VE     +PI+P       
Sbjct: 260 SQLIFLTINSSAQEGKSTWLSGRS-LALGLVTAVSLILFAYVEKTTTANPIIP------H 312

Query: 346 SVLGSSFSNWFCMMAMMT--TSY----YLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSL 399
            +LG  +S    ++ ++    SY     LP+Y+  V+       G RL    F T +G +
Sbjct: 313 DLLGQWYSTTVLIVGVLVGFVSYAYIFTLPLYFQVVVGDTAAEAGLRLTVPSFCTPIGGV 372

Query: 400 GAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVA 459
             G  MK   +   L +   +L L G+L   L+KP    W   +LLV    G  +     
Sbjct: 373 IMGISMKDPKRLPGLLIVGISLMLFGNLCFLLIKPTTPYWLTSLLLVPANIGQGITFPST 432

Query: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK--FADKH 517
           L + + A P    A  T+  Y FRS G   GV+ G +   QS+    + K L+    D+ 
Sbjct: 433 LFSFLFAFPPYKQATATATLYLFRSVGCVWGVA-GTSSLIQSVVRKQATKRLQGILTDEE 491

Query: 518 PRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCT-LCSIGTLASISI 576
            +  L+++  K S     + +  P+ +R  ++  Y  + K T+ F   LC I  + ++  
Sbjct: 492 IKSLLVKLSHKTS-----LIEKLPDNVRAAVLTSYEISIKSTYFFSVILCLIAIILALMR 546

Query: 577 IKEYKLHASLDR 588
               K   + DR
Sbjct: 547 RVFKKFDGTNDR 558

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score =  177 bits (449), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 153/548 (27%), Positives = 240/548 (43%), Gaps = 33/548 (6%)

Query: 54  DYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNEL 113
           D   I N DD  D +  S +P   L +I  +++  +FLA  DGT+ ++    I +EFN++
Sbjct: 36  DNEEIQNADDDED-IPLSRIP--NLWIIEATLFSNVFLAGFDGTITASTYQTIGNEFNQM 92

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
              SWI TAYL++S +FQPLYG  SD  GR+  L   N VF +GCL C  + + + L   
Sbjct: 93  SISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFM 152

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG-- 231
           R ++      + ++ +I  SD++P   R ++Q   N   G G  C        +  GG  
Sbjct: 153 RALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG-------ASFGGTI 205

Query: 232 ----GWRMAFLIQVPLSALSSLLIAVFM--KLPPRSKRVNSPASIKNKLLSVDWIGXXXX 285
               GWR  FLIQVP+S ++SLL+  ++  +     +++N   S K  L  +D  G    
Sbjct: 206 TSTIGWRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDIDITGSILI 265

Query: 286 XXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR 345
                        G    ++ +   + L + S +    FI  E       I+P+  + + 
Sbjct: 266 IAGLTLQLLYLSLGA-SFSWTNPPVLMLLLASIVIIILFILNERKTTARAIIPMELVNSS 324

Query: 346 ---SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL-MPNFFSTALGSLGA 401
               VL  S    F   A + T   LP+++  VL  +  + G RL +P+ F T +GSL  
Sbjct: 325 FSFVVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSLIT 380

Query: 402 GYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALL 461
           G  M +      L      L  LG+     ++     W   + L+    G  +     L 
Sbjct: 381 GISMSKYDCLQSLLYIGIFLMFLGNFLFLFIEKTSPNWLIGVFLIPANLGQGITFPTTLF 440

Query: 462 AMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKE 521
             I A P    A  TS  Y FRS GS  GV+I   + +      L   +    D+H    
Sbjct: 441 TFIFAFPKRDQATATSTLYLFRSIGSVWGVAISAGVIQLYFARYLRFNLKDLLDEH---T 497

Query: 522 LLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYK 581
           + +II + + +S ++     E ++ T+I  +  A K   L  TL S+  LA I  I +  
Sbjct: 498 INKIITRINANSSYIGSLHGE-VKNTVIKSFDSATKKAHLMSTLLSL--LALIFCIVKDN 554

Query: 582 LHASLDRK 589
           L     RK
Sbjct: 555 LKKPNSRK 562

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/524 (27%), Positives = 234/524 (44%), Gaps = 44/524 (8%)

Query: 54  DYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNEL 113
           D   I++ D   D +A S +P   L +I  +++  +FL+  DGT+ ++    I +EFN++
Sbjct: 31  DNADIEDVDKDED-MALSRIP--NLWIIEATLFSNVFLSGFDGTVTASTYQTIGNEFNQM 87

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
              +WI TAYL++S +FQPLYG  SD  GR+  L   N  F +GCL C L+ + + L   
Sbjct: 88  SISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAAFTIGCLACSLSTNIYTLSLM 147

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG-- 231
           R ++      + ++ +I  SD++P   R ++Q   N   G G  C        +  GG  
Sbjct: 148 RALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG-------ASFGGTI 200

Query: 232 ----GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPAS-----IKNKLLSVDWIGX 282
               GWR  FLIQVP+S +SS+L+  ++   P  K  N   S      K  L  +D  G 
Sbjct: 201 ASTIGWRWCFLIQVPISIISSVLMNYYV---PNQKEYNHENSNIFRNSKRILTDIDITGS 257

Query: 283 XXXXXXXXXXXXXXXXG--GKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLS 340
                           G  G ++++ S + + L +GS      FI  E       I+P+ 
Sbjct: 258 ILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLVGSIAILLLFISHEKKTTARAIIPM- 316

Query: 341 FLRNRSVLGSSFSNWFCMMAMMT--TSY----YLPIYYSGVLNMNPTRVGKRL-MPNFFS 393
                 ++ SS+S    +++++    SY     LP+++  VL  +  + G RL +P+ F 
Sbjct: 317 -----ELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLAIPSLF- 370

Query: 394 TALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYS 453
           T +GSL  G+ M +      L     +L  LG+     ++     W   + L+    G  
Sbjct: 371 TPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKTSPNWLISLFLIPANLGQG 430

Query: 454 VLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF 513
           +     L   I   P +  A  TS  Y FRS GS  GV+I   + + S    L   +   
Sbjct: 431 ITFPTTLFTFIFLFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAKYLRSNLKDM 490

Query: 514 ADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACK 557
            D++   +L+  +   S   E +H      ++ T+I  +  A K
Sbjct: 491 LDENTIAKLITKLNANSSYIESLHGE----VKNTVIESFDAATK 530

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 144/538 (26%), Positives = 234/538 (43%), Gaps = 33/538 (6%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI 116
           +I   D+  D +  S +P   L +I  +++  +FL+  DGT+ ++    I +EFN +   
Sbjct: 36  NIHGADEDED-IKLSDIP--NLWIIEAALFTNVFLSGFDGTVTASTYQTIGNEFNHMNIS 92

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           SWI TAYL++S +FQPLYG  SD  GR+  L   N  F +GCL CGL+P+   L   R +
Sbjct: 93  SWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLSPNIVVLSFMRAL 152

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG----- 231
           +      + ++ +I  SD++P   R ++Q   N   GLG  C        +  GG     
Sbjct: 153 TGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGAICG-------ASFGGSIASS 205

Query: 232 -GWRMAFLIQVPLSALSSLLIAVFM--KLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXX 288
            GWR  F +QVP+   +SL+++ ++  +     + +      K  L  +D  G       
Sbjct: 206 IGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKDIDVTGSVFIIIG 265

Query: 289 XXXXXXXXXXGGKE--IAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR- 345
                     G  +  +++ S + + L   S +    F+  E   +   I+PL  +R+  
Sbjct: 266 LTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSARAIIPLELMRSSF 325

Query: 346 --SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL-MPNFFSTALGSLGAG 402
              VL  S    F   A + T   LP+++  VL  +  + G RL +P+ F T +G L  G
Sbjct: 326 SFVVLTISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGGLITG 381

Query: 403 YYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLA 462
             M R      L      L  LG+     ++     W   + L+    G  +     L  
Sbjct: 382 ICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFT 441

Query: 463 MIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKEL 522
            I A P +  A  TS  Y FRS GS  GV++   + +      L   +    D+    EL
Sbjct: 442 FIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLDEDKINEL 501

Query: 523 LEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEY 580
           +  I   S   E +H      ++  +I C+  + K   L  T+ S+  LA   +IKE+
Sbjct: 502 VTKITSNSSYIEKLHGE----LKDVVIDCFDSSTKKAHLLSTILSLLALA-FCVIKEF 554

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  175 bits (444), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 142/490 (28%), Positives = 243/490 (49%), Gaps = 28/490 (5%)

Query: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           +F  A D +++  I++ IASEF+EL R+S I + YLLS+A  Q L+ KLS I   K LL 
Sbjct: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLC 318

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQ-GM 207
           +    F++G  +   +  FW  + ARF++      + ++ S TI +    ++ + Y    
Sbjct: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSA 377

Query: 208 CNFFFGLGTACXXXXXXWF-SDHGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVN 265
               F LG A        F S HG GW+ AFLI VP   + +S+++A    +        
Sbjct: 378 SVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEG 437

Query: 266 SP----ASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSS-LA 320
           S       +K  LLS D                       E+    +T +   + S  L 
Sbjct: 438 STFTLWKRVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTEL--EHRTMIQWVLFSVILI 495

Query: 321 CAFFIGVELYGAKD----PILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVL 376
           C       L  A D     ++ +S   ++ ++ +     FC  A+M    +   Y++ VL
Sbjct: 496 CGVLFW--LIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVL 553

Query: 377 NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDI 436
           N+N  ++ +RL+P FFS  +G     Y+ K   + Y L      ++L+ ++ +  +   +
Sbjct: 554 NLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSL 613

Query: 437 ATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAA-----TTSISYAFRSTGSTLGV 491
             W+Q++ L +P      L +  LL +++++ H +H       + SI Y F + G T+G+
Sbjct: 614 PVWKQYVCLSLP-----FLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGI 668

Query: 492 SIGGAIFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIG 550
           S+GG +F ++L   L  +V+KF+ + + +K+LL+II+ A++SS+WVH+SAP+FI  TLI 
Sbjct: 669 SLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIE 728

Query: 551 CYHFACKDTF 560
           CY  AC++ F
Sbjct: 729 CYLQACRNVF 738

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  171 bits (434), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 142/488 (29%), Positives = 235/488 (48%), Gaps = 52/488 (10%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           KL ++T S++LG F+++ DGT+V+ IM  +A EF+E  +  WIAT++LL++  FQPLYGK
Sbjct: 34  KLPILT-SLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGK 92

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LSD+ GRK  L++     ++GCL+  L  +      AR I       + +  SIT+SDI 
Sbjct: 93  LSDVTGRKFALLMAYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDIC 152

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLI--AVF 254
             ++R +YQG  N  FG+G          F D   GWR  F IQVP+  +S+ L    V 
Sbjct: 153 TAKERGIYQGYANIVFGMGQMLGAPLGGLFIDT-IGWRAIFGIQVPVVMVSAFLAYRNVN 211

Query: 255 MKL---PPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFV 311
           +KL   PP S+R       +  L  +D++G                         +K  V
Sbjct: 212 IKLSHVPPISERFT-----RKNLSRIDFLGSVTLASTICGVLVLCSTD------LNKLVV 260

Query: 312 ALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS--SFSNWFCMMAMMTTSYYLP 369
           +L   +S     F+ VEL+ A + ILP   L+    L S  +  + F +   +  S   P
Sbjct: 261 SLATAASF--VLFLWVELFYAAERILPFELLKGPFGLSSVVTVCSSFVIFGDIFRS---P 315

Query: 370 IYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGK-----YYWLTVGFCTLSLL 424
           IY   + +++ T  G  ++    S A+GSL  G  ++RT K      Y   +    L L 
Sbjct: 316 IYLQLIHDLSVTNTGLFMIFPSVSVAVGSLVTGAVLRRTSKSLELCSYLFVLAGIALQLT 375

Query: 425 G----HLQINLMKPDIAT----------------WRQFILL--VIPGFGYSVLITVALLA 462
           G    +  + +++P ++T                W+   +   V+ GFGY+ L+   L++
Sbjct: 376 GLVISYYLVGVVEPALSTQMASTLTFQFASQSTLWKLVFVFASVLVGFGYACLLVSTLVS 435

Query: 463 MIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKEL 522
           ++ ++  +  A  T I Y +RS G+ LG S+   +F+ SL   L + +L+      +K+ 
Sbjct: 436 IVFSIDKSQQATMTGIFYLWRSIGNVLGASLTLVVFQNSLTTSLRKYMLESHRSFTKKQY 495

Query: 523 LEIIEKAS 530
            +++  +S
Sbjct: 496 YKLLTDSS 503

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  172 bits (437), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/490 (25%), Positives = 230/490 (46%), Gaps = 18/490 (3%)

Query: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           +F  A D +++  I + IASEF+EL R+S + + YLL +A  Q ++ KLS + G K LL 
Sbjct: 265 LFFIAMDSSIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFLKLSLVSGVKLLLC 324

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMC 208
           +    F++G  +   +  FW  + AR ++      + ++ S  ++      +        
Sbjct: 325 VAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGSLIALKSTIMNRFSQKNENQYPLSTS 384

Query: 209 NFFFGLGTACXXXXXXWF-SDHGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVNS 266
              F LG A       +F S HG GW+ AFLI VP   + +S+++A    +         
Sbjct: 385 MTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKNTIHHEGP 444

Query: 267 PASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGG--KEIAFNSKTFVALCIGSSL---AC 321
             +++ +   V W                               T +   I S +     
Sbjct: 445 TTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLEHSTMIQEIIFSVIIICGV 504

Query: 322 AFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPT 381
            FF+  +     + +  LS   ++ ++ +    +FC  A+M    +   Y+  VLN++  
Sbjct: 505 LFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDTL 564

Query: 382 RVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQ 441
            + +RL+P FFS  +G     Y+     + Y        ++LL ++ +  M   ++ W+Q
Sbjct: 565 EIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKFVLSGVTLLLYVALMGMNLSLSVWKQ 624

Query: 442 FILLVIPGFGYSVLITVALLAMIAAVPHNHHAA-----TTSISYAFRSTGSTLGVSIGGA 496
           +  L +P  G S+++T     +++ + H +H       + SI+Y F + G T+GVS  G 
Sbjct: 625 YTCLSLPLLGSSMILT-----LLSTLYHEYHVQRKSPISGSIAYCFAAMGGTIGVSSAGY 679

Query: 497 IFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFA 555
           +F ++L   ++ +V+KF+ + + +K+L +II+ A++SS WVH SAP+FI  TLI CY  A
Sbjct: 680 VFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQA 739

Query: 556 CKDTFLFCTL 565
           C++ F    L
Sbjct: 740 CRNVFKLSAL 749

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 166/581 (28%), Positives = 261/581 (44%), Gaps = 94/581 (16%)

Query: 56  GSIDN--EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNEL 113
           G  DN  E+   +   S P  P     I LS++LG FL++ D T+V+ IM  +A EF E 
Sbjct: 20  GEEDNGLEEQYHEYNLSLPKFP-----ILLSLWLGSFLSSLDSTIVANIMNKVAEEFEES 74

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
            +  WIAT++LL++  FQPLYGKLSDI GRK  ++ ++  F +GC +     +      A
Sbjct: 75  DKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIA 134

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R I       V +M SIT+SDI   R+R +YQG  N  FGLG          F D   GW
Sbjct: 135 RAICGIGAGGVNAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFID-SVGW 193

Query: 234 RMAFLIQVPLSALSSLLIA--VFMKL---PPRSKRVNSPASIKNKLLSVDWIGXXXXXXX 288
           R+ F +QVP+  L S L    + +KL   PPR +R     + KN L  +D  G       
Sbjct: 194 RVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERF----TWKN-LSRIDIFGSLALVGT 248

Query: 289 XXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAF--FIGVELYGAKDPILPLSFLRNRS 346
                         +   S T   + +  S+  +F  FI +ELY AK+ ILP   L+   
Sbjct: 249 ISSL----------LFLTSTTLNKIVLTLSMIASFILFIWIELYYAKERILPFDLLKG-- 296

Query: 347 VLGSSFSNWFCMMAMMTTSYYL-------PIYYSGVLNMNPTRVGKRLMPNFFSTALGSL 399
               SF    C +  + +S+ +       PIY   V +++ T+ G  L+    + A GSL
Sbjct: 297 ----SFG--LCSLVTVASSFVVFGDIFRSPIYLQLVQDISVTKTGLFLVFPSIAVAGGSL 350

Query: 400 GAGYYMKRTGK-----YYWLTVG-----FCTLSLLGHLQINL----------------MK 433
             G+ ++ T K      Y + +G      C L +  +L  NL                  
Sbjct: 351 VTGWILRHTKKNLSHCAYGIILGGVCIQLCGLVIAYYLIKNLKPAMVHIDDSAMAFFTFT 410

Query: 434 PDIATWRQF--ILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGV 491
           P+   W+    + L++  +GY+ L+   L++++  +  +     T I Y +RS G+ LG 
Sbjct: 411 PNSIMWKIIYALALILVSYGYASLLVATLVSIVFTIEKSQQGTMTGIFYLWRSIGNVLGA 470

Query: 492 SIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSA-------PEFI 544
           S+   I+  S    L++K+  +  +   K+   I  K    +  V DS+       P   
Sbjct: 471 SLTLVIYENS----LAKKLWNYMFETNNKKDSYIFSKEEYYT-LVRDSSYLRAANFPALT 525

Query: 545 RPTLIGCYHFACKDTFLF-----CTLCSIGTLASISIIKEY 580
             +L+  Y    +D+FL        L  +G + S  ++++Y
Sbjct: 526 LRSLLNVY----RDSFLISYWPNIALAFLGLIVSWVLVRKY 562

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 150/539 (27%), Positives = 232/539 (43%), Gaps = 51/539 (9%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           K+L+I  +++  +FL+  D T+ ++    I +EF ++   SWI TAYL++  +FQPLYG 
Sbjct: 41  KVLLIETALFTNVFLSGLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGS 100

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
            SD  GR+  L   N +F +GC  CG T + + L+  R ++      + ++ +I  SDI+
Sbjct: 101 FSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDII 160

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG------GWRMAFLIQVPLSALSSLL 250
           P + R +YQ   N   G G           +  GG      GWR  FL+QVP+S +   L
Sbjct: 161 PAKKRGIYQAFQNVLLGTGAVVG-------ASCGGLIATTMGWRWCFLLQVPIS-VGGTL 212

Query: 251 IAVFMKLPPRSKRVNSPASIK----NKLLSVDW----IGXXXXXXXXXXXXXXXXXGGKE 302
           +A F     R       ++++     KL  +D+    +                     E
Sbjct: 213 VAFFFVHDQRPDINGGVSAVRTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSE 272

Query: 303 IAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRN---RSVLGSSFSNWFCMM 359
             + S   + L + + ++   F  VE     +PI+P   LR     +VL  S    F   
Sbjct: 273 SYWYSPQSIVLTLSTGVSLILFAYVEHTTKANPIIPHDLLRQAHGATVLIISVLVGFVAY 332

Query: 360 AMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFC 419
           A + T   LP+Y+  V+     + G RL    F T +G L  G  MK       L +   
Sbjct: 333 AYIFT---LPLYFQVVIGDTAAKAGLRLTVPSFCTPIGGLITGLSMKNPNHLPVLLISGI 389

Query: 420 TLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSIS 479
           T  LLG+L    +KP    W+  +LLV    G  +     L   + A P    A  TS  
Sbjct: 390 TCMLLGNLCFLFIKPWTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTL 449

Query: 480 YAFRSTGSTLGVSIGGAIF--------RQSLNGLLSRKVLKFADKHPRKELLEIIEKASK 531
           Y FRS G   GV+   ++         ++SLNGLL+       +K  RK LL++    S+
Sbjct: 450 YLFRSVGCVWGVAGTSSLIQYAVRNQAKKSLNGLLT-------EKEIRKLLLQLSHTTSQ 502

Query: 532 SSEWVHDSAPEFIRPTLIGCYHFACKDT-FLFCTLCSIGTLASI--SIIKEYKLHASLD 587
             +      P  +R  +I  Y  A +   FL   LC+I  L S    + K+   H   D
Sbjct: 503 IKK-----LPPDVRSAVISSYDNAIRQAYFLSVFLCTIAILLSFLKRVFKKRDEHEGQD 556

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  166 bits (419), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 143/504 (28%), Positives = 221/504 (43%), Gaps = 61/504 (12%)

Query: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120
           E +  +   S P  P     I LS++LG FL++ DGT+V+ IM  +A EF E  +  WIA
Sbjct: 24  EQEYHEHNLSLPKLP-----IVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIA 78

Query: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXX 180
           T+YLL++  FQPLYGKLSD+ GRK  ++  +  F +GCL+     S      AR I    
Sbjct: 79  TSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVG 138

Query: 181 XXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
              + +M SIT+SDI   R+R +YQG  N  FGLG          F D   GWR+ F +Q
Sbjct: 139 GGGINAMSSITVSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDT-LGWRILFGLQ 197

Query: 241 VPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVD----WIGXXXXXXXXXXXXXXX 296
           VP   L S L+          K VN   S    LL V+    W                 
Sbjct: 198 VPTILLCSSLV---------HKNVNIKLS---HLLPVEERFKWSNLSRIDILGSSTLVFT 245

Query: 297 XXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWF 356
             G   +         L I + ++   FI +ELY +K+ I+P   L+    L S+ +   
Sbjct: 246 ISGVLFLCSTELNKALLSIFTVISFIAFILIELYYSKERIMPFELLKGSFGLASA-ATVI 304

Query: 357 CMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY----- 411
               +    +  PIY   +  ++ T+ G  ++    S A+GSL  G+ ++ T        
Sbjct: 305 SSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGWILRHTKMKLSHCA 364

Query: 412 YWLTVGFCTLSLLG----HLQINLMKPDIA--------------------TWRQF--ILL 445
           YW+     ++ LLG    +  I  ++P ++                    TW     + L
Sbjct: 365 YWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSAIFGAFVQIGQNISSQSYTWVVIYALAL 424

Query: 446 VIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGL 505
           ++  FGY+ L+   L+ ++  +P +     T I Y +RS G+ LG S+    + + ++  
Sbjct: 425 ILVSFGYACLLVATLVNIVFTIPKSQQGTVTGIFYLWRSIGNVLGASLTLVFYEKGVSSF 484

Query: 506 LSRKVL-------KFADKHPRKEL 522
           L   +         F+ K  RK L
Sbjct: 485 LWNYMFNKQHDDYNFSKKEYRKLL 508

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  163 bits (412), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 147/491 (29%), Positives = 220/491 (44%), Gaps = 72/491 (14%)

Query: 60  NEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWI 119
            ++  RD +A    P      I LS++LG F++A DGT+V+ IM  IA+EF E  +  WI
Sbjct: 29  EQEYHRDNMALPKGP------ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWI 82

Query: 120 ATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXX 179
           AT+YLL++  FQPLYGKLSDI GRK  ++  +  F +GCL+     +      AR I   
Sbjct: 83  ATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLLTCFAQNVTQFSIARAICGI 142

Query: 180 XXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLI 239
               + +M SIT++DI   R+R +YQG  N  FG G         +  D   GWR  F I
Sbjct: 143 GGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQLLGAPIGGFLLD-SIGWRSIFGI 201

Query: 240 QVPLSALSSLLI-----AVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXX 294
           QVP+  L S+L         + +PPR++R     + KN L  +D  G             
Sbjct: 202 QVPMLMLCSVLALKNVNIKLVHIPPRNERF----TWKN-LSRIDIFGSISLVATISGILF 256

Query: 295 XXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSN 354
                  +          L I + L+ + FI +ELY AK+ I+P   L+    L S    
Sbjct: 257 LTSSNWNK--------SLLGIFTVLSFSLFIYIELYVAKERIMPFELLKGSFGLSS---- 304

Query: 355 WFCMMAMMTTSYYL-------PIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKR 407
               +A + TS+ +       PIY   + N++ T  G  L+    + ALGS+  G  ++ 
Sbjct: 305 ----IATVITSFIIYGEIFRSPIYLQLIQNVSVTVTGLYLIFPSVAIALGSIVTGSILRN 360

Query: 408 T--------------GKYYWLTVGFCTLSLLGHLQINLMKPDI---------------AT 438
           T              G    L     +  LL H+   L   D+               + 
Sbjct: 361 TKMDLAHCAAAIIFGGMIMQLAGLALSYYLLSHVNPALDLADLPANLFSAATIYFVSDSI 420

Query: 439 WRQFIL---LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGG 495
           W + +    LVI   GY+ L+   L++++  V  +     T I Y +RS G+ LG SI  
Sbjct: 421 WWKIVYVGALVIGSSGYASLLVATLVSIVFTVDRSKQGTITGIFYLWRSIGNVLGASITL 480

Query: 496 AIFRQSLNGLL 506
            +F +SL  +L
Sbjct: 481 VVFERSLGRML 491

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  163 bits (413), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 144/535 (26%), Positives = 250/535 (46%), Gaps = 31/535 (5%)

Query: 51  QGTDYGSIDNE-DDSRDGVASS---PVPPDKLL-------VITLSMYLGIFLAAADGTLV 99
           +  +YGSI     D  +G  SS       DK +       + +  M   +F  A D T++
Sbjct: 226 RAYEYGSISRTVKDVENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFIAMDSTIL 285

Query: 100 STIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCL 159
            +I++ IASEF+EL R+S I + YLLS+A  Q ++ KLS +   K LL +    F++G  
Sbjct: 286 MSIVSKIASEFHELWRLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSY 345

Query: 160 MCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACX 219
           +      FW  V AR I+      + ++ S  ++     +            F LG A  
Sbjct: 346 LSWSAFHFWTFVFARSITGFGSGALMALKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIG 405

Query: 220 XXXXXWFSD-HGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVNS-PAS---IKNK 273
                 F +  G GW+ AFLI VP   + +S+++A    +        S P S   IK  
Sbjct: 406 PFLVYLFDNSRGSGWKNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGSAPISWKRIKKI 465

Query: 274 LLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACA-FFIGVELYGA 332
           L+S D                        +  +S     +     + C   F  +E    
Sbjct: 466 LMSPDLYEILTLALLLLCFVQVTSLDITRLE-HSAVIQGVLFFVIITCGILFWWIETNET 524

Query: 333 -KDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNF 391
             + I+ +S   ++ ++ +     FC  A+M    +   Y++ VLN++  ++ +RL+P  
Sbjct: 525 YANSIISMSLRGDKHLMWTIMGISFCFAALMCIIPFGTTYFTIVLNISTLQIAERLLPLS 584

Query: 392 FSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFG 451
            +  +G     Y+ K   K Y L V    ++L+ ++ +      +  W+Q++ L +P  G
Sbjct: 585 VAIVVGYFSVCYFWKPQMKNYLLEVVLGGVTLILYIALMGASLSLPVWKQYVCLSLPLLG 644

Query: 452 YSVLITVALLAMIAAVPHNHHAATTS-----ISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
            ++++T     +++++ H +H    S     I Y F + G T+G+S+GG +F ++L   +
Sbjct: 645 SAMILT-----LLSSLYHEYHQPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAV 699

Query: 507 SRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTF 560
              V+KF+   +  K+LL+IIE A++SS+WVH+SAP+FI  TLI CY  AC++ F
Sbjct: 700 HDGVMKFSKHGYHEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQACRNVF 754

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  161 bits (407), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 209/460 (45%), Gaps = 63/460 (13%)

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGR 143
           S++LG F ++ D T+V+ IM  +A EF E  +  WIAT++LL++  FQPLYGKLSDI GR
Sbjct: 48  SLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGR 107

Query: 144 KPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRAL 203
           K  ++  +  F +GCL+     +      AR I       + +M SIT SDI   R+R +
Sbjct: 108 KFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERGI 167

Query: 204 YQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAV-----FMKLP 258
           +QG  N  FG+G          F DH  GWR  F IQVP+    S L         + +P
Sbjct: 168 FQGYANIVFGMGQVLGAPLGGLFLDH-IGWRTLFGIQVPMIMFCSYLTITNVNIKLLHVP 226

Query: 259 PRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSS 318
           PR +R     + KN L  +D  G                    ++  +  TF++      
Sbjct: 227 PRKERF----TWKN-LSRIDIFGSLSLVATISGILFLTSTQLDKLLLSLFTFISF----- 276

Query: 319 LACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYL-------PIY 371
                F+ +ELY AK+ ILP        +L  SF    C +  + +SY +       PIY
Sbjct: 277 ---GLFMWIELYYAKERILPF------DLLNGSFG--LCSVVTVISSYVVFGDIFRSPIY 325

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGK-----YYWLTVGFCTLSLLG- 425
              + +++ T+ G  L+    + A GSL  G+ ++ T K      Y + +    + L G 
Sbjct: 326 LQLIQDISVTKTGLFLIIPSIAMAGGSLVTGWILRNTTKNLSHCAYGIILSGVIIQLAGL 385

Query: 426 ---HLQINLMKPDI------------------ATWRQFIL--LVIPGFGYSVLITVALLA 462
              +L I  + P +                   TW+   +  L++  +GYS ++   L++
Sbjct: 386 VIAYLLIGHLNPSLNQLGNVFNIAMENFTSGSRTWKVIFVFSLLLGSYGYSSILVATLVS 445

Query: 463 MIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSL 502
           ++  +  +     T I Y +RS G+ LG S+   ++R +L
Sbjct: 446 IVFTIEKSQQGTMTGIFYLWRSIGNVLGASLTLVLYRNTL 485

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  160 bits (405), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 213/468 (45%), Gaps = 64/468 (13%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           KL ++T S++LG F+ + DGT+V+ IM  +A EF E  +  WIAT++LL++  FQPLYGK
Sbjct: 32  KLPILT-SLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGK 90

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LSDI GR+  L+  +  F +GCL+     S      AR I       + +  SI +SDI 
Sbjct: 91  LSDITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDIC 150

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLI--AVF 254
             ++R  YQG  N  FG G            D   GWR  F +QVP+    S L    + 
Sbjct: 151 TAKERGSYQGYANIVFGTGQMLGGPIGGLLIDT-IGWRAIFAVQVPIIMFCSFLTYKNIT 209

Query: 255 MKL---PPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFV 311
           +KL   PP S+R          L  +D +G                    ++  ++ T V
Sbjct: 210 IKLSHIPPVSERFT-----WMNLSRIDIMGSSSLVVVICGILFICSTNWNKVILSTFTIV 264

Query: 312 ALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYL--- 368
                      FFI  E Y AK+ ILPL  L+  S L        C +  + +S+     
Sbjct: 265 GFL--------FFIVTETYFAKECILPLKLLKGASGL--------CSLVTVLSSFITFGE 308

Query: 369 ----PIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRT----GKYYWLTVGFCT 420
               PIYY  V +M+ T+ G  ++    S A+GS+  G  ++ T    G Y +L +    
Sbjct: 309 IFRAPIYYQVVQDMSVTKTGLFVLFPAVSVAVGSVVTGTALRHTKLDLGHYCYLIILRSI 368

Query: 421 LS-----LLGHLQINLMKPDIAT--------WRQF--------ILLVIPG----FGYSVL 455
            +     LL ++ IN  +P I          W QF        ILLV  G    +GYS L
Sbjct: 369 FTQLIGLLLAYVVINGTEPTIGASSSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYSGL 428

Query: 456 ITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLN 503
           +   L++++ +V  +  A  T I Y +RS GS LG S+   I+  SL 
Sbjct: 429 LVATLVSIVCSVEKSEQATLTGIFYLWRSIGSVLGTSLTLVIYENSLT 476

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  158 bits (399), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 144/486 (29%), Positives = 218/486 (44%), Gaps = 52/486 (10%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FL++ DGT+V+ IM  +A EF+E  R  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  L+  +  F +GCL+     +      AR I       + ++ SI +SDI   R+
Sbjct: 98  TGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARE 157

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL------IAVF 254
           R +YQG  N  FGLG          F +   GWR  F +QVP+  L S+L      I +F
Sbjct: 158 RGVYQGYANIVFGLGQLLGAPLGGVFIE-TIGWRALFGVQVPVIMLCSVLAIKNINIKLF 216

Query: 255 MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALC 314
             +PP  +R     ++KN L  +D  G                        N        
Sbjct: 217 -HVPPMKERY----TLKN-LSRIDIFGSLSLVATISGVLFLCSS-----HLNKLYLTLFT 265

Query: 315 IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSG 374
           IGS +    FI VE Y A + ILPL  L  RS   SS         +    +  PIY   
Sbjct: 266 IGSFIV---FILVERYYATEKILPLELL-TRSFCLSSAVTVISSFVVFGEIFRSPIYLQL 321

Query: 375 VLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG------KYYWLTVGFCT-------- 420
           + N++ T+ G  L+    S A+GSL  G+ ++ T        Y  +  G  T        
Sbjct: 322 LQNISVTKTGLFLIFPSVSVAVGSLVTGWLLRNTKINLAHCAYQIIFGGMITQLLGLGLG 381

Query: 421 ----------LSLLGHLQINLMKPDIATWRQFILL--VIPGFGYSVLITVALLAMIAAVP 468
                      ++   L+    + D   W+   +   V+  FGY+ L+   L++++  V 
Sbjct: 382 YLLLAYLNPDYTIYDMLESITFESDSIWWKLIYVFASVLVSFGYACLLVATLVSIVFTVE 441

Query: 469 HNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVL--KFADKH--PRKELLE 524
            +     T + Y +RS G+ LG S+    +  SL+ +L   +   K +DK+   +K+   
Sbjct: 442 KSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFETKRSDKYHFTKKQYYS 501

Query: 525 IIEKAS 530
           +I   S
Sbjct: 502 LINDTS 507

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  157 bits (398), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 140/536 (26%), Positives = 233/536 (43%), Gaps = 43/536 (8%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           +++ I  +++  +FL+  DGT+ ++    I +EF+     +WI TAYL+++ +FQPLYG 
Sbjct: 43  RIVFIETALFANVFLSGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGS 102

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
            SD  GR+  L   N VF +GCL CGL P    L+  R ++      + ++ +I  SDI+
Sbjct: 103 FSDTLGRRHCLFFANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDII 162

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P   R +YQ   N   G+G           + +  GWR  FL+QVP+S   +++  +F++
Sbjct: 163 PPESRGIYQAFQNVLLGIGAVIGASTGGAVASY-LGWRWCFLLQVPVSVGGTIMAYMFLE 221

Query: 257 LPPR--SKRVNSPASIKNKLLSVDW-------IGXXXXXXXXXXXXXXXXXGGKEIAFNS 307
                 S+  +S   +KN+   +D        +G                 G + +   S
Sbjct: 222 NQKGFVSESESSGQLLKNRFSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWL---S 278

Query: 308 KTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRS---VLGSSFSNWFCMMAMMTT 364
           K  + L + + L+   FI  E     +PI+P   L       VL  S    F   A + T
Sbjct: 279 KESIGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYLFT 338

Query: 365 SYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLL 424
              LP+++  V+  +  R G RL    F T +G L  G  M+      +L      L ++
Sbjct: 339 ---LPLFFQIVVGDSAARAGFRLAIPSFCTPIGGLITGLSMRIPKTLPFLLSFGMVLMMI 395

Query: 425 GHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRS 484
           G+    L+K     W   +LL     G  V     L + + +    + A  TS  Y FRS
Sbjct: 396 GNAFFLLLKTTTPEWLVCLLLTPANVGQGVTFPATLFSFLFSFHPENQATATSTLYLFRS 455

Query: 485 TGSTLGVS--------IGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWV 536
            GS  GV+        + G   R+ L+G+LS            +E+  +  K    + ++
Sbjct: 456 IGSLWGVAGTSGLIQLLVGRKIREKLHGILS-----------PEEIARLRSKIGHKTSYI 504

Query: 537 HDSAPEFIRPTLIGCYHFACK-DTFLFCTLCSIGTLASISIIKEY-KLHASLDRKN 590
            +  P  I+  ++  Y  A K    L  + C I     ISI++ + K + +L   N
Sbjct: 505 -EKLPSEIKEAVVESYESAIKFAHILSVSFCVIAI--GISIVRHFSKGYRNLKEHN 557

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  153 bits (387), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 142/543 (26%), Positives = 242/543 (44%), Gaps = 61/543 (11%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FL+A D T+V+ IM  +A +FN   +  WIAT+YLL++  FQPLYG+LSDI
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDI 127

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK   ++    F +G  +   + +      AR ++      +++M SI +SDI  +++
Sbjct: 128 IGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKE 187

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK---- 256
           R +YQG  N F+G G            D   GWR  F  QVP+ A++  L   ++     
Sbjct: 188 RGMYQGYANIFYGAGQLIGAPIGGLLIDR-IGWRALFAFQVPMVAVAMFLSFTYLNIKLA 246

Query: 257 -LPPRSKRVNSPASIKNKLLS-VDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALC 314
            LPP+ +R       K K LS +D  G                  G     N     A+ 
Sbjct: 247 HLPPKEERY------KWKHLSKLDIFGSITLVITIGICIVILSDNG----LNRMVLGAMG 296

Query: 315 IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSG 374
           +   L+   F+ +E Y  K  ILPL  L+  S   +S +       +    +  PIY   
Sbjct: 297 L---LSFGLFLIIEKYYTKHQILPLKCLQG-SFGYASLTIIISTYVIFGEYFRTPIYLQV 352

Query: 375 VLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG------KYYWLTVGFCT-------L 421
           + N   ++ G  L+      A GS+  G  +K++        Y  +    CT       L
Sbjct: 353 IQNFTVSQSGIFLLFPTICVAGGSVLTGRVLKQSKMDLEKCSYQLIFYSVCTQFVGLLML 412

Query: 422 SLL-GHLQI---NLMKPDIA-----------TWRQFILLV--IPGFGYSVLITVALLAMI 464
           +LL  +L I   N  KP +            +W+    +   +  FGY+ ++   L++++
Sbjct: 413 TLLINYLHIFNSNNTKPGVGNIFHELTTVDFSWKIIFCIATSLVTFGYASILVATLVSIV 472

Query: 465 AAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKEL-- 522
             V  +   + T + Y +RS G+ LG SI    +  +    L+ K+ KF  ++P + +  
Sbjct: 473 HTVEKSQQGSITGLFYLWRSLGNVLGTSITLITYENN----LTSKLYKFMFENPEQHMDY 528

Query: 523 ---LEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFL-FCTLCSIGTLASISIIK 578
              +E  +   K+S ++     + +   L+  Y  A   +++    +CS+G + S  +++
Sbjct: 529 IFTIEEYKALVKNSGYLRSHFSKDVVEELLAVYRNAFVQSYIPNLLICSVGVVISYLLMR 588

Query: 579 EYK 581
            YK
Sbjct: 589 SYK 591

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 136/468 (29%), Positives = 206/468 (44%), Gaps = 56/468 (11%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FL++ D T+V+ IM  +A EF+E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  L+     F +GCL+     +      AR I       + ++ SI +SDI   R+
Sbjct: 98  TGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL------IAVF 254
           R +YQG  N  FG G          F +   GWR  F IQVP+  L S+L      I +F
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIET-IGWRALFGIQVPVIMLCSVLAIKNINIKLF 216

Query: 255 MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALC 314
             +PP  +R     ++KN L  +D  G                        N        
Sbjct: 217 -HVPPMKERY----TLKN-LSRIDIFGSLSLVATISGVLFLCSS-----QLNKLYLALFT 265

Query: 315 IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSG 374
           IGS +    FI VE Y A + ILP   L  RS   SS         +    +  PIY   
Sbjct: 266 IGSFIV---FILVERYYATEKILPFELL-TRSFCLSSAVTVISSFVVFGEIFRSPIYLQL 321

Query: 375 VLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLL---------- 424
           + N++ T+ G  L+    S A+GSL  G+ ++ T     + +  C   ++          
Sbjct: 322 LQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMIMQLLG 377

Query: 425 --------GHLQINLMKPDI---------ATWRQFILL---VIPGFGYSVLITVALLAMI 464
                    HL  +    D+         + W + I +   V+  FGY+ L+   L++++
Sbjct: 378 LGLGYFLLSHLNPDYTIYDMLESITFRSNSIWWKLIYVFASVLVSFGYACLLVATLVSIV 437

Query: 465 AAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK 512
             V  +     T + Y +RS G+ LG S+    +  SL+ +L   + K
Sbjct: 438 FTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFK 485

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  152 bits (383), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 147/546 (26%), Positives = 240/546 (43%), Gaps = 76/546 (13%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FL++ D T+V+ IM  +A +F+E  R  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  L++    F +GCL+     +      AR I       + ++ SI +SDI   R+
Sbjct: 98  TGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARE 157

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL------IAVF 254
           R +YQG  N  FG G          F +   GWR  F +QVP+  L ++L      I +F
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGVFIE-TIGWRALFGVQVPMIMLCTILAIKNINIKLF 216

Query: 255 MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALC 314
             +PP  +R     ++KN L  +D  G                        N        
Sbjct: 217 -HVPPMKERY----TLKN-LSRIDLFGSLSLVATISGVLFLCSS-----HLNKLYLSLFT 265

Query: 315 IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS--NWFCMMAMMTTSYYLPIYY 372
           IGS +    F+ VE Y A + ILP   L     L S+ +  + F +   +  S   PIY 
Sbjct: 266 IGSFIV---FVLVERYYATERILPFELLTPSFCLSSAVTVISSFVVFGEIFRS---PIYL 319

Query: 373 SGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLL-------- 424
             + N++ T+ G  L+    S A+GSL  G+ ++ T     + +  C   ++        
Sbjct: 320 QLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----INLAHCAYQIIFGGMVTQL 375

Query: 425 ----------GHLQINLMKPDI---------ATWRQFILL---VIPGFGYSVLITVALLA 462
                      HL  +    D+         + W + I +   V+  FGY+ L+   L++
Sbjct: 376 LGLGLGYLLLAHLNPDYTVYDMLESITFKSNSIWWKLIYVFASVLVSFGYACLLVATLVS 435

Query: 463 MIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHP---- 518
           ++  V  +     T + Y +RS G+ LG S+    +  SL+ +L   + K   +      
Sbjct: 436 IVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSMLWNYMFKSKREDEYHFS 495

Query: 519 RKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLF-----CTLCSIGTLAS 573
           +K+   +I+    SS    ++ P+++   ++  Y    K  FL        L  IG + S
Sbjct: 496 KKQYYSLID---DSSYLRGNNFPKYVFVRILDVY----KKAFLISYIPNIALAVIGMVLS 548

Query: 574 ISIIKE 579
           + ++K 
Sbjct: 549 LYLVKH 554

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  152 bits (383), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 133/462 (28%), Positives = 210/462 (45%), Gaps = 53/462 (11%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           L I  S+++G FL A DGT+V+ IM  +A EF E  +  WIAT++LL++  FQPLYGKLS
Sbjct: 51  LPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLS 110

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           DI GRK  L++ +  F +GCL+     +      AR I       +++M SIT+SDI   
Sbjct: 111 DITGRKFALLVAHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTA 170

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLP 258
           R+R  YQG  N  F  G         +  D   GWR  F +QVP+     LLI + +   
Sbjct: 171 RERGAYQGYANVVFSTGQLLGAPLGGFALDR-IGWRAIFGLQVPM-----LLICMVLGYR 224

Query: 259 PRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSS 318
             + ++     ++ +     W                   G   +   S     L + + 
Sbjct: 225 NVNIKLAHVPPLEERF---TWKNLSRIDIGGSITLVCTISGVLFLCSTSLNKAILSVFTG 281

Query: 319 LACAFFIGVELYGAKDPILPLSFLRNR----SVL--GSSFSNWFCMMAMMTTSYYLPIYY 372
           L+   F+  ELY A++ ILP   L       S+L  GSSF        +    +  PI+ 
Sbjct: 282 LSFMLFMYNELYLARERILPFELLGGSFGLASILTVGSSF-------VIFGDVFRSPIFL 334

Query: 373 SGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRT----GKYYWLTVGF------CTL- 421
             V N++ T+ G  L+ +  +TA  SL  G+ ++ T     K  +L V F      C L 
Sbjct: 335 QLVQNISVTKTGGFLLFSSIATAAASLITGWILRNTKMNLAKCSYLIVFFSIFLQLCGLV 394

Query: 422 ---SLLGHLQIN---------------LMKPDIATWRQFILL--VIPGFGYSVLITVALL 461
              +LL +L+ N               L K D   W+   +      G+GY+ L+   L+
Sbjct: 395 IAVTLLSYLEPNQTSLMANNTRLKRDYLFKSDSLAWKCVYICASAFTGYGYASLLVSTLV 454

Query: 462 AMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLN 503
           +++  +  +  A  T + Y +RS G+ LG S+  +++  +L+
Sbjct: 455 SIVFTIDKSQQATITGLFYLWRSIGNVLGASLTLSLYEATLS 496

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 135/465 (29%), Positives = 216/465 (46%), Gaps = 62/465 (13%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FL++ D T+V+ IM  +A EF+E  +  WIAT++LL++  FQPLYGKLSDI
Sbjct: 38  ILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDI 97

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GR+P L+     F +GCLM     +      AR +       + ++ SI +SDI   R+
Sbjct: 98  IGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARE 157

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL------IAVF 254
           R +YQG  N  FG G          F +   GWR  F +QVP+  + S+L      I +F
Sbjct: 158 RGVYQGYANIVFGFGQLLGAPLGGIFIE-TIGWRALFGVQVPMIIVCSILAIKNINIKLF 216

Query: 255 MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVAL- 313
             +PP  +R     ++KN L  +D  G                      +  +K ++AL 
Sbjct: 217 -HVPPMKERY----TLKN-LSRIDIFGSLSLVATISGVLFLCS------SHMNKIYLALF 264

Query: 314 CIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS--NWFCMMAMMTTSYYLPIY 371
            IGS +    F+ VE Y A + ILP   L     L S+ +  + F +   +  S   PIY
Sbjct: 265 TIGSFIV---FVLVERYYATERILPFELLTGSFCLSSAVTVISSFVVFGEIFRS---PIY 318

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLL------- 424
              + N++ T+ G  L+    S A+GSL  G+ ++ T     + +  C   ++       
Sbjct: 319 LQLLQNISVTKTGLFLIFPSISVAVGSLVTGWVLRNTK----MNLAHCAYQIIFGGMVTQ 374

Query: 425 ------GHLQINLMKPDI--------------ATWRQFILL---VIPGFGYSVLITVALL 461
                 G+L +  + PD               + W + I +   V+  FGY+ L+   L+
Sbjct: 375 LLGLGMGYLLLGHLYPDYTVYDMLESITFKSHSIWWKLIYVFASVLVSFGYACLLVATLV 434

Query: 462 AMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
           +++  V  +     T + Y +RS G+ LG S+    +  SL+ +L
Sbjct: 435 SIVFTVEKSQQGTMTGVFYLWRSIGNVLGASLTLVSYENSLSSML 479

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 131/468 (27%), Positives = 206/468 (44%), Gaps = 35/468 (7%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           +WI TAYL++S +FQPLYG  SD  GR+  L   N  F +GCL CG + + + L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG----- 231
           +      + ++ +I  SD++P   R ++Q   N   G G  C        +  GG     
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICG-------ASFGGTIASS 117

Query: 232 -GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNS-----PASIKNKLLSVDWIGXXXX 285
            GWR  FLIQVP+S +SS+L+  ++       R NS     P  I   L  +D +G    
Sbjct: 118 IGWRWCFLIQVPISVISSILMNYYVPNQKEYNRQNSSIFQNPGKI---LRDIDVMGSILI 174

Query: 286 XXXXXXXXXXXXXG--GKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLR 343
                        G    ++++ S + + L +GS +    FI  E   +   I+P+  + 
Sbjct: 175 ITGLTLQLLYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVN 234

Query: 344 NR---SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL-MPNFFSTALGSL 399
           +     VL  S    F   A + T   LP+++  VL  +  + G RL +P+ F T +GSL
Sbjct: 235 SSYSVVVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSL 290

Query: 400 GAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVA 459
             G+ M +      L     +L  LG+     ++     W   + L+    G  +     
Sbjct: 291 ITGFSMSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPNWLIGLFLIPANLGQGITFPTT 350

Query: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPR 519
           L   I     +  A  TS  Y FRS GS  GV+I   + + S  GLL   +    D++  
Sbjct: 351 LFTFIFMFSKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFAGLLRSNLKGLLDENKI 410

Query: 520 KELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCS 567
           K+L   I + S +S ++     E ++ T+I  +  A K   L  TL S
Sbjct: 411 KKL---IVQLSANSSYIGSLHGE-VKNTVIKSFDEATKRAHLMSTLLS 454

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  149 bits (377), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 146/545 (26%), Positives = 237/545 (43%), Gaps = 87/545 (15%)

Query: 59  DNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISW 118
           D E D RD        P+    I LS++L   + A DGT++ST M  IAS F E  +++W
Sbjct: 36  DLEKDFRD--------PNTFPYILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTW 87

Query: 119 IATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISX 178
           +ATAY+L++   QPLYGK SD+ GRK  L+   +VF+VG +MCG   +   L+ AR I  
Sbjct: 88  VATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICG 147

Query: 179 XXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXX----WFSDHGGGWR 234
                + +MC+I +SD+ PL  R++Y G  +  +G   +           WF     G R
Sbjct: 148 VGGSGLGAMCNIILSDLAPLSQRSIYWGWGSVIWGFSQSVGGPLGGLLLNWF-----GVR 202

Query: 235 MAFLIQVPLSALS-SLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXX 293
             F++Q+P    S SL +     L  ++         +     +D+ G            
Sbjct: 203 GLFVVQIPFCLFSLSLTVKYIHDLSNQT---------QGTWRDIDFAGSFCLITGISAFI 253

Query: 294 XXXXXGGKEIAFNSKTF--VALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS- 350
                 G     ++ +   V   + + L+ + FI VE   A   ILP   L+    LG  
Sbjct: 254 FLCSSSGDVTDDSAVSLFKVGCFLITVLSVSGFIYVEKNVAAKSILPAEVLKGS--LGVI 311

Query: 351 SFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG- 409
           SF      M      + +P+Y   V  ++    G  +M    ST++GS G+G+ +++ G 
Sbjct: 312 SFIYGLASMLSYVGLFVVPLYLQLVWGVSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGA 371

Query: 410 --------KYYWLTVGFCTLSLLGHLQI--NLMK------------PDIATWRQFIL-LV 446
                       + +G   ++ LG   +  N+++            PD   W  F+L   
Sbjct: 372 PDKDATLLNSGMMLIGSTLINTLGFFVMFKNILEIKPAFEGVKSPSPDQKFW--FLLGFA 429

Query: 447 IPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
           I G          +L  +A V     A++TS+++ FRS G+ L VSI  ++F  SL G L
Sbjct: 430 IMGLSAGFQSVSVMLYTVAKVGRKGQASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKL 489

Query: 507 S-----------RKVLK-----FADKHPR---KELLEIIEKASKSSEWVHDSAPEFIRPT 547
                       RK+LK      + + P    K+LL++ + A   + W          P+
Sbjct: 490 KSYFQGQQSDLYRKLLKENAFLRSGEVPSDQLKDLLQVFKSAIVKAFW----------PS 539

Query: 548 LIGCY 552
           ++ C+
Sbjct: 540 VVCCF 544

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 134/470 (28%), Positives = 215/470 (45%), Gaps = 77/470 (16%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S+++G FL + D T+V+ IM  +A EF E  +  WI T++LL++  FQPLYGKLSD+
Sbjct: 42  ILYSLWMGSFLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  LM+ +  FLVGCL   L+ +      AR +       ++++ SI++SDI   ++
Sbjct: 102 AGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKE 161

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAV------F 254
           R +YQG  N  FG G+        W  D   GW++ F  QVPL  ++ + +         
Sbjct: 162 RGVYQGYANVVFGTGSMLGGPIGGWLMD-SFGWKVIFAGQVPL-IMTCMFLGYRNVNIKL 219

Query: 255 MKLPPRSKRVNSPASIKNKLL--SVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA 312
           + +PPR +R     +IK   L  S+  IG                            F+ 
Sbjct: 220 LHVPPRHERYRWE-NIKRIDLGGSISLIGTI------------------------SGFLC 254

Query: 313 LC----------IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMM 362
           LC            + L+   FI  ELY A + I+P   L     + S  + +   +A  
Sbjct: 255 LCSTDLNKPLLATLTLLSLVLFIMNELYWAPERIIPTDLLSGTFGITSLLTVFSSFIAFG 314

Query: 363 TTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG------KYYWLTV 416
              +  P+Y   V N++PT  G  L+ +  S+AL SL  G+ ++ T        Y  +T+
Sbjct: 315 DV-FRNPVYLQLVQNISPTSTGGFLLFSSISSALASLATGWILRNTSLGLATCSYLLITI 373

Query: 417 GFCT--LSL-LGHLQINLMKPDIAT--------------------WRQF--ILLVIPGFG 451
             C   +SL LG+  I+ ++P+  +                    WR    I +++  +G
Sbjct: 374 AVCLHFISLSLGYTTISHLEPNPTSHVSALDTSGTNYWFTSNQFRWRVLYVIAMILNSWG 433

Query: 452 YSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQS 501
           Y+ L+   L++++  +P +  A  T   Y +RS G+ LG S    IF  S
Sbjct: 434 YASLLVATLVSIVFTIPKSQQATITGCFYLWRSIGTVLGASSVLTIFESS 483

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 144/548 (26%), Positives = 229/548 (41%), Gaps = 54/548 (9%)

Query: 53  TDYGSIDNE--DDSRDGVASSPVPPDK---LLVITLSMYLGIFLAAADGTLVSTIMAHIA 107
           +D G    E  DD +  +     P  +   L +I  ++Y  +FL+  D T+ ++    I 
Sbjct: 36  SDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIG 95

Query: 108 SEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSF 167
           +EFN +   SWI  +YL++S +FQPLYG  SD+ GR+  L   +++F +GCL CG++ + 
Sbjct: 96  NEFNHMDLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINI 155

Query: 168 WGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFS 227
             L   R  +      + ++ +I  SD++P   R ++Q   N   GLG  C        +
Sbjct: 156 LWLSFMRAFTGIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICG-------A 208

Query: 228 DHGG------GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK--LLSVDW 279
             GG      GWR  FL+QVP+S   +L+  ++++     +R  S  S + K  L  +D+
Sbjct: 209 SFGGVITSSIGWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDF 268

Query: 280 IGXXXXXXXXXXXXXXXXXGGKEI----AFNSKTFVALCIGSSLACAFFIGVELYGAKDP 335
            G                 G         ++S    A+ + S +    F+  E   +   
Sbjct: 269 SGAFLIIIGLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARA 328

Query: 336 ILPLSFLRNRS---VLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL-MPNF 391
           I+P   +R+     VL  S    F   A + T   LP+++  +L  +  + G RL +P+ 
Sbjct: 329 IIPSKLVRSLFSFLVLTISVLVGFASYAYLFT---LPLFFQVILGDSTAKAGLRLAIPSV 385

Query: 392 FSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFG 451
           F T +G L AG  M +      L         LG+     +  D         L+    G
Sbjct: 386 F-TPVGGLIAGICMSKFNCLQTLLYVGIAFMCLGNFLFLYIGADATDSLIGFFLIPANLG 444

Query: 452 YSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAI--------FRQSLN 503
             +    +L   I A      A  TS  Y FRS GS  GV+    I          ++L 
Sbjct: 445 QGITFPSSLFTFIFAFSKIDQATATSTLYLFRSIGSVWGVTGSAGIVQFCFSHHLEKALE 504

Query: 504 GLL-SRKVLKFADKHPR-----KEL-----LEIIEKASKSSEWVHDSAPEFIRPTLIGCY 552
           GLL  RK+ K   K        KEL     + +IE    +++ VH  +  F    LI C 
Sbjct: 505 GLLDERKIRKLIKKITSNTSYIKELEGPVKVAVIESFDTATKKVHLISTSFCLVALILC- 563

Query: 553 HFACKDTF 560
               KD F
Sbjct: 564 --VIKDVF 569

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 125/458 (27%), Positives = 197/458 (43%), Gaps = 35/458 (7%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           +WI TAYL++S +FQPLYG  SD  GR+  L   N  F +GCL CG + + + L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG----- 231
           +      + ++ +I  SD++P   R ++Q   N   G G  C        +  GG     
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICG-------ASFGGTIAST 117

Query: 232 -GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPAS-----IKNKLLSVDWIGXXXX 285
            GWR  FLIQVP+S +SS+L+  ++   P  K  N   S      K  L  +D +G    
Sbjct: 118 IGWRWCFLIQVPISMISSILMNYYV---PNQKEYNDQNSNIFNDPKKILTGIDVMGSILI 174

Query: 286 XXXXXXXXXXXXXG--GKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLR 343
                        G     +++ S + + L  GS +    FI  E       I+P+  + 
Sbjct: 175 ITGLTLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVS 234

Query: 344 NR---SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL-MPNFFSTALGSL 399
           +     VL  S    F   A + T   LP+++  VL  +  + G RL +P+ F T +GSL
Sbjct: 235 SSYSFVVLSISILVGFASYAYLFT---LPLFFQIVLGDSTAKAGLRLTIPSLF-TPVGSL 290

Query: 400 GAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVA 459
             G+ M +      L     +L  LG+     ++     W   + L+    G  +     
Sbjct: 291 ITGFSMSKYNCLRSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTT 350

Query: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPR 519
           L   I   P +  A  TS  Y FRS GS  GV+I   + + S    L   +    D++  
Sbjct: 351 LFTFIFMFPKSDQATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTI 410

Query: 520 KELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACK 557
           K+L   + K S +S ++     E ++  +I  +  A K
Sbjct: 411 KKL---VIKLSDNSSYIGSLHGE-VKSAVIKSFDAATK 444

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  139 bits (351), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 172/360 (47%), Gaps = 46/360 (12%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I +S++LG FL++ D T+V+ IM  +A EF E     WIAT++LL++  FQPLYGKLSDI
Sbjct: 36  ILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDI 95

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  L+     F +GC +  L+ +      AR I       + ++ SIT+ DI   +D
Sbjct: 96  TGRKFALLTALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKD 155

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKL--- 257
           R +YQG  N  FG+G          F     GWR  F IQVPL  ++ +L  +++ +   
Sbjct: 156 RGIYQGYANIVFGMGQLLGAPVGGLFI-ATIGWRALFWIQVPLVIIAIILGEMYVNIKLV 214

Query: 258 --PPRSKRVNSPASIKNKLLS-VDWIGXXXXXXXXXXXXXXXXXGGKEI---AFNSKTFV 311
             PP S+R       K K +S +D++G                     I     +  +F+
Sbjct: 215 HVPPPSER------FKWKNISRIDFLGSFTLVSSITCFIILISTKSNVILLSLLSVLSFI 268

Query: 312 ALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYL--- 368
           A           FI VELY +KD ILP   L+     GS   N    +A + +SY +   
Sbjct: 269 A-----------FIYVELYVSKDRILPFELLK-----GSFGCN---SIATVISSYVIFGE 309

Query: 369 ----PIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLL 424
               PIY   V + +  + G  L+    +TA+GSL  G  +KRT     L + +C+  L+
Sbjct: 310 IFRSPIYLQLVQDFSVIKTGIFLIFPAITTAIGSLVTGAILKRTK----LDLAYCSYKLV 365

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  138 bits (347), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 136/503 (27%), Positives = 215/503 (42%), Gaps = 63/503 (12%)

Query: 56  GSIDNEDDSRDGVASS------PVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASE 109
           GSI  E++   G+          +P   +LV   S++LG FL A DGT+V+ +M  IA E
Sbjct: 14  GSISEENECDVGLEREYHEHNLALPKIPILV---SLWLGSFLVALDGTIVANVMNRIAEE 70

Query: 110 FNELPRISWIATAYLLSSATFQPLYGKLSDI-FGRKPLLMLNNIVFLVGCLMCGLTPSFW 168
           F E  +  WIAT++LL++  FQPLYGKLSD+  GRK   ++    F +G ++     +  
Sbjct: 71  FQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVT 130

Query: 169 GLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSD 228
                R +       V++M SI +SDI   ++R +YQG  N  FG               
Sbjct: 131 QFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYANIVFG-SGQLLGAPLGGLLI 189

Query: 229 HGGGWRMAFLIQVPLSALSSLLIA-----VFMKLPPRSKRVNSPASIKNKLLSVDWIGXX 283
              GWR  F IQVP++     L           LP R++R     ++KN L  +D +G  
Sbjct: 190 TTIGWRAIFAIQVPMALFCMFLTGRNVNIKLAHLPSRNERF----TLKN-LSRLDLLGSC 244

Query: 284 XXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLR 343
                                 ++ T V   I        FI  E + AK+ I+P   L 
Sbjct: 245 TLVLSISGLLFLFSTSMNRTWISAFTIVTFAI--------FIYNERFWAKERIIPFDLLC 296

Query: 344 NRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGY 403
             S + +S         M    +  PIY   V N++  + G  ++    + A  S+  G+
Sbjct: 297 GTSGI-TSLLTVLSSFIMFGDVFRSPIYLQIVQNVSLAKSGIFILFGSVACAATSVLTGW 355

Query: 404 YMKRTGK-----YYWLTVGFCTLSLLGH-----LQINLM-------KPDIA--------- 437
            ++RT        Y + +    L L+G      L  NL+         D+A         
Sbjct: 356 IIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIANLIPNNTTYADKDVAIKVALSAKG 415

Query: 438 -TWRQFILL--VIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIG 494
            TW+   +   V+  FGY  ++   L++++  VP +  A  T + Y +RS G+ LG SI 
Sbjct: 416 FTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPKSQQATLTGVFYLWRSIGNVLGTSIT 475

Query: 495 GAIFRQSLNGLLSRKVLKFADKH 517
            A++    + +L  K+  F + H
Sbjct: 476 LALY----DLILKSKLRVFMEAH 494

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  137 bits (345), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 123/457 (26%), Positives = 203/457 (44%), Gaps = 43/457 (9%)

Query: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134
           P    ++ LS++L   + A DGT++ST M  +AS F E   ++W+ATAY+L++ + QPLY
Sbjct: 47  PKTFPLVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLY 106

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           GK SD+ GRK  L+   +VF++G ++CG+  +   L  AR I       + +MC+I +SD
Sbjct: 107 GKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSD 166

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXX----WFSDHGGGWRMAFLIQVPLSALSSLL 250
           + PL  R++Y G+ +  +G   +           WF   G      F+IQVP   L SL 
Sbjct: 167 LAPLSQRSIYWGLGSLIWGFSQSIGGPLGGLLLNWFGVSG-----LFVIQVPF-CLFSLF 220

Query: 251 IAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTF 310
           + V        +R       +     +D+ G                 G    + +   F
Sbjct: 221 LTVRYIHDLTDQR-------QGTWRDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPF 273

Query: 311 VALCIGSSLAC-AFFIGVELYGAKDPILPLSFLRNR-SVLGSSFSNWFCMMAMMTTSYYL 368
             +C+  ++A  A F+ VE   A   ILP   L+    V+G  +      M      + +
Sbjct: 274 KVVCLIVTIAAVAGFVVVEKRMATKSILPAHVLKGSLGVVGLIYG--LSSMLSYVGLFIV 331

Query: 369 PIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCT-LSLLGHL 427
           P+Y   V   +    G  ++    ST++GS  +G+ ++R G     T  F + + L+   
Sbjct: 332 PLYLQVVWGTSVAGSGGYIIYAVVSTSVGSFSSGWLLRRYGSPTRCTTLFNSGIMLVSST 391

Query: 428 QINLM--------------------KPDIATWRQFIL-LVIPGFGYSVLITVALLAMIAA 466
            IN++                     P  +    F+L  VI G          +L  +A 
Sbjct: 392 LINVLGFAILFRNILSISPNFENTGGPSGSQKFWFLLGFVIMGCSQGFQNVSVMLYTVAK 451

Query: 467 VPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLN 503
           V     AA+TS+++ FRS G+ L VSI  +++  SL 
Sbjct: 452 VGRKGQAASTSVTFLFRSLGNVLSVSIALSVYVASLK 488

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score =  134 bits (336), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 126/461 (27%), Positives = 201/461 (43%), Gaps = 50/461 (10%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I +S++LG FL A DGT+V+ +M  IA EF E  +  WIAT++LL++  FQPLYGKLSD+
Sbjct: 42  ILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDV 101

Query: 141 -FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLR 199
             GRK   ++    F +G ++     +       R +       + +M SI +SDI   +
Sbjct: 102 ATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAK 161

Query: 200 DRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPP 259
           +R +YQG  N  FG                  GWR  F IQVP++ L   ++  F  +  
Sbjct: 162 ERGMYQGYANIVFG-SGQLLGAPLGGLLITTLGWRAIFAIQVPVTLLC--MVLAFRNVNI 218

Query: 260 RSKRVNSPA---SIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIG 316
           +   +  P    ++KN L  +D +G                  G    F S T   L I 
Sbjct: 219 KLAHLPPPKECFTLKN-LSRLDLLG---------SCTLVMSISGLLFLF-STTLNKLWIS 267

Query: 317 SSLACAF--FIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSG 374
              A +F  F+  E Y A + I+P   LR  S + S+ +       M    +  PIY   
Sbjct: 268 IFTAVSFGLFVYNEYYWATERIIPFELLRGESGVTSALTV-LSSFVMFGDVFRSPIYLQV 326

Query: 375 VLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG----KYYWLTVGFCTLSLLGHLQIN 430
           V N++  R G  ++    + A  S+  G+ ++RT     K  +L V    +S L    IN
Sbjct: 327 VQNVSLARSGLFILFGSIACAGSSMLTGWLIRRTNMGLVKCAYLIVLGMIISQLAGTAIN 386

Query: 431 -----------------------LMKPDIATWRQFIL--LVIPGFGYSVLITVALLAMIA 465
                                   ++P+   W+   +   V+  FGY  ++   L++++ 
Sbjct: 387 AVLIAKLKPNQTSHALTDSITQQTLQPEGLLWKIIYVSATVLNTFGYGGVLVAVLVSIVF 446

Query: 466 AVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
            VP +  A  T + Y +RS G+ LG S+   ++  +L   L
Sbjct: 447 TVPKSQQATLTGVFYLWRSIGNVLGTSVTLTLYDLTLKAKL 487

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  126 bits (317), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 118/486 (24%), Positives = 207/486 (42%), Gaps = 77/486 (15%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
           LS+++  FLA+ D T+++ IM  +  EF E  RI W+AT++LL+S  FQP+YGKLSD+ G
Sbjct: 51  LSLWMANFLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTG 110

Query: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRA 202
           R+ +L+L   +FL+GCL+     + W     R I       + +MC IT+ D+  +++++
Sbjct: 111 RRFVLVLAYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQS 170

Query: 203 LYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKL----- 257
           +YQ   +  + +G           +    GWR  FL QVP+     L I +++ L     
Sbjct: 171 IYQSYAHIIYTIGEVLGAPIGG-IALETVGWRAIFLAQVPV-----LTICIYLTLCDDDL 224

Query: 258 -----PPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA 312
                PP  +R+              W                   G   I  +S T + 
Sbjct: 225 AQQHIPPHGERLT-------------WKNISRMDLSGSILLIISLCG--VILLSSATIIE 269

Query: 313 -----LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYY 367
                L I S+     FI  ELY   + I+P  F + +  +G +         +  +  Y
Sbjct: 270 YWMWLLVIASA---GLFIINELYWVSECIIP--FRKLKGAIGLTSLLLLVSSFIEYSELY 324

Query: 368 -LPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRT-------------GKYYW 413
             P++   V NM+ +  G  L+ +  ++A+ +L +G+ ++ T             G    
Sbjct: 325 RTPLFLQLVQNMSTSTTGVVLLFSSAASAVATLLSGWVLRTTRTNLGEASFNHMFGSMTL 384

Query: 414 LTVGFCTLSLLGH--------LQIN--------LMKPDIATWRQFILLVIPGF--GYSVL 455
              G  T+ +L H        +Q+         +M  D A W+   +  +     G++ L
Sbjct: 385 QVAGLTTILVLIHFLNPDQSSIQVTSEHRLAPFMMNSDSAVWKIIYVAALSTVSSGHAGL 444

Query: 456 ITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFAD 515
           +   L ++         A  T   Y FR  GS LG S   +++      +LS+++  + D
Sbjct: 445 LVSTLTSIFVHTETPDRAMFTGAFYLFRYIGSVLGASTALSVYE----SVLSKRLWNYLD 500

Query: 516 KHPRKE 521
            +  K+
Sbjct: 501 LNNMKD 506

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score =  126 bits (316), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 123/494 (24%), Positives = 215/494 (43%), Gaps = 66/494 (13%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++LG FLA+ D ++V+ IM  IA EF+E  +  W+AT++LL++A FQPLYG+ SDI
Sbjct: 46  ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDI 105

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GRK  L++    FL+G L+     +      AR I       + +M SIT+SDI   ++
Sbjct: 106 VGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKE 165

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAV------F 254
           R +YQG  N  FG G            +    WR+ F  QV ++ +  +++A        
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIME-TFNWRIIFAAQV-VAIMICMILAYRNINLKL 223

Query: 255 MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALC 314
           + +PP  +R       +  L  +D  G                 G     +   T V+L 
Sbjct: 224 LHIPPFHQRFT-----RKNLSRIDLFGSSMLSCSLVSFLMLFSSGVSRSLWFLLTLVSLT 278

Query: 315 IGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSF--SNWFCMMAMMTTSYYLPIYY 372
           +        F   E Y A + +LP   LR    L +     + F M A +   Y +P+Y 
Sbjct: 279 L--------FCINERYIATERLLPNGILRGHFGLSALLIVVSSFMMFAEL---YRMPVYL 327

Query: 373 SGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGK-----YYWLTVGFCTLSLLGHL 427
             + +++ +R G  L+    S++  SL  G+ ++ T +      Y + +    + L+G +
Sbjct: 328 QLIQDISVSRSGIFLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMM 387

Query: 428 ----------------------------QINLMKPDIATWRQF--ILLVIPGFGYSVLIT 457
                                       Q++  K D   WR    + L+   F Y+ L+ 
Sbjct: 388 LALFTTSVTEPSQAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLV 447

Query: 458 VALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKH 517
             L++++     +  A    + Y +RS G+TLG S+  +++       ++RK+  + +  
Sbjct: 448 SILVSIVDTTEKSQQATMIGVFYLWRSIGNTLGASVPLSVYEFE----VARKLWDYMEAQ 503

Query: 518 P-RKELLEIIEKAS 530
             R   L+++  +S
Sbjct: 504 GLRDTYLDLLHDSS 517

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score =  101 bits (251), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 203/497 (40%), Gaps = 53/497 (10%)

Query: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           +F+ A D  +V TI+  +   F +  +  WI T Y L +A F  L+ +LS + G +  ++
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMC 208
              I+F  G L+  L  S   L+  R ++      + ++  +    +V  + R L   + 
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 209 NFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFM------------K 256
           N  F + +         F+ H   WR  F I +P+  L+   IA+F+            K
Sbjct: 174 NCTFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLA---IAIFVFFYNPEGVNLLEK 229

Query: 257 LPPRSKRVN-------SPASIKNKLL-SVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSK 308
                K+V+       SP  +  +LL   D +                  GG+  A+NS 
Sbjct: 230 FGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSG 289

Query: 309 TFVA------LCIGSSLACAF--FIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMA 360
             ++      L I  SL   F  F  ++   +  P+L    + NRS+L S+F+ +F  +A
Sbjct: 290 IVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVA 349

Query: 361 MMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCT 420
                 Y   ++  V   +  + G  L+P   ST + S+ +G   K+TG    L V    
Sbjct: 350 YNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIKPLLVFGSA 409

Query: 421 LSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA------A 474
           + +LG   + L+        Q  +L++PG     ++  AL+A    +   + +       
Sbjct: 410 MGVLGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKGNPSYGADLLE 469

Query: 475 TTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFAD---------------KHPR 519
           TTS++   +S G+TLG  +   +F  S+N  +    L   +                 PR
Sbjct: 470 TTSVNALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSLEEYDRLDGIASYRMDHFDGPR 529

Query: 520 KELLEIIEKASKSSEWV 536
            E+  I+  + K++ W+
Sbjct: 530 SEMGYILSDSIKNAFWM 546

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 85/164 (51%), Gaps = 8/164 (4%)

Query: 51  QGTDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110
           +G      D E D RD        P     +  S++    L+A DGT+VST +  +AS F
Sbjct: 82  EGNKEDEEDLEIDLRD--------PKTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRF 133

Query: 111 NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL 170
            +   ++W+ATAYLL++   QPLYGK+SDI GR+  L+   IVF VG  +C  + S   L
Sbjct: 134 QQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQL 193

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
             AR I         +M +I +SD+ PL +R  Y G  +   G+
Sbjct: 194 AIARGICGIGGSGTGAMTNIILSDMAPLSERGKYWGYGSMLGGV 237

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 118/271 (43%), Gaps = 37/271 (13%)

Query: 323 FFIGVELYGAKDPILPLSFLRNRSVLGS-SFSNWFCMMAMMTTSYYLPIYYSGVLNMNPT 381
            F+ VE Y A + I+P+  L+    LG  +F      M   T  + +P++   V  ++ +
Sbjct: 341 LFLVVEKYVALENIIPMEVLKG--TLGLLAFIQGLVSMINYTELFIVPLFLQLVWGISVS 398

Query: 382 RVGKRLMPNFFSTALGSLGAGYYMKRTGK--------YYWLTVGFCTL-SLLGHL----Q 428
             G  ++    S ++GSL +G  +K+  K        Y  +++ + +L S++G+      
Sbjct: 399 TSGAYIVCIVISYSVGSLLSGALIKKVAKPSRESTIYYSGVSIFYMSLISMVGYYFLDRA 458

Query: 429 INLMKP---DIATWRQFILLVIPGFGYSVL--------ITVALLAMIAAVPHNHHAATTS 477
           +   KP   D          +I  FG ++L        +T+ +L  +A V     A++TS
Sbjct: 459 VRYTKPVYGDTKVPESLNFQLI--FGITLLGLCQGSQGVTI-MLYNVAKVGRKGQASSTS 515

Query: 478 ISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVH 537
           + + FRS G+ L VS+   +F  +L     RK L         EL  ++ K   ++   +
Sbjct: 516 VQFLFRSLGNVLSVSLAFNVFTNAL-----RKTLGKVLAGKNDELFALLLK--DNAFLRN 568

Query: 538 DSAPEFIRPTLIGCYHFACKDTFLFCTLCSI 568
              P     +++  +H A   +F+ C  C I
Sbjct: 569 KDMPTDDLDSILEAFHKALVSSFVPCIWCLI 599

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 97.8 bits (242), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 72/114 (63%)

Query: 91  LAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLN 150
           LAA DGT+VST +  IAS+F +   ++W+ATAYLL++   QPLYGK+SDI GR+  L+  
Sbjct: 72  LAALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFG 131

Query: 151 NIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALY 204
            ++F +G L+C    +   L  AR I        ++M +I ++DI+PL  RA Y
Sbjct: 132 EVIFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATY 185

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 116/314 (36%), Gaps = 64/314 (20%)

Query: 311 VALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMM-----TTS 365
           V L I S +A AF   +E + A + I+P      R +L  +     C+  ++     T  
Sbjct: 289 VVLLIVSIIAFAF---IENFVAVECIIP------RVILEGTLGLMVCIHGLVAVINYTCL 339

Query: 366 YYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLG 425
           + +P++      ++ +R G  +M     ++ GSL     + R  K    +  FC  S + 
Sbjct: 340 FMVPLFLQLNWGVSVSRSGGYIMFIVIFSSAGSLFTSMILNRFSKPTRSSQLFCAASAIF 399

Query: 426 HLQI----------------------NLMKPDIATWRQFILLVIPGFGYSVLITVALLAM 463
           ++ I                      +   P    W   + + I GF          +  
Sbjct: 400 YMSILTIVGYYYMQKAIYYSKPIYGSDTQIPKYDNWSIILGIAILGFCQGSQNVTISIYN 459

Query: 464 IAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELL 523
           +A V     A++TS++  FRS G+ L VSI   IF   L                 K+ L
Sbjct: 460 VAKVGRKEQASSTSVNLLFRSMGNVLSVSIALNIFTNVL-----------------KKKL 502

Query: 524 EIIEKASKSSEWVHDSAPEFIR----PT-----LIGCYHFACKDTFLFCTLCS-IGTLAS 573
            I+         V      F+R    PT     ++G +H A   + + C  C  I  + S
Sbjct: 503 SIVLNDDLDLLAVLLKDNAFLRSDIMPTERIGPILGAFHDALGTSIVPCKWCVYISLILS 562

Query: 574 ISI-IKEYKLHASL 586
           + + + EY+ H  L
Sbjct: 563 LMLFVTEYRQHKDL 576

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/493 (21%), Positives = 198/493 (40%), Gaps = 42/493 (8%)

Query: 51  QGTDYG-SIDNEDDSRDGVASSPVPPD-------KLLVITLSMYLGIFLAAADGTLVSTI 102
           Q ++Y   I +E        S+ + PD       KL +  LS+ L +F+ A D  +V TI
Sbjct: 8   QNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFLSLLSLGLSMFVTALDVLIVGTI 67

Query: 103 MAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG 162
           +  + + F +  +  WI T Y L +A F  L+G+LS + G +  ++   I+F  G L+  
Sbjct: 68  IDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLISA 127

Query: 163 LTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXX 222
           L  S   L+  R I+      + ++  +    +V  + R L   + N  F + +      
Sbjct: 128 LAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFL 187

Query: 223 XXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLS------ 276
              F+ H   WR  F I +P+  L ++ I +F   P  +  +   +    KLLS      
Sbjct: 188 GGAFTTH-VTWRWCFYINLPIGGL-AIAIFIFFYNPEGADLLEKGSQTFKKLLSYRRANL 245

Query: 277 ------------VDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACA-- 322
                        D +                  GG+   + S   ++  I   L  A  
Sbjct: 246 SLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVISFIIVGVLLIALS 305

Query: 323 ------FFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVL 376
                  F  ++      P+L    +  R++L ++F+ +F  +A      Y   ++  V 
Sbjct: 306 LIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVY 365

Query: 377 NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDI 436
             +  + G  L+P   ST + S+ +G  +K+TG    L V    + +LG   + L+    
Sbjct: 366 GFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTS 425

Query: 437 ATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA------ATTSISYAFRSTGSTLG 490
               Q  +L++PG     ++  AL+     +     +       TTS++   +S G+T+G
Sbjct: 426 TKHTQIGVLILPGVALGFVLPAALITCHVQLDRTSPSYGADMLETTSVNALLKSLGTTVG 485

Query: 491 VSIGGAIFRQSLN 503
             +   +F  SL+
Sbjct: 486 SILSTMVFSTSLH 498

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 106/483 (21%), Positives = 197/483 (40%), Gaps = 49/483 (10%)

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGR 143
           S+ L +FL+A D  +VSTI+  ++ +FNE  +  W+ T Y L +A    ++G+ + I G 
Sbjct: 48  SLTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGF 107

Query: 144 KPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRAL 203
           K  ++L+ I+F VG L+  L  S   L+G R IS      + ++C + IS +V  R R +
Sbjct: 108 KSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGM 167

Query: 204 YQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL------------I 251
              + +  F + +         F+ H   WR  F I +P+  L+ L+            I
Sbjct: 168 AISVLSCSFAVASIVGPFLGGAFTTH-VTWRWCFYINLPIGGLAFLVFVLSYNPNGGNSI 226

Query: 252 AVFMKLPPRSKRVNSPASIKNK---------LLSVDWIGXXXXXXXXXXXXXXXXXGGKE 302
             F K       V+    +K K         +   D++G                 GG E
Sbjct: 227 KNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGFCLILLGLTFGGNE 286

Query: 303 IAFNSKTFVA-LCIGSSLACAFFIGVELYG--------------AKDPILPLSFLRNRSV 347
            ++ S T +A L IG  L+ AFF    LY                  P++  + +    V
Sbjct: 287 YSWGSGTIIAYLVIGIVLSIAFF----LYDFFVFNRFKAPRENMVYRPLVSWNVISKPGV 342

Query: 348 LGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKR 407
           + ++  N+   +       Y+  ++  +      + G  L+     T +    +G    +
Sbjct: 343 ITATAVNFTICLMYNAQVIYIVQFFQLIHGSTAWKAGIHLIACVVPTIITVNISGIINGK 402

Query: 408 TGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAV 467
           TG   ++ V     +++G   + L+  +  + +   LL++PG  +  +I   L++    +
Sbjct: 403 TGHVKFIIVVGVVAAIVGAGLLTLLDNNSGSSKHIGLLILPGIAFGAIIQSTLMSSQIQI 462

Query: 468 P-------HNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRK 520
                   H+  + TT  S+A ++ G+  G  I   +F  S++  L    L         
Sbjct: 463 DKSSPSFRHDFISVTTINSFA-KALGTAFGGVISNTVFTTSVHNKLVESHLNLPTGSSAS 521

Query: 521 ELL 523
           +L+
Sbjct: 522 QLI 524

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 105/484 (21%), Positives = 190/484 (39%), Gaps = 45/484 (9%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
           +S+ L IFLAA D  +VSTI+ ++A EF +  +  WI   Y L SA    ++G+++ + G
Sbjct: 59  ISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCG 118

Query: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRA 202
            K  ++   I+F VG L+  L  S   L+G R I+      + ++C + IS +V    R 
Sbjct: 119 FKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRG 178

Query: 203 LYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS- 261
           L        FG+ +         F+ H   WR  F I +P+  L+     +F   P  S 
Sbjct: 179 LLIACMGSAFGIASVVGPFLGGAFTTH-VTWRWCFWINLPIGGLAFAFFILFYN-PHGSD 236

Query: 262 -----------KRVNSPASIKNKLLSV--------------DWIGXXXXXXXXXXXXXXX 296
                      K+V        KLL +              D I                
Sbjct: 237 QTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHELIYKFDIIEFALCTTGLVLILLAL 296

Query: 297 XXGGKEIAFNSKTFVAL-CIGS-----SLACAFFIGVELYGAKD-----PILPLSFLRNR 345
             GG + A+NS + +A+  IG      +L   F I   L   ++     P++PL   +  
Sbjct: 297 SFGGNKYAWNSGSTIAMFVIGILVTILALVYDFAIFPRLKVVRENPRYQPLIPLRVAKKF 356

Query: 346 SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYM 405
            +  ++ + +F  MA M    Y+  ++  + N    +    ++     T +  + +G   
Sbjct: 357 FICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKASIHVIACVVPTVITVITSGILN 416

Query: 406 KRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALL-AMI 464
            + G    + V   T +++G   + L+           LL++PG  +   +   L+ + I
Sbjct: 417 SKFGIVKPINVLGITAAIVGAGLLTLLTNKSTNSEHIGLLILPGVAFGATMQSTLIGSQI 476

Query: 465 AAVPHNHH-----AATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPR 519
                + H      A T+++   ++ G   G  +   +F  S+   L +  +   D    
Sbjct: 477 QLDKKSTHYRMDFIAVTTMNNFLKNLGQAFGGVLCNTVFTTSILNKLKQNDITIGDHTTS 536

Query: 520 KELL 523
             L+
Sbjct: 537 DALI 540

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 120/537 (22%), Positives = 213/537 (39%), Gaps = 31/537 (5%)

Query: 58  IDNEDDSRD-GVASSP-VPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPR 115
           +D E ++RD  + + P +    + + +L ++  IF       L +T  +H+    N    
Sbjct: 177 VDLETNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNS--- 233

Query: 116 ISWIATAYLLSSATFQPLYGKLSDIFGR-KPLLMLNNIVFLVGCLMCGL-TPSFWGLVGA 173
            SWI  +YL++    Q L  ++S  +   K L  +  ++FL+G  +  + T SFW +V A
Sbjct: 234 -SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMA 292

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL--GTACXXXXXXWFSDHGG 231
           RFI       +  +  +TI +   L  R     M  F   +  G +       + +    
Sbjct: 293 RFILGLASGSLIYVM-LTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFIT---- 347

Query: 232 GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXX 291
            W+  + +    S  +  LI  +       K  N+  S     L +D IG          
Sbjct: 348 SWQNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLL 407

Query: 292 XXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSS 351
                       +  S     L I   L     +  E    K+PI+PL F+ N+ +   S
Sbjct: 408 IAVITTGNSNGFSITSPYSATLVISIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKS 467

Query: 352 FSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411
            + +F  M+++T  +Y P Y    LN++   + KR  P F +     +     +      
Sbjct: 468 LTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNTL 527

Query: 412 -YWLTVGFCTLSLLGH-LQINLMKPDIAT---WRQFILLVIPGFGYSVLITVALLAMIAA 466
            Y L   F  + L+G  + +N +  D A    W+Q ++ ++P  G + L+   L+ +   
Sbjct: 528 SYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDV--- 584

Query: 467 VPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEII 526
                    ++ S+A  + GS LG+ I G IF Q L   L      +      K L +II
Sbjct: 585 TDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGLYDEL------WVHSTEEKGLGKII 638

Query: 527 EKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYKLH 583
            K   +SE+  +S+  +    ++  Y       FLF  +C +  + S     + K H
Sbjct: 639 RKMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAICLLVAVISFCFTIKNKRH 693

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 99/511 (19%), Positives = 201/511 (39%), Gaps = 43/511 (8%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIF-GRKPLLMLNNIV 153
           D  +V+TI+  + + F+   +  WI   Y L +A    L+G+++  F G K  ++   ++
Sbjct: 74  DIMIVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVI 133

Query: 154 FLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFG 213
           F +G L+C L  S   L+G R I+      + S+  +  S +V  R R       +  FG
Sbjct: 134 FEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFG 193

Query: 214 LGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL----------------IAVFMKL 257
           + +         F+ H   WR  F I +P+ A++ ++                I    +L
Sbjct: 194 IASVIGPFIGGAFTSHVT-WRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLKEL 252

Query: 258 PPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVAL-CIG 316
             + K+V     +K+ L  +D I                  GG    + S + + L  IG
Sbjct: 253 SEKVKKVRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTFGGNRFKWGSYSIILLFVIG 312

Query: 317 SSLACA-------FFIGVELYGAK----DPILPLSFLRNRSVLGSSFSNWFCMMAMMTTS 365
             L           F  +++  A      P++    LR R +  +S + +F  +  M+ +
Sbjct: 313 GCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRGIFTASMTTFFFCIGYMSQT 372

Query: 366 YYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLG 425
            Y   ++  + N +P +    L+     T L ++  G+   + G    +TV    L+++G
Sbjct: 373 VYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIG 432

Query: 426 HLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVP------HNHHAATTSIS 479
              + L+     + +   LL++PG  +       ++A    +        +   A T+++
Sbjct: 433 AGLLTLLDNHSNSAQHIGLLILPGVAFGACNQCTMMAAQIELDKKSPTFKSDFVAVTTLN 492

Query: 480 YAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDS 539
              ++ G  +G  I  ++F     G +  K+ K +     + + ++I   ++  +     
Sbjct: 493 SFLKNCGQAVGSIISASVF----GGAVMNKIGKSSYHSEIRSVDDLIIYRAEHFDGARSV 548

Query: 540 APEFIRPTLIGCYHFA---CKDTFLFCTLCS 567
               I  ++   ++ A   C   FLF    S
Sbjct: 549 LGNMISDSVKDVFYMALGWCALAFLFAIFTS 579

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 106/471 (22%), Positives = 181/471 (38%), Gaps = 45/471 (9%)

Query: 78  LLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKL 137
           ++V   S+ + +FL A D  +  T+   I  EFN+   + W+   Y L +A F  L+G++
Sbjct: 6   VIVCVTSLCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRI 65

Query: 138 SDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVP 197
           + + G K  LM + ++F  G LM G   S   L+GAR IS      + S+     + IV 
Sbjct: 66  ASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVE 125

Query: 198 LRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKL 257
            + RA    +    + L            ++H   WR  F + +P+  ++  L A+    
Sbjct: 126 EKHRARVITVLGIAYMLAEGAGPFVGGGLAEH-VSWRWCFYVNLPIGGVA--LAALGWGY 182

Query: 258 PPRSKR---------VNSPASIKNKLLS--------------VDWIGXXXXXXXXXXXXX 294
            P  +          V + A     LL               +D  G             
Sbjct: 183 NPAGRAPGRALARFWVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFALVML 242

Query: 295 XXXXGGKEIAFNSKTFVALCI-GSSLACAFF---------IGVELYGAKD-PILPLSFLR 343
               GG + A+ S T V + + G++L   F          +G  + G +  P++P     
Sbjct: 243 ALTFGGNQYAWRSATIVCMFVFGAALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAA 302

Query: 344 NRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGY 403
           N  VL SS   +F   A    S YL  YY  V+N  PT     L        +  + +  
Sbjct: 303 NVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSVIASAV 362

Query: 404 YMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAM 463
             +R G    L +    +  +G   + L++ D    +     V+ G  +  +  ++L++ 
Sbjct: 363 VNERFGVVKPLVLAGVVMGFVGSGLLTLVRSDTTLGQSIGFSVLAGASFGCVYQLSLISA 422

Query: 464 IAAVPHNH---HAATTSISYAFRSTGSTLGVSIGG----AIFRQSLNGLLS 507
              V  +    HA    ++ ++ +   TLG S  G     +F  SL  L S
Sbjct: 423 QLQVERDDPDFHARFIEVT-SYNTFIKTLGFSFAGIVSTTVFTVSLKNLAS 472

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 96/454 (21%), Positives = 180/454 (39%), Gaps = 37/454 (8%)

Query: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           +F+ A D  +V TI+  +   F +  +  WI T Y L +A F  L+G++S   G +  ++
Sbjct: 53  MFVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIV 112

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMC 208
              ++F  G L+  L  S   L+  R +S      + ++  +    +V  + R L   + 
Sbjct: 113 ACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 172

Query: 209 NFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF-------------- 254
           N  F + +         F+ H   WR  F I +P+  ++ L    F              
Sbjct: 173 NCTFAIASIIGPFIGGAFTTH-VTWRWCFYINLPIGGVAILTFLCFYNPHNENLLEEGKK 231

Query: 255 -----MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKT 309
                +K  P S  + S  ++   L   D +                  GG+  +++S  
Sbjct: 232 AFKRVLKFKPTS--LFSSKAMHQLLFGFDIVSFALFTAGWVLFLLALTFGGQSYSWDSGV 289

Query: 310 FVAL--CIGSSLACAFFIGVELYGAKD------PILPLSFLRNRSVLGSSFSNWFCMMAM 361
            ++        +  + F   +L+ A        P+L    +   +++ S+FS +F  +A 
Sbjct: 290 VISFLVVGILLILLSLFYDFKLFEAMKSQENIRPLLCWRLMSQPTIVLSNFSGFFSTVAY 349

Query: 362 MTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTL 421
                Y   ++  V      + G  L+P   ST + S+ +G   K+TG    L V    +
Sbjct: 350 NVQMIYSVQFFQLVYGFTAWKAGLHLIPILVSTVVFSIMSGVLTKKTGHIKPLLVFGSAM 409

Query: 422 SLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA------AT 475
            +LG   + L+        Q  +L++PG     ++  AL+A    +  ++          
Sbjct: 410 GVLGGGLMTLLNNTSTKHTQIGVLILPGVALGFVLPSALIACHVQLDKSNSRYGADMLEV 469

Query: 476 TSISYAFRSTGSTLGVSIGGAIFRQSL-NGLLSR 508
           TS++   +S G+TLG  +   IF  S+ N + SR
Sbjct: 470 TSVNALLKSLGTTLGSILSTMIFSTSMYNKMKSR 503

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/497 (19%), Positives = 195/497 (39%), Gaps = 48/497 (9%)

Query: 60  NEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWI 119
           N  D R G++        L +   S+ L +F+ A D  +V TI+  +A +F    +  W+
Sbjct: 24  NSSDERGGIS--------LYLCLTSLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWL 75

Query: 120 ATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXX 179
            T Y L +A    ++G+ + I G +  L+L  ++F  G L+  L  S   L+  R ++  
Sbjct: 76  VTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGV 135

Query: 180 XXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLI 239
               + ++C +    +V  R R L   + +  F +           F+ H   WR  F I
Sbjct: 136 GGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYI 194

Query: 240 QVPLSALSSLLIAVFMKLPPRS-----------------KRVNSPASIKNKLLSV----D 278
            +P+   + ++  +  K    +                 +R+  P +++  L+ +    D
Sbjct: 195 NLPIGGFAVIMFLLTYKTKSENILQQTRNILGRISKFELRRLTEPGNLRKALIGILFKFD 254

Query: 279 WIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA-LCIGS-----SLACAFFIGVELYGA 332
           ++G                 GG + ++NS   +  L +G      SL   FFI  +    
Sbjct: 255 FLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIITYLVLGILLFVFSLIYDFFIFQKFNPE 314

Query: 333 KD-----PILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL 387
            D     P+     +   +V+  +   +   +       Y   ++  +   +  + G  L
Sbjct: 315 PDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGYNGQMIYSVQFFQLIFASSAWKAGLHL 374

Query: 388 MPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVI 447
           +P   +  + ++ +G   K+ G    L +    L ++G   + LM  +  +  Q  +L++
Sbjct: 375 IPIVITNVIAAIASGVITKKLGLVKPLLIFGGILGVIGAGLMTLMSNNSTSSTQIGVLIL 434

Query: 448 PGFGYSVLITVALLAMIAAVPHNHHAATTSISY--AFRSTGSTLGVSIGGAIFRQSLNGL 505
           PG      +  +L++    +  +   ATT      AF +   +LG ++GG +     +  
Sbjct: 435 PGLSLGFALQASLMSAQLQIKKDRPEATTDFIEITAFNTFMKSLGTTLGGVLSTTVFSAS 494

Query: 506 LSRKVLKFADKHPRKEL 522
           L  KV     KH + E+
Sbjct: 495 LRNKV-----KHAQLEM 506

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 109/472 (23%), Positives = 182/472 (38%), Gaps = 51/472 (10%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +V T+   I  +F++   I W+ T Y L++A F  L+G+L++I G    LM++ I+F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            VG L+  L+ S   L+  R I+      + S+  +  + IV    R          + +
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF----MKLPPRS--KRVNSPA 268
                      F++H   WR  F I +P+ A + +++A        LP  S   ++ S  
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIM 202

Query: 269 SIKNK---------------LLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVAL 313
           S K                 +  +D IG                 GG   A+NS T ++L
Sbjct: 203 SYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISL 262

Query: 314 -CIGSSLA---CAF-FIGVELYGAK------DPILPLSFLRNRSVLGSSFSNWFCMMAMM 362
             +G  L    CA+ F  + L G +       P+L  S   N  +  SS + +F   A  
Sbjct: 263 FTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIASNSGIFTSSVTGFFSCFAYE 322

Query: 363 TTSYYLPIYYSGVLNMNPTRVGKRL----MPNFFST-ALGSLGAGYYMKRTGKYYWLTVG 417
             S YL   Y  VL   PT     L    +P   +T A+  L A Y + +    + +  G
Sbjct: 323 LQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIATMAIAYLNAKYGIIKPAIVFGVLCG 382

Query: 418 FCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVP------HNH 471
                ++G     L+    +    + +L  PG  +  +    LL+    +        N 
Sbjct: 383 -----IVGSGLFTLINGKSSQSIGYSIL--PGLAFGSIFQATLLSSQVQIKSDDPEFQNK 435

Query: 472 HAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELL 523
               T+ +   +S G   G ++G  IF  SL   +    L   +    + LL
Sbjct: 436 FIEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSHLSLPEFTSVETLL 487

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 110/492 (22%), Positives = 191/492 (38%), Gaps = 47/492 (9%)

Query: 63  DSRDGVAS--------SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELP 114
           DS +G A+        SP+   +  V   S+ L +FLAA D  +V TIM  +A++FN   
Sbjct: 51  DSENGQAAPSEPETAISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAAKFNGYS 110

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGAR 174
              W+ T Y L +A    L+G+   + G K  ++L+ ++F VG L+     S   L+G R
Sbjct: 111 MTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTMLIGGR 170

Query: 175 FISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWR 234
            IS      + ++C +  S +V  R R     + +  F + +         F+ H   WR
Sbjct: 171 VISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATH-VTWR 229

Query: 235 MAFLIQVPLSALSSLLIAV------------FMKLPPRSKRVNSPASI---------KNK 273
             F I +P+  L+                  F  L  R KR++    +         +  
Sbjct: 230 WCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSFYRRLFRTL 289

Query: 274 LLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA-LCIGSSLACAFFI------- 325
           +   D+                   GG    +NS T +A   +G  L  A F+       
Sbjct: 290 VFKFDFFEFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYFVVGILLIIASFVYDFVVFD 349

Query: 326 GVELYGAKDPILPL---SFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTR 382
            V+    + P LPL   + +    VL  + +N+           Y+  Y+  V   +  +
Sbjct: 350 RVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYFQLVWGDSAWK 409

Query: 383 VGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQF 442
               L+    ST +  L  G   ++TG    L V    +  +    + L+ P  ++  + 
Sbjct: 410 ASIHLIAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILTLLGPKSSSSAKI 469

Query: 443 ILLVIPGFGYSVLITVALLAMIAAVPHNH------HAATTSISYAFRSTGSTLGVSIGGA 496
            LL++PG  +  ++  +LL+    +  NH        A T+ +   +  G   G  +   
Sbjct: 470 GLLILPGISFGSVMNGSLLSSQLQIQKNHPLFRFDFIAVTTFNAFVKMLGMAFGGIMSNM 529

Query: 497 IFRQSLNGLLSR 508
           IF  S+   LS+
Sbjct: 530 IFTTSVRNELSK 541

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 84/171 (49%), Gaps = 1/171 (0%)

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGR 143
           S+ L +FLAA D   VSTI+  ++ +F +  ++ W+ T Y L +A    ++G+++ + G 
Sbjct: 48  SLVLCLFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGF 107

Query: 144 KPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRAL 203
           K   +   ++F VG L+  L  S   L+G R I+      V S+  +  S +V  R+R L
Sbjct: 108 KTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNRGL 167

Query: 204 YQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF 254
              + +  FG+ +         F+ H   WR  F I +P+  L+  L   F
Sbjct: 168 IIAVMSSSFGIASVVGPFLGGAFTTH-VTWRWCFYINLPVGGLAFFLFLTF 217

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 110/550 (20%), Positives = 210/550 (38%), Gaps = 48/550 (8%)

Query: 61  EDDSRDGVASSPVPPDKLLVITL-SMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWI 119
            D S +   S+  P    L + L S+ L +F+ A D  +V TI+  +A +F    +  W+
Sbjct: 18  SDASLNARGSNDSPMGLSLYLCLASLTLVLFITALDILIVGTIIDVVAEQFGNYSKTGWL 77

Query: 120 ATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXX 179
            T Y L +A    ++G+ + I G +  L+L  ++F  G L+  L  S   L+  R ++  
Sbjct: 78  VTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGV 137

Query: 180 XXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLI 239
               + ++C +    +V  R R L   + +  F +           F+ H   WR  F I
Sbjct: 138 GGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYI 196

Query: 240 QVPLSALSSLLIAVFMKLPPRS---------------------KRVNSPASIKNKLLSVD 278
            +P+  L+ ++  +  K   +                       +VN    +   +   D
Sbjct: 197 NLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFD 256

Query: 279 WIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA-LCIGS-----SLACAFFIGVELYGA 332
           + G                 GG + ++NS   +  L +G      SL   FF+  +    
Sbjct: 257 FFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLGVLLFIFSLVYDFFLFDKFNPE 316

Query: 333 KDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSY-----YLPIYYSGVLNMNPTRVGKRL 387
            D I     L  R V   +      +  ++ T Y     Y   ++  +   +  + G  L
Sbjct: 317 PDNISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHL 376

Query: 388 MPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVI 447
           +P   +  + ++ +G   K+ G    L +    L ++G   + LM        Q  +L++
Sbjct: 377 IPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTSTKSTQIGVLLL 436

Query: 448 PGFGYSVLITVALLAMIAAVPHNHHAA------TTSISYAFRSTGSTLGVSIGGAIFRQS 501
           PGF     +  +L++    +  +   A       T+ +   +S G+TLG  +   +F  S
Sbjct: 437 PGFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFNTFMKSLGTTLGGVLSTTVFSAS 496

Query: 502 LNGLLSRKVLK-FADKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTL---IGCYHFACK 557
            +  +SR  L+ +  K     +L  ++    S   + +   + I+      +G Y     
Sbjct: 497 FHNKVSRAHLEPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVFWMDLGFYALG-- 554

Query: 558 DTFLFCTLCS 567
             FLFC+  S
Sbjct: 555 --FLFCSFSS 562

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 106/457 (23%), Positives = 178/457 (38%), Gaps = 54/457 (11%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +V T+   I  +F++   I W+ T Y LS+A F  L+G+L++I G    LM++ ++F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            +G L+  L+ +   L+G R I+      + S+  +  + IV    R +        + +
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAV-------FMKLPPRSKRVNSP 267
                      F++H   WR  F I +P+ A + + +A        ++       ++NS 
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAFISLAFCCASGGKWLSKKWLLSKINSI 202

Query: 268 ASIK----------NKLLSV-----DWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA 312
            S K           K+  +     D IG                 GG   A+NS   ++
Sbjct: 203 TSYKYYEIFKASFWKKVFQILVFKLDMIGIILSSAGFTLLMLGLSFGGNNFAWNSSIIIS 262

Query: 313 LC----IGSSLACAF------FIGVELYGAK--DPILPLSFLRNRSVLGSSFSNWFCMMA 360
                 I   L CA+       +GV  Y +K   P+L      N  +  SS + +F   A
Sbjct: 263 FFTLGPILLILFCAYDFHILPLLGVH-YKSKYARPLLTWKIASNAGIFTSSITGFFSCFA 321

Query: 361 MMTTSYYLPIYYSGVLNMNPTRVGKRL----MPNFFST-ALGSLGAGYYMKRTGKYYWLT 415
               S YL   Y  VL  N       L    +P   +T A   L A Y + +    + + 
Sbjct: 322 YELQSAYLVQLYQLVLKRNSMLASIHLWELSIPAMITTMATAYLNAKYGIIKPAIVFGVL 381

Query: 416 VGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALL-AMIAAVP-----H 469
            G     ++G     L+  +I+    + LL  PG  +  +    LL + +   P      
Sbjct: 382 CG-----IVGSGIFTLINGEISQSIGYSLL--PGIAFGSIFQATLLSSQVQITPDDPDFQ 434

Query: 470 NHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
           N     T+ +   +S G + G +IG  IF  SL   L
Sbjct: 435 NKFIEVTAFNSFAKSLGFSFGGNIGAMIFTASLKNQL 471

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 109/511 (21%), Positives = 191/511 (37%), Gaps = 67/511 (13%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +V T+   I  +F++   I W+ T Y LS+A F  L+G+L++I G K  LM++ IVF
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            +G L+  L+ S   L+  R ++      + S+  +  + IV    R +        + +
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF---------MKLPPRSKRVN 265
                      F++H   WR  F I +P+ A + +++A           M LP + K++ 
Sbjct: 144 AEGVGPFIGGAFNEH-LSWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIM 202

Query: 266 S-------PASI-KNK----LLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA- 312
           +        AS  KN     +  +D +G                 GG    +NS   +  
Sbjct: 203 NYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIIICF 262

Query: 313 LCIGSSLA---CAF-FIGVELYGAK------DPILPLSFLRNRSVLGSSFSNWFCMMAMM 362
             +G  L    CA+ F  + L G         P+L  +   N  +  SS + +    A  
Sbjct: 263 FTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYE 322

Query: 363 TTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLS 422
             S YL   Y  V    PT     L        + ++   Y   + G      V      
Sbjct: 323 LQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCG 382

Query: 423 LLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVP------HNHHAATT 476
           ++G     L+  +++    + +L  PG  +  +    LL+    +        N     T
Sbjct: 383 IVGSGLFTLINGELSQSIGYSIL--PGIAFGSIFQATLLSSQVQITSDDPDFQNKFIEVT 440

Query: 477 SISYAFRSTGSTLGVSIGGAIFRQSLNGLLS------------RKVLKFADKH---PRKE 521
           + +   +S G   G ++G  IF  SL   +               +L ++ +H   P+  
Sbjct: 441 AFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSQLNIPQFTSVETLLAYSTEHYDGPQSS 500

Query: 522 LLEIIEKASKSSEWVHDSAPEFIRPTLIGCY 552
           L + I  A      +HD     +    +GCY
Sbjct: 501 LSKFINTA------IHD-----VFYCALGCY 520

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 90/437 (20%), Positives = 165/437 (37%), Gaps = 35/437 (8%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +V T+   I  +F +  RI W+ T Y L +A F  L+G+L+ I G K  L  + ++F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            +G L+  ++ S   ++G R ++      + S+  +  + +V  R+R +   +    F +
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKN-- 272
             A        F+++   WR  F I +P+  ++  ++        +S +     + +   
Sbjct: 143 AFAVGPVIGGAFTEN-VSWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQ 201

Query: 273 -------------------KLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA- 312
                               +  +D+IG                 GG   A+NS T ++ 
Sbjct: 202 TYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISF 261

Query: 313 LCIGSSLACAFFI--GVELYG--------AKDPILPLSFLRNRSVLGSSFSNWFCMMAMM 362
           L +G+ L   + +   V LY            P+L  S      +  SS +N F      
Sbjct: 262 LTVGAILVLFWLVFDFVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFGFN 321

Query: 363 TTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLS 422
             + Y+   Y  V N  PT     L     +T +  +  G      G      V   T  
Sbjct: 322 MQTVYIVQLYQLVFNSGPTAASMHLWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCG 381

Query: 423 LLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSI--SY 480
           L+G   + L++    T       ++PG  +  ++   LL+    V H+     T    + 
Sbjct: 382 LVGSGLMTLVRNTSTTGNVIGYCILPGAAFGSIMQGTLLSAQVQVDHDDENFQTMFIEAT 441

Query: 481 AFRSTGSTLGVSIGGAI 497
           A  +   +LG S GG +
Sbjct: 442 ALNTFVKSLGFSFGGVV 458

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 3/171 (1%)

Query: 92  AAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNN 151
           AA D  +V T+   I  +FN+   + W+ T Y LSSA F  L+G+++ + G K  LML+ 
Sbjct: 56  AALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSV 115

Query: 152 IVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFF 211
           ++F +G L+  ++ S   L+  R ++      + S+  I  + +V  R R +   +  F 
Sbjct: 116 LIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFA 175

Query: 212 FGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSK 262
           F    A         ++H   WR  F I +P+   ++ ++  F+   P  K
Sbjct: 176 FVGSNAGGPILGGALNEH-ASWRWCFFINLPIGGAAAFML--FLCYNPSGK 223

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/336 (23%), Positives = 132/336 (39%), Gaps = 35/336 (10%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           +V   S+ L +FL A D  +  T+   I   FN+   + W+ T Y L +A    L+G+++
Sbjct: 7   VVCIFSLSLTLFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIA 66

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
            + G K  L+ + ++F  G L+  L  S   L+G R I+      + ++     + +V  
Sbjct: 67  SLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDE 126

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLP 258
           + RA    +    + L           F++H   WR  F I +P+  + +L I  +   P
Sbjct: 127 KHRARVVTILGIAYMLAEGAGPFIGGAFAEH-VSWRWCFFINIPIGGV-ALAILCWGYNP 184

Query: 259 PRSKRVNS----------------------PASIKNKLLSVDWIGXXXXXXXXXXXXXXX 296
                +N+                         +K  +  +D +G               
Sbjct: 185 AGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLSSGGFALIMLAL 244

Query: 297 XXGGKEIAFNSKTFVAL-CIGSSLACAF---------FIGVELY-GAKDPILPLSFLRNR 345
             GG + A+NS + + +  IG +L   F         +IG  L  G   P++P S   N 
Sbjct: 245 TFGGNKFAWNSASIICMFTIGIALLGIFMLYDFVVLPYIGRRLENGEAMPLVPWSLACNM 304

Query: 346 SVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPT 381
            +L SS + +F   A    S YL  YY  V N  P 
Sbjct: 305 PILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPV 340

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 103/508 (20%), Positives = 203/508 (39%), Gaps = 50/508 (9%)

Query: 61  EDDSRDGVAS-SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWI 119
           +D+S   V    P+   KL     S+ L +FLAA D  ++S  +  I+ +FN+  +  WI
Sbjct: 22  QDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWI 81

Query: 120 ATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXX 179
            + Y L  A    L+G+ + IFG K  L+L+ ++F  G L+  ++ S   L+G R ++  
Sbjct: 82  VSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGI 141

Query: 180 XXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLI 239
               + S+C +  S +   R R +   + +  + +           F+ H   WR  F I
Sbjct: 142 GGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTH-VTWRWCFYI 200

Query: 240 QVPLSALSSLLIAVFMKLPPRSKRVNSPASI--------KNKLLSVDW------------ 279
            +P+ +L+  ++ +  K P       S  S+          +L S D             
Sbjct: 201 NLPIGSLAFAVLVLTYK-PHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGF 259

Query: 280 --IGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA-LCIGSSLACAF----------FIG 326
             IG                 GG + A++S   +    +G +++ AF          F  
Sbjct: 260 DFIGFIFCSVGFILFLLGLTFGGDKYAWSSGAIIVYFIVGVTISVAFLLYDFMIFPKFGR 319

Query: 327 VELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKR 386
           V    +  P++P S +    +  +  +N+   +A      Y+  ++  V   +  R    
Sbjct: 320 VRKNASFRPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIH 379

Query: 387 L----MPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQF 442
           +    +P+  + A+    +G   + TG    +        L+G   + L+  D  + +  
Sbjct: 380 VVALEIPDIITVAI----SGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHI 435

Query: 443 ILLVIPGFGYSVLITVALLAMIAAVPHNHHA------ATTSISYAFRSTGSTLGVSIGGA 496
            LL++PG  +  ++  +LL+    +P +  +      +TT++     S G + G  +   
Sbjct: 436 GLLILPGVAFGAMLQGSLLSCQLQIPKDSASFMPDFVSTTTVHTFSISLGMSFGSVLATM 495

Query: 497 IFRQSLNGLLSRKVLKFADKHPRKELLE 524
           +F  SL+  ++    +F       EL+ 
Sbjct: 496 VFGTSLHNKIASSGFEFLSTKSVDELVS 523

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 108/492 (21%), Positives = 193/492 (39%), Gaps = 48/492 (9%)

Query: 54  DYGSID-NEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE 112
           D  SID N  D  D      +   +L V   ++ L  F+ A D  +V+TI+  +++    
Sbjct: 32  DNASIDANTPDHNDNSNVRLMSGLRLYVCVAALVLATFIFALDVFIVNTIIDSVSASLGG 91

Query: 113 LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVG 172
             +  W+   Y L ++ F  ++G+ + + G +  + L+  +F VG ++     S   L+ 
Sbjct: 92  YSKSGWLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIV 151

Query: 173 ARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGG 232
            R I+      + ++  +  S IV  ++RA+   +    F   +         F+ H   
Sbjct: 152 GRVIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVI- 210

Query: 233 WRMAFLIQVPLSALSSLLIAVFMKLPPR----SKRVNSPASIK----------------- 271
           WR  F I +P+ A+++LL   F   P R    S+  +   S+K                 
Sbjct: 211 WRWCFWINLPIGAVTALLF-YFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMG 269

Query: 272 -NKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELY 330
            N L   D +G                 GG++ ++ S   +   I   L     +  + Y
Sbjct: 270 KNLLFRFDIVGFATGCAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFY 329

Query: 331 GAKD-----------PILPLSFLRNRSVLGSSFSNWFCMMAMMTTSY--YLPIYYSGVLN 377
                          P+L    L NR +L  +     C  A+  + Y  Y   ++  V+ 
Sbjct: 330 IFDKINPEPSNLSFRPMLVKGLLNNRFILLPNLVT--CASAIAFSGYMLYSVQFFQLVMG 387

Query: 378 MNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIA 437
            +    G  L+P   ++ + ++  G  MK+TG+   L +   ++ L+G     L+     
Sbjct: 388 SSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSG 447

Query: 438 TWRQFILLVIPGFGYSVLITVALLA---MIAAVPHNHHAATTSISYAFRSTGSTLGVSIG 494
              Q  + ++PGFG    +  AL++    I     N       ++ AF S   +LG SIG
Sbjct: 448 NSMQIGVWILPGFGLGAALQCALISSQLQIDKESPNSEIELVEVT-AFNSFTKSLGSSIG 506

Query: 495 G----AIFRQSL 502
           G    AIF  SL
Sbjct: 507 GVLCTAIFTSSL 518

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 86/177 (48%), Gaps = 1/177 (0%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           KL     S+ L +FLAA D  ++S  +  IA +F +  +  WI + Y L+ A    L+G+
Sbjct: 116 KLYTTIGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGR 175

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
            + I G K  L+++ ++F  G L+  ++ S   L+G R ++      + S+C +  S + 
Sbjct: 176 FATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLT 235

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAV 253
           P R R +   + +  + +            + H   WR  F I +P+  L+ +++A+
Sbjct: 236 PDRSRVIIISVLSCSYAVAAVVGPFLGGALTTH-VTWRWCFYINLPIGGLAFVVLAM 291

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 90/452 (19%), Positives = 175/452 (38%), Gaps = 45/452 (9%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +VSTI+  +A +F    +  WI   Y L +A    L+G+++ I G K  ++   I+F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            +G L+ G+  S   L+G R I+      + S+  +  S++V  R R L     +  F +
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS------------- 261
            +         F+ H   WR  F I +P+  ++  L  VF     +S             
Sbjct: 214 ASVIGPFLGGAFTTH-ATWRWCFYINLPVGGVAFALFVVFYNPQRKSLEGISILSSLKEF 272

Query: 262 ----KRVNSPASIKN----------KLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNS 307
               +++    ++KN           +   D I                  GG +  ++S
Sbjct: 273 CNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEFIFCSAGFVLVLLAFTFGGNQYNWSS 332

Query: 308 KTFVAL-CIG-----SSLACAFFIGVELYGAKD-----PILPLSFLRNRSVLGSSFSNWF 356
            + + +  IG      SL   F I       K+     P++  S   +  +  ++ + +F
Sbjct: 333 ASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKENSLYQPLIKWSIFSHPGIFTANAALFF 392

Query: 357 CMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTV 416
              A +  + Y+  ++  V      +    L+     T + +  +G    + G    +T 
Sbjct: 393 ECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIATVVPTVITTFSSGIANSKFGLVKHVTF 452

Query: 417 GFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALL-AMI-----AAVPHN 470
                SL+G   + L+  + ++ +   LL++PG G+   +   ++ A I     A    +
Sbjct: 453 IGVVTSLVGAGLLTLLDNNSSSAKHIGLLILPGIGFGATMQSTMIGAQIQLDKKAVTYRS 512

Query: 471 HHAATTSISYAFRSTGSTLGVSIGGAIFRQSL 502
              A T+++   +  G  LG  I   +F  S+
Sbjct: 513 DFIAVTTLNAFLKGAGQALGGIICDTVFSASI 544

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 106/483 (21%), Positives = 198/483 (40%), Gaps = 48/483 (9%)

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGR 143
           S+ L +F+ A D  +V TI+  +A +F    +  W+ T Y L +A    L+G+ + I G 
Sbjct: 50  SLTLVLFITALDILIVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGF 109

Query: 144 KPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRAL 203
           +  L+L  ++F  G L+  L  S   L+  R ++      + ++C +    +V  R R L
Sbjct: 110 QHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSRPL 169

Query: 204 YQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL-----------IA 252
              + +  F +           F+ H   WR  F I +P+  L+ ++           I 
Sbjct: 170 VISILSCAFAVAAIVGPIIGGAFTTH-VTWRWCFYINLPIGGLAVIMFLLTYDAKNDGII 228

Query: 253 VFMKLPPRS------KRVNSPASIKNK----LLSVDWIGXXXXXXXXXXXXXXXXXGGKE 302
             MK   R        R+  P +++      +   D+ G                 GG +
Sbjct: 229 QQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNK 288

Query: 303 IAFNSKTFVA-LCIGS-----SLACAFFIGVELYGAKDPI--LPLSFLRNRSVLGSSFSN 354
             ++S   +  L +G      SL   FF+  +    +D I   PL FLR R V   +   
Sbjct: 289 YTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPL-FLR-RLVAKPAIII 346

Query: 355 WFCMMAMMTTSY-----YLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTG 409
              +  ++ T Y     Y   ++  +   +  + G  L+P   +  + ++ +G   K+ G
Sbjct: 347 VNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVITNVIAAIASGIITKKLG 406

Query: 410 KYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPH 469
               L +    L ++G   + LMK +  +  Q  +L++PGF     +  +L++  A +  
Sbjct: 407 LVKPLLIFGGFLGVIGAGLMTLMKNNSTSSTQIGVLILPGFSLGFALQASLMS--AQLQI 464

Query: 470 NHHAATTSISY----AFRSTGSTLGVSIGGA----IFRQSLNGLLSRKVLK-FADKHPRK 520
           N     T + +    AF +   +LG ++GG     +F  SL+  +S   L+ +A K   +
Sbjct: 465 NKDRPETPMDFIEITAFNTFMKSLGTTLGGVLSTTVFSTSLHNKVSHVHLEPYAGKTVDE 524

Query: 521 ELL 523
            +L
Sbjct: 525 MIL 527

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 107/506 (21%), Positives = 195/506 (38%), Gaps = 53/506 (10%)

Query: 61  EDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIA 120
           ED+ +  V  S      L V  +++ L +FLAA D  +VSTI+  +A +      I W+ 
Sbjct: 45  EDNVKKNVELSK--GSILYVSLVAVALSLFLAALDVMIVSTIIEEVAKQLGSYSEIGWLF 102

Query: 121 TAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXX 180
           T Y L +A    ++G+++   G K  ++   ++F +G L+  L  S   L+G R I+   
Sbjct: 103 TGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIG 162

Query: 181 XXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
              + S+  +  S +V    R +   + +  F + +         F+     WR  F I 
Sbjct: 163 GCGIQSLSFVIGSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTS-SVTWRWCFYIN 221

Query: 241 VPLSALSSLLIAVF-----------MKLPPR------------------SKRVNSPASIK 271
           +P+  L+  L  +F           MK  PR                   K  N   S K
Sbjct: 222 LPIGGLAFFLFVLFYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSNSWK 281

Query: 272 NKLLSV----DWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKT------FVALCIGSSLAC 321
              + +    D I                  GG   A+NS +         + + S++  
Sbjct: 282 KLFIELVFMYDVIELVLCSAGFTSILLAFTFGGNRYAWNSTSIIILFIVGIILVISAIIY 341

Query: 322 AFFI--GVELYGAKDPILPLSFLRNRSVLGSSFSN--WFCMMAMMTTSY-YLPIYYSGVL 376
            FF+     L  A     PL   RN    G    N   F + A   + + Y+  Y+  + 
Sbjct: 342 DFFVFPKFNLVKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIY 401

Query: 377 NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDI 436
           N +  +    L+    ST + ++  G    +T +   + V    L ++G   + L+  + 
Sbjct: 402 NDSAWKAAVHLITCVISTVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNA 461

Query: 437 ATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGST----LGVS 492
           ++     LL++PG  +  L   ++LA  + +  +  + T    +   +T +T    LG +
Sbjct: 462 SSSAHIGLLILPGIAFGGLAQSSMLA--SQIQLDKESPTIKSDFVSITTFNTFCKALGQA 519

Query: 493 IGGAIFRQSLNGLLSRKVLKFADKHP 518
           +GG +     +  +  KV +   K P
Sbjct: 520 LGGVVSNTVFSAAVMTKVTRSNIKLP 545

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 116/567 (20%), Positives = 219/567 (38%), Gaps = 71/567 (12%)

Query: 6   SKNDLTS-RTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNEDDS 64
           S  D TS + NF   + D+  +DA+      V             C G     +     +
Sbjct: 6   SMTDSTSGQLNFQEKLHDEARKDAAEKDLISVNGCLQQVSSSITSCNGEKI--VKTRGVT 63

Query: 65  RDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYL 124
           R  V    +    + ++ LS++L  ++AA D T       +  S FN    +S +  A  
Sbjct: 64  RIEVVREKMSTKVIWILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANS 123

Query: 125 LSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG-LVGARFISXXXXXX 183
           +  A  +P   K+SD+  R     +  +++++G ++   +P+    ++G+ FI+      
Sbjct: 124 VIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSG- 182

Query: 184 VTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDH------GGGWRMA- 236
           ++ M  + I+D   L+ R+ +  + +  + + T        W S +         WR   
Sbjct: 183 ISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTT--------WISGYIVEDIINSNWRWGY 234

Query: 237 --FLIQVPLSALSSLLIAVFMKL-------------PPRSKRVNSPAS-----------I 270
             F I  P++   ++L+  +++              P   K+V    +           +
Sbjct: 235 GMFAIITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELL 294

Query: 271 KNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVEL 329
           K  L+ +D  G                     E  +N+ + +A+ +   +    ++  E+
Sbjct: 295 KVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLISYVVFEV 354

Query: 330 YGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---------NP 380
           + A  P+LP   L NR+ +     ++   MA   +  +   Y   VLN+         N 
Sbjct: 355 FFAPFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNT 414

Query: 381 TRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH-LQINLMKPDIATW 439
           T +G      FF    G+L  G++     +Y    V    + L+G  L +   K D +  
Sbjct: 415 TTMGL----CFFGVVWGALFRGFH-----RYKIFQVVGIAIKLIGMGLYVACSKKDGSPG 465

Query: 440 RQFIL--LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAI 497
              ++  LV+  FG +  +    +A  AAVPH   AAT S+   + S G+ +G +I  A+
Sbjct: 466 IGLVVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAV 525

Query: 498 FRQSLNGLLSRKVLKFADKHPRKELLE 524
           +   L G L + V    DK       E
Sbjct: 526 WTDQLPGALFKYV---PDKEKAVAFFE 549

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 98/193 (50%), Gaps = 3/193 (1%)

Query: 72  PVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQ 131
           P+   +L++  +S+ L +FL++ D  +V TI+  IA +FN   +I W+ T Y LS+A F 
Sbjct: 13  PISLLRLIMCIISLLLVLFLSSLDIIIVVTILNTIADKFNAYSKIGWLITGYSLSNALFT 72

Query: 132 PLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSIT 191
            L+G+ + IFG K  LM++ I+F +G L+  ++ S   ++G R I+      + ++    
Sbjct: 73  LLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAI 132

Query: 192 ISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLI 251
            + +V    R     + +  + + +A         +++   WR  F I +P+  L+  L 
Sbjct: 133 ATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEY-VTWRWCFYINLPIGGLA--LG 189

Query: 252 AVFMKLPPRSKRV 264
             ++   P  ++V
Sbjct: 190 VFYLSYNPAQRKV 202

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 101/508 (19%), Positives = 200/508 (39%), Gaps = 50/508 (9%)

Query: 61  EDDSRDGVAS-SPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWI 119
           +D+S   V    P+   KL     S+ L +FLAA D  ++S  +  I+ +FN+  +  WI
Sbjct: 22  QDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWI 81

Query: 120 ATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXX 179
            + Y L  A    L+G+ + IFG K  L+L+ ++F  G L+  ++ S   L+G R ++  
Sbjct: 82  VSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGI 141

Query: 180 XXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLI 239
               + S+C +  S +   R R +   + +  + +           F+ H   WR  F I
Sbjct: 142 GGSGIQSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTH-VTWRWCFYI 200

Query: 240 QVPLSALSSLLIAVFMKLPPRSKRVNSPASI--------KNKLLSVDW------------ 279
            +P+  L+  ++ +  K P       S  S+          +L S D             
Sbjct: 201 NLPIGGLAFAVLVLTYK-PHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFNELVFGF 259

Query: 280 --IGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA-LCIGSSLACAF----------FIG 326
             IG                 GG +  ++S   +    +G +++ AF          F  
Sbjct: 260 DFIGFIFCSVGFILFRLGLTFGGDKYTWSSGAIIVYFVVGVTISVAFLLYDFMVFPKFGR 319

Query: 327 VELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKR 386
           V    +  P++P S +    +  +  +N+   +A      Y+  ++  V   +  R    
Sbjct: 320 VRKNASFRPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIH 379

Query: 387 L----MPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQF 442
           +    +P+  + A+    +G   + TG    +        L+G   + L+  D  + +  
Sbjct: 380 VVALEIPDIITVAI----SGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHI 435

Query: 443 ILLVIPGFGYSVLITVALLAMIAAVPHNHHA------ATTSISYAFRSTGSTLGVSIGGA 496
            LL++PG  +  ++  +LL+    +P +  +      +TT++     S G   G  +   
Sbjct: 436 GLLILPGVAFGAMLQGSLLSCQLQIPKDSASFMPDFVSTTTVHTFSISLGMYFGSVLATM 495

Query: 497 IFRQSLNGLLSRKVLKFADKHPRKELLE 524
           +F  SL+  ++    +F       +L+ 
Sbjct: 496 VFGTSLHNKIASSGFEFLSTKSVDKLVS 523

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 99/475 (20%), Positives = 187/475 (39%), Gaps = 59/475 (12%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           ++ LS++L   +AA D T       +  S FN    +S +  A  +  A  +P   K+SD
Sbjct: 79  ILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGAVCKPFIAKISD 138

Query: 140 IFGRKPLLMLNNIVFLVGCLMCGLTPSFWG-LVGARFISXXXXXXVTSMCSITISDIVPL 198
           +  R     +  +++++G ++   +P+    +VG+ FI+      ++ M  + I+D   L
Sbjct: 139 LSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSG-ISLMNMVIIADTTTL 197

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDH------GGGWRMA---FLIQVPLSALSSL 249
           + R+ +  + +  + + T        W S +         WR     F I  P++   ++
Sbjct: 198 KWRSFFTSLLSVPYLVTT--------WISGYIVEDIINSNWRWGYGMFAIITPVALTPAI 249

Query: 250 LIAVFMKL-------------PPRSKRVNSPAS-----------IKNKLLSVDWIGXXXX 285
           L+  +++              P   KR+    S           +K  L+ +D  G    
Sbjct: 250 LVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGLILL 309

Query: 286 XXXXXXXXX-XXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRN 344
                            E  +N+ + +A+ +   +    ++  E++ A  P+LP   L N
Sbjct: 310 GFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLISYVVFEVFFAPFPLLPKRVLMN 369

Query: 345 RSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---------NPTRVGKRLMPNFFSTA 395
           R+ +     ++   MA   +  +   Y   VLN+         N T +G      FF   
Sbjct: 370 RTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGL----CFFGVV 425

Query: 396 LGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVL 455
            G+L  G++  +  +   + +    + L          P I        LV+  FG +  
Sbjct: 426 WGALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGL--VVAALVVTNFGDAAN 483

Query: 456 ITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
           +    +A  AAVPH   AAT S+   + S G+ +G +I  AI+   L G LS+ V
Sbjct: 484 VMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKYV 538

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 106/545 (19%), Positives = 213/545 (39%), Gaps = 47/545 (8%)

Query: 59  DNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISW 118
           DNE        SS +   +L V   ++ L   + A D  +V+T++  ++       +  W
Sbjct: 60  DNEKTQ-----SSIMAGMRLYVCLFALVLAQLIVALDVFIVNTVIDVVSKNLGGYAKSGW 114

Query: 119 IATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISX 178
           + T Y L ++    ++G+ + + G +  ++++  +F VG ++     S   LV  R ++ 
Sbjct: 115 LITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAG 174

Query: 179 XXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFL 238
                + ++  I    +V  R+R +   +    F + +         F+ H   WR  F 
Sbjct: 175 IGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTH-ATWRWCFW 233

Query: 239 IQVPLSALSSLL---------IAVFMKLPPRSKRVNS------------PASIKNKLLSV 277
           I +P+   ++ L         +++  +L    K V +               ++N +   
Sbjct: 234 ISLPVGGSAAFLFFFTYNPERLSITARLVRCLKLVKAIPLKQFQYVETYKTIVRNLVFRF 293

Query: 278 DWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVA--LCIGSSL-ACAFFIGVELYGAKD 334
           D IG                 G ++ ++  + FV   L IG  L  C+      ++   +
Sbjct: 294 DLIGFTLNCTGICLFLLGLTFGSEDNSWK-RAFVVCFLVIGGLLVVCSVVYDFYIFDRIN 352

Query: 335 PILPLSFLRN---RSVLGSSF----SNWFCMMAMMTTSY--YLPIYYSGVLNMNPTRVGK 385
           P    +  R    R+++G  +    +   C  A++   Y  Y   ++  VL       G 
Sbjct: 353 PEPANASYRPLMVRTLIGHKYFLLANTVTCAAAVVFAGYMVYSVQFFQLVLGYTAWNAGL 412

Query: 386 RLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILL 445
            L+P   ++ L ++  G + K+TG   ++ +    L L+G     L+        Q  + 
Sbjct: 413 HLIPLVIASLLSAIFCGGFTKKTGHVKYVMIANIALLLIGSGVCTLLDNYSNNSMQIGVW 472

Query: 446 VIPGFGYSVLITVALLAMIAAVPHNHHAATTSISY--AFRSTGSTLGVSIGGAIFRQSLN 503
           ++PGFG    +  AL++    +  N   A T +    AF S   +LG SIG  +   +  
Sbjct: 473 ILPGFGLGATLQCALISSQLQIDKNSPDAKTELVEITAFNSFCKSLGSSIGAVLSTTTFI 532

Query: 504 GLLSRKVLKFA-DKHPRKELLEIIEKASKSSEWVHDSAPEFIRPTLI----GCYHFACKD 558
             L RK+ K   + +  K++ E+++   ++ +     A E     +      CY F+   
Sbjct: 533 SALWRKINKAKLEGYYGKKINELVKYRLQNFDGKSTEAAEIFSAAVTYVFWMCYAFSALA 592

Query: 559 TFLFC 563
            F  C
Sbjct: 593 FFCAC 597

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 97/444 (21%), Positives = 176/444 (39%), Gaps = 41/444 (9%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG++     ++  S +++ P IS I     + SA  Q ++ +LSD+FGR  L +   + +
Sbjct: 71  DGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLFY 130

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQG-------M 207
            VG ++                       +  +  + +SD   LR R +YQ        +
Sbjct: 131 AVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYII 190

Query: 208 CNFFFGLGTACXXXXXXWFSDHGGGWRMA-FLIQVPLSALSSLLIAVFMKLPPRSKRVNS 266
             +F G  TA       W       W +A +   VPLSAL  +   + M+   ++++   
Sbjct: 191 NTWFAGTVTARANPQEHW------SWDIAMWAFIVPLSALPMIFCMLHMRF--KARKTEQ 242

Query: 267 PASIKNK----------------LLSVDWIGXXXXXXXXXXXXXXXXXGG--KEIAFNSK 308
            A+IK++                   +D +G                  G  K    N  
Sbjct: 243 WAAIKDEKSFFQSHGLIRTLVELFWKLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPH 302

Query: 309 TFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYL 368
               L +G  L   F I  E   AK P++P   +++R+V G+    +         + Y 
Sbjct: 303 LIGPLVLGFVLLPLFMIW-ESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGY- 360

Query: 369 PIYYSGVLNMNPTRVGKRLMPNF--FSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH 426
            IY   ++ +N +     ++ +   F + + S     Y+ R  K     +G C + +L  
Sbjct: 361 -IYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAM 419

Query: 427 -LQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRST 485
            L  +    + A       +VI G G ++LI    +++ +A  H++ A  T+++Y     
Sbjct: 420 GLFYHYRGGEFAHSGIVGAMVIWGLGDTLLIYPTTISVQSATSHDNMATVTALNYTLYRI 479

Query: 486 GSTLGVSIGGAIFRQSL-NGLLSR 508
           G   G ++ GAI+ Q+L   LLSR
Sbjct: 480 GLATGAAVSGAIWSQTLYKALLSR 503

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 76/167 (45%), Gaps = 1/167 (0%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +VSTI+  +A +F     I W+ T Y L +A    ++G+++   G K  ++   ++F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
            VG L+  L  S   L+G R I+      + S+  +  S++V   +R +   + +  F +
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 215 GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS 261
            +         F+     WR  F I +P+  L+  L  +F    P +
Sbjct: 212 ASVVGPFLGGVFTSR-VTWRWCFYINLPIGGLTFFLFLMFCNPDPHT 257

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 104/443 (23%), Positives = 184/443 (41%), Gaps = 36/443 (8%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG + S   ++ A+ +   P IS ++    + SA  Q  + +LSD+FGR  L +     +
Sbjct: 74  DGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSDVFGRLSLFVTAIAFY 133

Query: 155 LVGCLMCGLTPSFWGL-VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQ------GM 207
           +VG ++           VG+ F S      +  M  + +SD   LR R LYQ      G+
Sbjct: 134 VVGTIIQSQAYDIQRYAVGSVFWSIGYVG-ILLMLILIVSDFSSLRWRLLYQFAPSWPGI 192

Query: 208 CNFFF-GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNS 266
            N +  G  TA       W S + G W  AF+I  PL+ L  +L  + M+   +++R   
Sbjct: 193 INTWIAGTITARSNPQEKW-SWNIGMW--AFII--PLTCLPMILCMLHMRF--KARRTEQ 245

Query: 267 PASIKNK----------------LLSVDWIGXXXXXXXXX-XXXXXXXXGGKEIAFNSKT 309
            A ++N+                   VD +G                  GG    + +  
Sbjct: 246 WAELRNERSYYQTHGLIKTLIELFWKVDVVGILLMTASIGCVLAPLTLAGGTGSKWQNPR 305

Query: 310 FVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFC-MMAMMTTSYYL 368
            ++  +   +    F+  E   A+DPI+P   +++R+V  S  S +    + MM   Y  
Sbjct: 306 VISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFIYMMAAGYIY 365

Query: 369 PIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH-L 427
            I   GV     +     ++ +F +TA  S     ++ R  +     V  C L +L   L
Sbjct: 366 NILIVGVNESIKSATTITILSSFVATA-ASPPFCLWITRCTRMKGYIVAGCGLWMLAMGL 424

Query: 428 QINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGS 487
             +    + A       +V+ G G  +LI    +++ +A  H++ A  T+++Y     G 
Sbjct: 425 FYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPITVSVQSATSHDNMAMVTALNYTTYRIGL 484

Query: 488 TLGVSIGGAIFRQSLNGLLSRKV 510
           + G +I GAI+ Q+L   L +++
Sbjct: 485 STGSAISGAIWTQTLYKELFKRL 507

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 98/446 (21%), Positives = 179/446 (40%), Gaps = 53/446 (11%)

Query: 100 STIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCL 159
           S    +  S +NE   +S I     + S   Q ++ +LSDIFGR  L ++  ++++VG +
Sbjct: 99  SVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTI 158

Query: 160 M-CGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTAC 218
           + C         VGA F +      V+ +  I +SD+ P + R L+Q          T+ 
Sbjct: 159 IQCEARDIRTYAVGAAFYNSGYVG-VSILLIIVLSDLSPSKWRLLFQ--------FATSW 209

Query: 219 XXXXXXWFS-------DHGGGWRM-----AFLIQVPLSALSSLLIAVF------------ 254
                 W S       +    WR      AFL   P+SAL  ++  ++            
Sbjct: 210 PCIIICWISGDIVQSANPAKNWRFDIGMWAFLF--PISALPFIIFLLYFTRQASKTAEWK 267

Query: 255 -MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
            ++   +   V     IK+   ++D +G                  GG    +N    +A
Sbjct: 268 EIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIA 327

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYL-PIY 371
             +   ++  FF+  ++  AK+ +LP   L++R V  S  +     +   T S YL P+ 
Sbjct: 328 TIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVL 387

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY-YWLTVGFC----TLSLLGH 426
              V   + +      +P F +   GS+  G  + RT +   +  +G C    ++ L  H
Sbjct: 388 LVSVNESSKSATRILWLPTFVACT-GSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYH 446

Query: 427 LQINLMKPDIATWRQFIL--LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRS 484
            +        A+    I+   V+ G G ++     ++ +     H + A+ T + + F  
Sbjct: 447 YRGG------ASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMTSHKNMASITGLYFMFAQ 500

Query: 485 TGSTLGVSIGGAIFRQSLNGLLSRKV 510
            GS  G SI GAI+ Q++   L +++
Sbjct: 501 IGSASGASISGAIWTQTMYKQLYKRL 526

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 104/493 (21%), Positives = 182/493 (36%), Gaps = 53/493 (10%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSM--YLGIFLAAA---------DGTLVSTIMAH 105
           S ++ED +   V  S +   +++ +      Y  + +A A         D TL ST   +
Sbjct: 22  SFEDEDANPANVEFSKLGESEIIAVQFDTPKYRALMIATAFLCGFGYSLDHTLRSTYTGY 81

Query: 106 IASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP 165
             + + E   +S I     + S   Q ++ +LSD FGR  L +   I++++G ++     
Sbjct: 82  ATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAY 141

Query: 166 SFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXW 225
           S                 VT +  + +SD   L+ R LYQ +  + F            W
Sbjct: 142 SVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPF--------IIIPW 193

Query: 226 FS---------DHGGGWRMAFLIQV-PLSALSSLLIAVFM-----------KLPPRSKRV 264
            S         +    W +A    + PLSAL  + + V+M            L  R+   
Sbjct: 194 ISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSKTPEWKALKERTHIK 253

Query: 265 NSPASIKNKLL---SVDWIGXXXXXXXX--XXXXXXXXXGGKEIAFNSKTFVALCIGSSL 319
            +   +KN +     +D IG                   G  +   +SK    L  G  L
Sbjct: 254 KNQGFLKNTVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVL 313

Query: 320 ACAFFIGVELYGAKDPILPLSFLRNRSV---LGSSFSNWFCMMAMMTTSYYLPIYYSGVL 376
            C F      Y AK+P+LP   L +R +   LG +F N+F     +   +  P+    + 
Sbjct: 314 FCIFVFWETAY-AKNPLLPFKLLGDRGIWAPLGVAFFNYFTFF--IACDFLYPVLLVSMN 370

Query: 377 NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDI 436
             + T      +P+F    L     G  + +  +  +  VG C   ++        +   
Sbjct: 371 ESSTTATRILNLPDFVGATLSPF-YGILVAKARRLKFSVVGGCAAWMISMGLFYQYRGGS 429

Query: 437 ATWRQFILL-VIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGG 495
            +    I   VI G    +     ++++ A   H   A  TSI + F   G+ +G S+ G
Sbjct: 430 ESHGGAIAASVIMGMSGLLCSNSVIVSLQAMTTHGRMAVITSIYFTFSKVGAAVGASVSG 489

Query: 496 AIFRQSLNGLLSR 508
           A++ Q +   L +
Sbjct: 490 AVWTQIMPNQLRK 502

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 92/212 (43%), Gaps = 12/212 (5%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN--EL-- 113
           +++EDD    +  +      ++++T    L  FL   D   +S+ +  I ++ +  EL  
Sbjct: 53  VNDEDDVSVMINFNQGVSHFIIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNKELTY 112

Query: 114 --PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171
               I+  AT+  L +  F  + G   DIFGRKP LM +NI+FL+G ++      FW + 
Sbjct: 113 GEKEITTAATS--LGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQVTAHKFWQMT 170

Query: 172 GARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG 231
             RFI        + +  + IS+I P   R     + + +   G           +    
Sbjct: 171 AGRFIMGFGVGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHN 230

Query: 232 GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
           GWR    I V LS + ++L  VF    P + R
Sbjct: 231 GWR----ILVGLSLIPTVLQFVFFIFLPDTPR 258

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 97/231 (41%), Gaps = 11/231 (4%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI- 116
           +++EDD+   +  +      ++++T    +  FL   D   +S+ +  I ++ +  P   
Sbjct: 113 VNDEDDTSVIINFNQGISPFIVILTFVASISGFLFGYDTGYISSALISIGNDLDNRPLTY 172

Query: 117 ---SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
               +I  A  L +       G  +D+FGRKP LM +N++F+VG ++      FW +   
Sbjct: 173 GDKEFITAATSLGALISSIFAGTAADVFGRKPCLMFSNLMFVVGAIVQITAHKFWQMTAG 232

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R +        + +  + I +I P + R     + + +   G           +    GW
Sbjct: 233 RLVMGFGVGIGSLIAPLYIGEIAPRKIRGRLTVINSLWLTGGQLIAYGCGAGLTKVNNGW 292

Query: 234 RMAFLIQVPLSALSSLL-IAVFMKLP--PRSKRVNSPASIKNKLLSVDWIG 281
           R    I V LS + +++    F+ LP  PR   +     + NK+L   + G
Sbjct: 293 R----ILVGLSLIPTVVQFTCFLFLPDTPRYYVMKGDYDMANKVLHRSYTG 339

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 11/210 (5%)

Query: 78  LLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN--ELP--RISWIATAYLLSSATFQPL 133
           ++++T    +  F+   D   +ST +  I ++ +  EL      +I  A  L +      
Sbjct: 119 IIILTFVTSISGFMFGYDTGYISTALISIGTDLDHKELTYGNKEFITAATSLGALISSIF 178

Query: 134 YGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITIS 193
            G  +DIFGRKP ++L+N++FL+G ++     +FW +V  RFI        + +  + IS
Sbjct: 179 AGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSLIAPLYIS 238

Query: 194 DIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL-IA 252
           +I P   R     + + +   G           S    GWR    I V LS + +++  +
Sbjct: 239 EIAPKNIRGRLTVINSLWLTGGQLIAYGCGAGLSHVNNGWR----ILVGLSLIPTVIQFS 294

Query: 253 VFMKLP--PRSKRVNSPASIKNKLLSVDWI 280
            F+ LP  PR   +       NK+L   ++
Sbjct: 295 CFLFLPDTPRFYVMKGQLEKANKVLHKSYV 324

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 96/233 (41%), Gaps = 28/233 (12%)

Query: 58  IDNEDDSRDGVA-SSPVPPDKLLVITLSMYLGI--FLAAADGTLVSTIMAHIASEFNELP 114
           +++EDD    +  +  +PP   LVI L+    I  F+   D   +S  +  +  + +   
Sbjct: 58  LNDEDDCSAILNFNKKIPP---LVIGLTFLASISGFMFGYDTGYISAALVSLGKDLDN-K 113

Query: 115 RISW----IATAYLLSSATFQPLY-GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169
            +S+    I TA     A    L+ G L+DIFGRKP+ M +N++FL+G ++   T SFW 
Sbjct: 114 YLSYGEKEIITAATSLGALITSLFAGTLADIFGRKPVTMSSNVMFLIGAILQACTRSFWQ 173

Query: 170 LVGARFISXXXXXXVTSMCSITISDIVPLRDR--------ALYQGMCNFFFGLGTACXXX 221
           +   R +        + +  + IS+I P   R        A   G     +G+G      
Sbjct: 174 MAAGRLLMGFGIGIGSLLSPLFISEIAPSEYRGRLTVVNSACITGGQLIAYGIGAGT--- 230

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKL 274
                S    GWR+   I V  S +  +    F   P      N P   K+ L
Sbjct: 231 -----SKIDNGWRILVAISVVPSMIQLISFYFFPDTPRFYIMNNQPERAKDVL 278

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 93/215 (43%), Gaps = 18/215 (8%)

Query: 58  IDNEDDSRDGVA-SSPVPPDKLLVITLSMYLGI--FLAAADGTLVSTIMAHIASEFNELP 114
           +++EDD+   +  +  V P    +ITL+    I  FL   D   +S+ +  I ++ +   
Sbjct: 100 VNDEDDTSVMITFNQGVSP---FIITLTFVASISGFLFGYDTGYISSALISIGTDLD--G 154

Query: 115 RISWIATAYLLSSATF------QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFW 168
           R+       ++++AT         + G  +D++GRKP +M +NI+FLVG ++      FW
Sbjct: 155 RVLTYGNKEIVTAATSLGALISSTMAGTAADMYGRKPCIMFSNIMFLVGAILQVSAHKFW 214

Query: 169 GLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSD 228
            +   R I        + +  + IS+I P   R     + + +   G          F+ 
Sbjct: 215 QMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGLGAAFNH 274

Query: 229 HGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
              GWR    I V LS + ++L   F    P + R
Sbjct: 275 VNNGWR----ILVGLSLVPTVLQFCFFLFLPDTPR 305

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 91/192 (47%), Gaps = 5/192 (2%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVIT-LSMYLGIFLAAADGTLVSTIMAHIASEFNELPR 115
           S+  ED++ +    + +P   +L  + +++ L +FLAA D  +VSTI+  +A +F     
Sbjct: 47  SVVLEDNASES---NELPKGFILYASLIALALSLFLAALDIMIVSTIIEEVAKQFGSYSE 103

Query: 116 ISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARF 175
           I W+ T Y L +A    ++G+++   G K  ++   ++F +G L+  L  S   L+G R 
Sbjct: 104 IGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRV 163

Query: 176 ISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRM 235
           I+      + S+  +  S +V    R +   + +  F + +         F+     WR 
Sbjct: 164 IAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSS-VTWRW 222

Query: 236 AFLIQVPLSALS 247
            F + +P+  L+
Sbjct: 223 CFYVNLPIGGLA 234

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 90/436 (20%), Positives = 166/436 (38%), Gaps = 25/436 (5%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  L ST   +  + F++   ++ I     + S   Q  + +LSD FGR  L     +++
Sbjct: 97  DAVLRSTYTGYATNSFSQHSLLATINVINSVVSIASQLFFARLSDHFGRLQLFGFCTLMY 156

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGL 214
           +VG ++   + +     G           V  + +I +SD   L  R       ++ + +
Sbjct: 157 IVGTILQSQSKNVSIYAGGAVFYNAGYTGVRLLMTIMMSDFSTLGWRYFMIASPDWCYII 216

Query: 215 GTACXXXXXXWFSDHGGGWR-----MAFLIQVPLSALSSLLIAVFMK---------LPPR 260
            T          S+    W       AF+  +    L   L+ +F K         L   
Sbjct: 217 ITWVSGNIIE-ISNPLENWSWDIAMWAFIFPLTTIPLVGFLVYMFYKASRTDEWKELRSV 275

Query: 261 SKRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAF--NSKTFVALCIGSS 318
           +K++ +P  IK    ++D  G                  G E     +S+    LC+GS 
Sbjct: 276 TKKMPTPVYIKEVFWNLDIPGVLLIAISLGCILIPLTVSGGETEEWKDSRNIGVLCLGSV 335

Query: 319 LACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM 378
           L   F +  E   AK P+L L++L++R V     +++F   A +  + YL  Y   ++  
Sbjct: 336 LFPIFLLW-EGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYLIATDYL--YAVLLVGF 392

Query: 379 NPTRVGKR---LMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPD 435
           N +    +    +P+F    +     G  + R      LT+  C    +        +  
Sbjct: 393 NQSESASQRITWLPSFAGVVITPF-TGLLITRWKHLKVLTITGCIFYYIAFGLFYRYRGG 451

Query: 436 IATWRQFIL-LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIG 494
                  I+  +  GFG  +     ++++ A   H   A  T++ Y F   G  +G SI 
Sbjct: 452 STNVAGIIVGTIFMGFGSGISTYPLMVSLQAVSSHTKIAIVTALFYTFEQVGRAVGSSIS 511

Query: 495 GAIFRQSLNGLLSRKV 510
           GAI+ Q +   +S+++
Sbjct: 512 GAIWTQVMFKEISKRL 527

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 92/445 (20%), Positives = 172/445 (38%), Gaps = 40/445 (8%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG        +  S + +   +S I     + SA  Q +Y +LSD++GR  L  ++ +++
Sbjct: 108 DGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVLY 167

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
            VG ++                       V  +  + +SD   LR R +YQ +  + F  
Sbjct: 168 SVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFII 227

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPR------- 260
                G  T+       W  D G  W   F    PLS +  L + + M    R       
Sbjct: 228 NTWISGNVTSRANPLKNWSWDIGM-WAFIF----PLSCVPLLCVMIHMWWLARKTEEWQE 282

Query: 261 ---SKRVNSPASIKNKLLSVDW----IGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
               K       +K+ ++ + W    +G                  GG +  +N+   + 
Sbjct: 283 LSKEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIG 342

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLP--- 369
             +   +     +  E   A+DPI+P   +++R V  S     F +  ++   YY+    
Sbjct: 343 PFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRGVWAS-----FAISFLIDFIYYMAADY 397

Query: 370 IYYSGVLNMNPT-RVGKRL--MPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH 426
           +Y   ++ +N + +   R+  +  F ST +GS      + R  +     +  C L +L  
Sbjct: 398 LYTVLIVGVNESVKSATRISSLSTFVST-VGSPIFSLLITRFSRLKPFIICGCGLWMLAM 456

Query: 427 LQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRST 485
             +   +    +    I  L + G G ++      +++ AA  H H A  T+++Y F   
Sbjct: 457 GLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVSVQAATSHEHMATVTALNYTFYRI 516

Query: 486 GSTLGVSIGGAIFRQSLNGLLSRKV 510
           GS +G ++ GAI+ Q+L   L ++V
Sbjct: 517 GSAVGAAVSGAIWTQTLYKQLLKRV 541

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 100/511 (19%), Positives = 191/511 (37%), Gaps = 72/511 (14%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS 117
           I     +R  V    +      ++  S+ L  ++AA D T       +  S FN    +S
Sbjct: 58  IKTRGVTRIEVVKEKMSTKVTWILAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLS 117

Query: 118 WIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG-LVGARFI 176
            +  A  +  A  +P   K+SD+  R     +  I++++G ++   +P+    +VG+ FI
Sbjct: 118 TLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFI 177

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDH------G 230
           +      +  M  + ++D   L+ R+    + +  + + T        W S +       
Sbjct: 178 AVGQSG-INLMNMVIVADTTSLKWRSFITSLLSVPYLVTT--------WISGYIVQNIIS 228

Query: 231 GGWRMA---FLIQVPLSALSSLLIAVFMK---------------LPPRSKRVNSPAS--- 269
             WR     F I  P++   ++L+  +++               L  + + +        
Sbjct: 229 SNWRWGYGMFAIITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGF 288

Query: 270 ------IKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVALCIGSSLACA 322
                 +K  L+ +D  G                     E  + + + +A+ +   +   
Sbjct: 289 KGYWQLLKTSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLI 348

Query: 323 FFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---- 378
            ++  E++ A  P+LP   L NR+ +     ++   M    +  +   Y   VLN+    
Sbjct: 349 SYVIFEVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKN 408

Query: 379 -----NPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH-LQINLM 432
                N T +G      FF    G L      +   +Y    V    + L+G  L +   
Sbjct: 409 WVYLSNTTTMGL----CFFGVVWGVL-----FRYFHRYKIFQVVGIAIKLIGMGLYVACS 459

Query: 433 KPDIATWRQFIL--LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLG 490
           K D +     I+  L++  FG +  +    +A  AAVPH   AAT S+   + S G+ +G
Sbjct: 460 KKDGSPGIGLIVAALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVG 519

Query: 491 VSIGGAIFRQSLNGLLSRKVLKFADKHPRKE 521
            +I  A++   L G L + V       P KE
Sbjct: 520 TAITSAVWTNELPGALLKYV-------PDKE 543

>TDEL0G05000 Chr7 (938512..939072) [561 bp, 186 aa] {ON} 
          Length = 186

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 62/157 (39%), Gaps = 5/157 (3%)

Query: 424 LGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFR 483
           LG+     ++     W   + L+    G  +     L   I A P +  A  TS  Y FR
Sbjct: 20  LGNFLFLFIEKGSPNWLVGLFLIPANLGQGITFPATLFTFIFAFPKSRQATATSTLYLFR 79

Query: 484 STGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSAPEF 543
           S GS  GV++   + +      L   +    D+    EL+  I   S   E +H    + 
Sbjct: 80  SIGSVWGVAMSTGVIQLYFGKSLRSNLKDLLDEDKINELVTKITSNSSYIEKLHGELKDV 139

Query: 544 IRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEY 580
           +   LI     A K T L  T+ S+  LA   +IKE+
Sbjct: 140 VIDVLI----LARKKTHLLSTILSLLALA-FCVIKEF 171

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 106/490 (21%), Positives = 185/490 (37%), Gaps = 59/490 (12%)

Query: 131 QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL-VGARFISXXXXXXVTSMCS 189
           Q  + +LSD+FGR  + ++  I+++VG ++           VGA F +         +  
Sbjct: 116 QISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLIL 175

Query: 190 ITISDIVPLRDRALYQGMCNF-------FFGLGTACXXXXXXWFSDHGGGWRMAFLIQVP 242
             +SD+ PLR R  YQ   +F         G           W  D  G W   F    P
Sbjct: 176 -VLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEAANPMKNWSWDI-GMWAFIF----P 229

Query: 243 LSALSSLLIAVF-------------MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXX 289
           LS+L  +    +             ++    + + N    +K+    +D +G        
Sbjct: 230 LSSLPFITYLFYATHISSKTKKWKDLRNKVETHKRNIILVVKDIFNQIDIVGTVLVTAAL 289

Query: 290 XXXXX-XXXXGGKEIAFNSKTFVA-LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV 347
                     GG    ++    +A L IG +L   F    E   AK+  LP + L++R V
Sbjct: 290 GLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFW-EAKFAKNAALPFNLLKDRGV 348

Query: 348 LGSSFSNWF-CMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMK 406
             S  + +   M+  M + Y  P+    V   N +      +P F +  L S+  G  + 
Sbjct: 349 WASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMA-CLCSVFFGLLVV 407

Query: 407 RTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIA 465
              +    T+    L ++        +   ++    I   ++ GFG ++     ++ + A
Sbjct: 408 SVQRLKVFTICGTFLWIISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSIIVTLQA 467

Query: 466 AVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEI 525
              H++ A+ T + + F   G+  G SI GAI+ Q++                 K+LL+ 
Sbjct: 468 MASHDNMASITGLYFMFAQVGAATGASISGAIWTQTM----------------YKQLLKQ 511

Query: 526 IEKASKSSEWVHDSAPEFI---------RPTLIGCYHFACKDTFLFCTLCSIGTLASISI 576
           + K S  +  V  S  EFI         R  +I  Y    K T L   + ++  L S+  
Sbjct: 512 L-KDSDLTMAVFASPYEFIASYAWGTKERDLVIQAYRHVQKVTMLVSLILTVPLLVSVLF 570

Query: 577 IKEYKLHASL 586
            K+ KL  S+
Sbjct: 571 TKDRKLSDSV 580

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 68/149 (45%), Gaps = 4/149 (2%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI- 116
           +++EDD+   +  +      +L++T +  +  F+   D   +S+ +  I ++ +      
Sbjct: 41  VNDEDDTSVMITFNQKISPFILILTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTY 100

Query: 117 --SWIATAYLLSSATFQPLYGKLS-DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
               I TA     A    ++  +S DIFGRKP LM +NI+F++G  +     SFW +   
Sbjct: 101 GDKEIITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVG 160

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRA 202
           R I        + +  + IS+I P   R 
Sbjct: 161 RLIMGFGVGIGSLLAPLFISEIAPKHIRG 189

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 103/506 (20%), Positives = 180/506 (35%), Gaps = 66/506 (13%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLS----------MYLGIFLAAA---------DGTL 98
           I+  +   D    SP PP K LVI  +           Y  + L +A         DG +
Sbjct: 32  IETNETDDDITIRSP-PPKKSLVIKQTEVMASVYDKWYYHVVLLVSAFICGYGYGLDGNI 90

Query: 99  VSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGC 158
                 +  S + E   +S +     + SA  Q +Y +LSD FGR  L ++  ++++VG 
Sbjct: 91  RYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIVLYVVGT 150

Query: 159 LMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF------ 212
           ++                       V  +  + +SD   L+ R  YQ    + F      
Sbjct: 151 IIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWPFIINTWI 210

Query: 213 -GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS---------- 261
            G  T        W  D  G W   F    PLS +  LL  + M+               
Sbjct: 211 SGNITLAANPLVHWSWD-VGMWAFIF----PLSCIPMLLCMIHMQWKASKTEEWKELKKE 265

Query: 262 -------------KRVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSK 308
                        K +     I   LL V W+G                 GG +  +N  
Sbjct: 266 KSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLA--------GGVKSKWNDG 317

Query: 309 TFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS-SFSNWFCMMAMMTTSYY 367
             +   +   +    F   E + A+DP++P + +++R V  S   S     +  M + Y 
Sbjct: 318 RIIGPFVLGFVLVPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYL 377

Query: 368 LPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHL 427
             +    V     +      + +F ST      A    + +    ++ VG C+L +L   
Sbjct: 378 YTVLIVAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVG-CSLWMLSMG 436

Query: 428 QINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTG 486
            +   +    +    I  L + G G ++      +++ +A  H + A  T+I+Y     G
Sbjct: 437 LLYHFRGGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQSATSHENMATVTAINYTCYRLG 496

Query: 487 STLGVSIGGAIFRQSLNGLLSRKVLK 512
           S +G ++ GAI+ Q L   + ++V +
Sbjct: 497 SAIGAAVSGAIWTQKLYPDILKRVTE 522

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 95/442 (21%), Positives = 166/442 (37%), Gaps = 34/442 (7%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG +      +  S ++E   +S I     + SA  Q +Y +LSDI+GR  LL++  +++
Sbjct: 96  DGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIYGRMSLLVVAIVLY 155

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
            VG ++                       V  +  + +SD   LR R  YQ +  + F  
Sbjct: 156 AVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWRLFYQFVPTWPFII 215

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFM----KLPPRSKR 263
                G  T        W  D  G W   F    PLS +  L   + M    +  P  K 
Sbjct: 216 NTWISGNITQKANPLKHWSWDI-GMWAFIF----PLSCVPILCCMIHMHWRVRNDPEWKE 270

Query: 264 VNSP----------ASIKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
           +              ++K     +D +G                  GG    +N    + 
Sbjct: 271 LQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIG 330

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV---LGSSFSNWFCMMAMMTTSYYLP 369
             +   +    F   E   A +P++P   +++R V   LG SF   F     +   Y + 
Sbjct: 331 PFVLGFVLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVL 390

Query: 370 IYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQI 429
           I        + TR+    + +F ST    + A    + T     + VG C+L LL    +
Sbjct: 391 IVAVHESVKSATRISS--LSSFVSTVASPIVALALTRVTRMKPVIIVG-CSLWLLAMGLL 447

Query: 430 NLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGST 488
              +    +    I  L + G G ++      +++ AA  H++ A  T+++Y     GS 
Sbjct: 448 YHFRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQAATNHDNMATVTALNYTLYRIGSA 507

Query: 489 LGVSIGGAIFRQSLNGLLSRKV 510
           +G ++ GAI+ Q+L   L +++
Sbjct: 508 VGAAVSGAIWTQTLYKQLLKRI 529

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 93/211 (44%), Gaps = 13/211 (6%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS 117
           I++EDD+   +  +      ++++T    +  F+   D   +S+ +  I  + +    ++
Sbjct: 117 INDEDDTSIMITFNQKISPFIIILTFVASISGFMFGYDTGYISSALLSINKDLDN-KILT 175

Query: 118 WIATAYLLSSATFQPLY-----GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVG 172
           +    Y+ ++ +   L      G  +D+FGRKP LM +N++F+VG ++   + +FW +  
Sbjct: 176 YGEKEYITAATSLGALITSIGAGTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCA 235

Query: 173 ARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGG 232
            R I        + +  + IS+I P   R     + +     G          F+    G
Sbjct: 236 GRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLCLTGGQLIAYGCGAGFNYVNNG 295

Query: 233 WRMAFLIQVPLSALSSLL-IAVFMKLP--PR 260
           WR    I V LS + +++    F+ LP  PR
Sbjct: 296 WR----ILVGLSLIPTVIQFTCFLFLPDTPR 322

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 86/413 (20%), Positives = 156/413 (37%), Gaps = 45/413 (10%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           SW  T+Y ++ A F    G+L DI G   L  ++   F V  L+C + P+F      R I
Sbjct: 67  SWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMPNFPAFAVFRAI 126

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA 236
                  +       I  + P      Y  + +  F             F+    G+R  
Sbjct: 127 QGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLGLIIGGAFATTKIGYRGI 186

Query: 237 FLIQVPLSALSSLLIAVFM----KLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXXXX 292
           F +   +  L S++   F     KL  + ++  +  S+K    S+D+IG           
Sbjct: 187 FYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVK----SLDFIGSLIFVAGSILI 242

Query: 293 XXXXXXGGKEIAFNSK-TFVALCIGSSLACAFFI---------------GVE---LYGAK 333
                 GG+  ++N   T+V L IG  L   FF+               G++    +   
Sbjct: 243 VVGLTEGGE--SWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSKYFEKV 300

Query: 334 DPILPLSFLRNRS----VLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMN-PTRVGKRLM 388
             ++P+  L  ++    VL  + +N     A + +  Y+   YS     N P   G +L+
Sbjct: 301 QLLIPIDVLFMKNFIPIVLAFALNN-----ACLFSCLYIIDQYSQYAERNSPLLAGVKLV 355

Query: 389 PNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH---LQINLMKPDIATWRQFI-L 444
           P      +G+    +   +      + +GF  L+L G    +Q++L+K D+  W+ F   
Sbjct: 356 PLIICMVIGNALCAFESTKLRPRVGVAIGF-FLALAGSIILIQLHLVKEDL-FWKIFFSA 413

Query: 445 LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAI 497
             + GFG ++    AL   +   P       + ++  F   G  +  S+  ++
Sbjct: 414 QALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASV 466

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 93/209 (44%), Gaps = 8/209 (3%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI 116
           ++++EDD+ + +  +      ++++T    L  FL   D   +S+ +  + ++     ++
Sbjct: 45  AVNDEDDTSELITFNQDVSWFIVMLTFVASLSGFLFGYDTGYISSALQSVGTDLGH--QL 102

Query: 117 SWIATAYLLSSATFQPLYGKL-----SDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171
           ++    Y+ S+ +   L   L     +D+FGR+  +M +NI+F+VG ++     +FW +V
Sbjct: 103 TYRDKEYITSATSLGALIAALGAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMV 162

Query: 172 GARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG 231
             R +        + +  + IS+I P   R     + + +   G          F     
Sbjct: 163 VGRLVMGFGIGFGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKH 222

Query: 232 GWRMAFLIQVPLSALSSLLIAVFMKLPPR 260
           GWR+   I + L A+   +  +F+   PR
Sbjct: 223 GWRILVGISM-LPAVLQFVSFIFLPDTPR 250

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 92/463 (19%), Positives = 173/463 (37%), Gaps = 38/463 (8%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           +V+  S +L  +    DG L S       + ++    +S I     +  A  Q +Y +LS
Sbjct: 81  VVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLS 140

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           D++GR  L +   + ++VG ++                       V  +  + +SD   L
Sbjct: 141 DVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSL 200

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFS---------DHGGGWRMAFLIQV-PLSALSS 248
           + R  Y  +  + F + T        W S         +    W +A    + PLS L  
Sbjct: 201 KWRLFYSFVPTWPFIINT--------WISGNIVDVAKPEQNWSWDIAMWAFIFPLSCLPL 252

Query: 249 LLIAVFMKLPPRS----KRVNSP----------ASIKNKLLSVDWIGXXXXXXXXX-XXX 293
           L   + MK   R     K ++S            S+      +D IG             
Sbjct: 253 LGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLDVIGVFFMIIILGCILV 312

Query: 294 XXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS 353
                GG    +N+   +A  I   +   FFI  E   A++PI P   LR+R +  +   
Sbjct: 313 PLTLAGGISNKWNNPHIIAPFILGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWAALCI 372

Query: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYW 413
            +         + YL       +N + T   +    + F++ + S     ++ R  +   
Sbjct: 373 AFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFALFITRFTRLKP 432

Query: 414 LTVGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHH 472
             +  C+L ++    +   +    + +  I  LV+ G G ++      +++ +   H + 
Sbjct: 433 FIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQSVTSHENM 492

Query: 473 AATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFAD 515
           A  T++SY     GS +G ++ GAI+ Q    LL +++L+  D
Sbjct: 493 ATVTALSYTMYRIGSAVGSAVSGAIWTQ----LLYKQLLQHLD 531

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 91/225 (40%), Gaps = 22/225 (9%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGI--------FLAAADGTLVSTIMAHIAS 108
           S+ ++++  D +   PV  +  + + ++   GI        F+A+  G +      +I+S
Sbjct: 52  SLSDDEEDNDRIQIKPVNDEDDVSVIITFNQGISPFILILTFVASISGFMFGYDTGYISS 111

Query: 109 EF----NELPRISWIATAYLLSSATF------QPLYGKLSDIFGRKPLLMLNNIVFLVGC 158
                  +L R        ++++AT           G  +DIFGRKP LM +N++F++G 
Sbjct: 112 ALISINKDLGRTLTYGDKEIITAATSLGALISSIFAGTAADIFGRKPCLMFSNVLFVIGA 171

Query: 159 LMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTAC 218
           ++      FW +   R I        + +  + IS+I P   R     + + +   G   
Sbjct: 172 ILQITAHRFWQMNAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLI 231

Query: 219 XXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
                   +    GWR    I V LS + ++L   F    P + R
Sbjct: 232 AYGCGAGLNHVHNGWR----ILVGLSLIPTVLQFSFFLFLPDTPR 272

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 99/230 (43%), Gaps = 13/230 (5%)

Query: 51  QGTDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110
           Q +D GS+  +D+  +   S     DKLL++      G+F + A  ++   ++  +  +F
Sbjct: 26  QKSD-GSLAGKDNESEIPYSRFKRRDKLLLVAQCASTGLFSSIA-ASIYFPVLTTVERKF 83

Query: 111 NELPRISWIATAYLLSSATFQPLY-GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169
           +     + I            P + G ++D  GR+P+++++ +++ V CL      ++  
Sbjct: 84  HITEEQANITVVVYYVFQGLSPSFMGNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQ 143

Query: 170 LVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDH 229
           L+G R +       V ++ S  ++DI    +R  Y G  +    LG+A         S  
Sbjct: 144 LIGLRCLQAAGISPVIAINSGMMTDITTRAERGGYVGYTSGCQVLGSAFGALIGAGLSSR 203

Query: 230 GGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRV------NSPASIKNK 273
             GWR  F     LS  S + + +   L P +KR        +P SI N+
Sbjct: 204 -WGWRSVFWF---LSIGSGICLVISTLLLPETKRTIVGNASITPRSILNR 249

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 88/210 (41%), Gaps = 10/210 (4%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN---EL 113
            + NE D      S      K+L++    + G F   A G++   ++  I  +FN   EL
Sbjct: 44  EVGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVA-GSIYYPVLTVIEKKFNITEEL 102

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
             ++ +   Y +       + G L+D FGR+P+++   + +   C+    + ++  ++  
Sbjct: 103 ANVTIVV--YFVFQGLAPSIMGGLADTFGRRPVVLWAVLTYCCACIGLASSHNYAQILAL 160

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R +       V ++ S  + D+    +R  Y G+ + F  +GTA         S    GW
Sbjct: 161 RCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLVSGFQVVGTAFGALIGAGLSSR-WGW 219

Query: 234 RMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
           R  F     L+  S + + V   L P +KR
Sbjct: 220 RAIFWF---LAIGSGICLVVSALLLPETKR 246

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 91/233 (39%), Gaps = 28/233 (12%)

Query: 54  DYGSIDNEDDSR---DGVASSPVPPDK-------------LLVITLSMYLGI--FLAAAD 95
           D  S D+E D     D +   PV  +                +ITL+    I  F+   D
Sbjct: 68  DINSFDHETDDENENDRIVIKPVNDEDDTSVIITFNQGISAFIITLTFVASISGFMFGYD 127

Query: 96  GTLVSTIMAHIASEFNELPRISW-----IATAYLLSSATFQPLYGKLSDIFGRKPLLMLN 150
              +S+ +  I ++ +    +S+     I  A  L +     + G  +DIFGR+P LM +
Sbjct: 128 TGYISSALVSIGTDLDN-KVLSYGDKEIITAATSLGALITSTMAGTAADIFGRRPCLMFS 186

Query: 151 NIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNF 210
           N++F++G ++      FW +   R I        + +  + IS+I P   R     + + 
Sbjct: 187 NVMFVIGAILQITAHKFWQMAVGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSL 246

Query: 211 FFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
           +   G           +    GWR    I V LS + ++L   F    P + R
Sbjct: 247 WLTGGQLIAYGCGAGLNHVNNGWR----ILVGLSLIPTVLQFSFFLFLPDTPR 295

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 83/428 (19%), Positives = 165/428 (38%), Gaps = 42/428 (9%)

Query: 101 TIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCL 159
           +++  +A ++N      SW  T+Y ++ A F    G+L DI G   L  ++   F +  L
Sbjct: 50  SLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSL 109

Query: 160 MCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACX 219
           +C + P+F      R I       +       I  + P      Y  + +  F       
Sbjct: 110 LCAVMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIGLG 169

Query: 220 XXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFM----KLPPRSKRVNSPASIKNKLL 275
                 F+    G+R  F +   + +L S++   F         + +++ +  S+K    
Sbjct: 170 LIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVK---- 225

Query: 276 SVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSK-TFVALCIGSSLACAFFI--------- 325
           S+D+IG                 GG+  ++N   T+V L IG  L   FF+         
Sbjct: 226 SLDFIGSLIFVAGSILIVVGLTEGGE--SWNRPVTYVTLIIGILLFFGFFVWNCTYAKIV 283

Query: 326 -GVELYGAKDP--------ILPLS--FLRNRSVLGSSFS-NWFCMMAMMTTSYYLPIYYS 373
            G+   G            ++P+   F++N   +  +F+ N  C+ + +   Y +  Y  
Sbjct: 284 RGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCL---YIIDQYSQ 340

Query: 374 GVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGH---LQIN 430
                +P   G +L+P      +G+    +   +      + +GF +L+L G    +Q++
Sbjct: 341 YAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGF-SLALAGSIILIQLH 399

Query: 431 LMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTL 489
           L+K ++  W+ F     + GFG ++    AL   +   P       + ++  F   G  +
Sbjct: 400 LIKDNV-FWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEI 458

Query: 490 GVSIGGAI 497
             S+  ++
Sbjct: 459 TFSVMASV 466

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 88/216 (40%), Gaps = 10/216 (4%)

Query: 51  QGTDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110
           +   +  IDNE +      S      K+L++    + G F   A G++   ++  I  +F
Sbjct: 42  RSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCAFTGFFSTVA-GSIYYPVLTIIERKF 100

Query: 111 N---ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSF 167
           N   EL  ++ +   Y +       + G L+D FGR+P+++   + +   C+      ++
Sbjct: 101 NITEELANVTIVV--YFIFQGVAPSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNY 158

Query: 168 WGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFS 227
             ++  R +       V ++ S  + D+    +R  Y G+   F  +GTA         S
Sbjct: 159 AQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIGAGLS 218

Query: 228 DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
               GWR  F     L+  S + +     L P +KR
Sbjct: 219 SK-WGWRAIFWF---LAIGSGICLVFSTLLMPETKR 250

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 93/220 (42%), Gaps = 7/220 (3%)

Query: 299 GGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV---LGSSFSNW 355
           GG    +N    +   I   +   FF   E + A+DP+LP   +++R V   +G SF   
Sbjct: 313 GGTSSKWNHGNVIGPFILGFVLIPFFALWEKFFARDPLLPAKLVKDRGVWSAMGISFLID 372

Query: 356 FCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLT 415
           F         Y + I        + TR+    + +F ST      A Y  + +    W+ 
Sbjct: 373 FIYYMAADYLYTVLIVAVDESVKSATRISS--LSSFVSTVASPFFALYLTRCSRLKPWIM 430

Query: 416 VGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAA 474
           +G C+L +L    +   +    +    I  L + G G ++      +++ AAV H + A 
Sbjct: 431 LG-CSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPVTVSVQAAVSHENMAT 489

Query: 475 TTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFA 514
            T+ +Y     GS +G ++ GAI+ Q+L   L + +   A
Sbjct: 490 VTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIA 529

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 86/408 (21%), Positives = 149/408 (36%), Gaps = 41/408 (10%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           SW  T+Y ++ A F    G+L DI G   L  ++   F +  L+CGL P+F      R +
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLMPNFEAFAVMRAL 126

Query: 177 SXXXXXXVTSMCSITISDIV-PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRM 235
                  +  MC   +  I+ P      Y  + +  F                + G + +
Sbjct: 127 QGIAAAGLV-MCGYALIPILSPKEQVQEYFSIVSCGFSSTIGIGFIIGGAXXGYKGIFYL 185

Query: 236 AFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK---LLSVDWIGXXXXXXXXXXX 292
            F      +A++ + I  F       K       +K     + S+D+IG           
Sbjct: 186 TF------AAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASLDFIGSLIFITGSILI 239

Query: 293 XXXXXXGGKEIAFNSKTFVALCIGSSLACAFFI----------GVELYGAKDP------- 335
                 GG+     +K +V   IG  L  +FF           G+ L G           
Sbjct: 240 VVGLTEGGESWR-EAKAYVTFAIGIILFLSFFAWNCFYLKIVNGIRLIGIDTTKYFEKVQ 298

Query: 336 -ILPLSF-LRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFS 393
            ++PL+       VL  + +N        ++ Y +  Y     N +P   G +L+P   S
Sbjct: 299 LLVPLNIHFMTXIVLAFAMNN----ACPFSSIYIIDQYSQYKENDSPLMAGVKLVPLIIS 354

Query: 394 TALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHL---QINLMKPDIATWRQFI-LLVIPG 449
             +G+   G    R    + +T+GF  L+L G +   Q+  +K D+  W+ F    V+ G
Sbjct: 355 MIIGNFLCGIEKTRMRPKFGVTLGF-FLALSGSIILTQLRAVKYDV-FWKIFFSAEVLVG 412

Query: 450 FGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAI 497
           FG ++    A    +   P       + ++  F   G  +  SI  ++
Sbjct: 413 FGVAIFYPYAQQLAVGRAPDEAKGIASGVAQTFGQLGIEIAFSIMASV 460

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 73/153 (47%), Gaps = 12/153 (7%)

Query: 58  IDNEDDSRDGVA-SSPVPPDKLLVITLSMYLGI--FLAAADGTLVSTIMAHIASEFN--E 112
           +++EDD+   +  +  V P    +ITL+    I  F+   D   +S+ +  I ++ +  E
Sbjct: 60  VNDEDDTSVMITFNQSVSP---FIITLTFVASISGFMFGYDTGYISSALVSIGTDLDNKE 116

Query: 113 LP--RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL 170
           L      +I  A  L +       G  +D++GRKP LM +N++FL+G ++     +FW +
Sbjct: 117 LTYGDKEFITAATSLGALISSIFAGVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQM 176

Query: 171 VGARFISXXXXXXVTSMCSITISDIVP--LRDR 201
              R I        + +  + IS+I P  LR R
Sbjct: 177 TVGRLIMGFGVGIGSLISPLFISEIAPKMLRGR 209

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           + + ++++L  +     G +  +I  + A+ F + P+I  I T   + +A     Y +LS
Sbjct: 62  IALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLS 121

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           D FGR    +   +++ VG ++   TP+F GL     I          + +   +DI  L
Sbjct: 122 DRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGL 181

Query: 199 RDR 201
           RDR
Sbjct: 182 RDR 184

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/432 (20%), Positives = 162/432 (37%), Gaps = 30/432 (6%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG +      +  S +++   +S I     + SA  Q +Y +LSD+FGR  L +   I++
Sbjct: 95  DGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILY 154

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
           +VG ++                       V  +  I +SD   L+ R LYQ    + F  
Sbjct: 155 VVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPFII 214

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKL----PPRSKR 263
                G  T+       W  D G  W   F    PLS +  +L  + M+      P  + 
Sbjct: 215 NTWIAGNITSRANPVVNWSWDVGM-WAFIF----PLSCIPIVLCMLHMQWRAGKTPEWQE 269

Query: 264 VNSPAS----------IKNKLLSVDWIGXXXXXXXXX-XXXXXXXXGGKEIAFNSKTFVA 312
           +    S          ++     +D IG                  GG +  +N    + 
Sbjct: 270 LKGQKSYYQEHGLMKILEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIG 329

Query: 313 -LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIY 371
              +G  L    ++    Y A+DPILP   +++R V  S   ++         + YL   
Sbjct: 330 PFVLGFVLIPILWVWEYSY-ARDPILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTV 388

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL 431
               +N +     +    + F + + S   G  M R  +     +  C+L +L    +  
Sbjct: 389 MIVAVNESIKSATRISTLSSFVSVVASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYR 448

Query: 432 MKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLG 490
            +    +    I  L + G G ++      +++ +AV H + A  T+++Y     GS +G
Sbjct: 449 FRGGSESHSGIIGALCVWGVGTTLFTYPVTVSVQSAVSHENLATVTALNYTMYRIGSAVG 508

Query: 491 VSIGGAIFRQSL 502
            ++ GAI+ Q+L
Sbjct: 509 SAVSGAIWTQTL 520

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 96/228 (42%), Gaps = 18/228 (7%)

Query: 57  SIDNEDDSRDGVASSPVP----PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF-- 110
           +I N+ D +D +   P        KL ++    + G F + A G +   +++ I ++F  
Sbjct: 55  TISNQLDEQDVMDMIPYSRFGTKSKLGLVVQCAFTGFFSSIA-GAIYYPVLSVIENKFHI 113

Query: 111 NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL 170
           NE  +++     Y +       L G L+D  GR+P+++ + I++   C+    + ++  +
Sbjct: 114 NE-EQVNMTVVVYFIFQGLSPTLMGGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQV 172

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHG 230
           +  R +       V ++ S  + D+    +R  Y G  + F  +GTA         S   
Sbjct: 173 IALRCLQAAGISPVIAINSGMMGDVTTKAERGGYVGYVSGFQVVGTATGAVFGALLSSR- 231

Query: 231 GGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRV------NSPASIKN 272
            GWR  F      S   S+   V + L P +KR        +P SI N
Sbjct: 232 WGWRSIFWFLAIGSGACSI---VSLLLLPETKRTIVGNGSVTPKSIYN 276

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 89/222 (40%), Gaps = 21/222 (9%)

Query: 59  DNEDDSRDGVASSPVPPDKLLVITLSMYLG------IFLAAADGTLVSTIMAHIASEFNE 112
           ++EDD R  +       D  ++IT +  +        F+A+  G +      +I+S    
Sbjct: 77  EDEDDGRIVIKPVNDEDDTSVIITFNQSISPFIITLTFVASISGFMFGYDTGYISSALIS 136

Query: 113 LPR------ISWIATAYLLSSATFQPLY-----GKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           + R      +++     + ++ +   L      G  +D+FGR+P LM +N++FL+G ++ 
Sbjct: 137 INRDLDNKVLTYGEKELITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQ 196

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
                FW +   R I        + +  + IS+I P   R     + + +   G      
Sbjct: 197 ITAHKFWQMAAGRLIMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYG 256

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
                +    GWR    I V LS + ++L   F    P + R
Sbjct: 257 CGAGLNHVKNGWR----ILVGLSLIPTVLQFSFFCFLPDTPR 294

>ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {ON}
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively and similar to YDR497C uniprot|P30605
           Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
           transporter with strong similarity to the minor myo-
           inositol transporter Itr2p, member of the sugar
           transporter superfamily; expression is repressed by
           inositol and choline via Opi1p and derepressed via Ino2p
           and Ino4p
          Length = 593

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 96/238 (40%), Gaps = 23/238 (9%)

Query: 56  GSIDNED--DSRDGVASSPVPPDK--------LLVITLSMYLGIFLAAADGTLVSTIMAH 105
           G  D ED  D  DG     V  D+        ++V+TL   +  F+   D   +S+ +  
Sbjct: 62  GEADGEDKKDFEDGYDEQSVFSDEYDEGLSWFVIVLTLVSSISGFMFGYDTGYISSALTS 121

Query: 106 IASEFNELPRISW----IATAYLLSSATFQPLY-GKLSDIFGRKPLLMLNNIVFLVGCLM 160
           +  + +    +S+    I TA     A    L+ G ++DI GRKP +M +N++FLVG ++
Sbjct: 122 VKQDLSN-KTLSYGDKEILTAATSLGAFISSLFAGIVADIIGRKPSIMASNVMFLVGIVL 180

Query: 161 CGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXX 220
                 +W +   R I        + +  + I +I P   R     + +     G     
Sbjct: 181 QVCAHKYWQMAAGRLIMGFGVGVGSLVAPLFIGEIAPSMIRGRLTVINSLCVTGGQLVAY 240

Query: 221 XXXXWFSDHGGGWR-MAFLIQVPLSALSSLLIAVFMKLP--PRSKRVNSPASIKNKLL 275
                 +    GWR +  L  +P+    +L  A FM LP  PR   + +      K+L
Sbjct: 241 ACGAGLTHVNNGWRVLVGLALIPV----ALQFAFFMFLPDTPRYYVMKNDVESARKVL 294

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 87/440 (19%), Positives = 164/440 (37%), Gaps = 30/440 (6%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +     +++ + F+E   +S +     + SA  Q +Y +L+D+FGR  L +   + +
Sbjct: 112 DSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGRLTLFITAVVFY 171

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
            +G ++   + +                 V  +  + +SD   L+ R  YQ    + F  
Sbjct: 172 SMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWRLFYQFAPTWPFII 231

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS----KR 263
                G  T+       W  D  G W   F    PLS +  +   + M    R     K 
Sbjct: 232 NTWISGNITSRANPQENWSWD-IGMWAFIF----PLSCVPLICCMLHMWWKARRTEEWKI 286

Query: 264 VNSPAS----------IKNKLLSVDWIGXXXXXXXXX-XXXXXXXXGGKEIAFNSKTFVA 312
           +N   +          IK     +D IG                  GG    ++    + 
Sbjct: 287 LNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIG 346

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS-SFSNWFCMMAMMTTSYYLPIY 371
             +   +     I  EL  A++PILP   +++R+V  S S S  +  +  M   Y   + 
Sbjct: 347 PLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYDFIFYMAYDYLYTVM 406

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL 431
              V     +      +  F ST      A Y  + T    ++  G C L ++    +  
Sbjct: 407 IVAVDESVKSATRISSLSAFVSTVFSPFFALYITRVTRLKPYIIAG-CGLWMVAMGLLYH 465

Query: 432 MKPDIATWRQFIL-LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLG 490
            +   ++    I  L + G G ++      +++ +A  H + A  TS++Y     GS +G
Sbjct: 466 FRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMATVTSLNYTLYRIGSAVG 525

Query: 491 VSIGGAIFRQSLNGLLSRKV 510
           +++ G I+ Q+L   + ++V
Sbjct: 526 IAVSGCIWTQNLYHEIFKRV 545

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 98/443 (22%), Positives = 166/443 (37%), Gaps = 36/443 (8%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG +      +  S ++E   +S I     + SA  Q +Y +LSD+FGR  L +   I++
Sbjct: 91  DGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILY 150

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
           +VG ++                       V  +  I +SD   L+ R LYQ    + F  
Sbjct: 151 VVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPFII 210

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFM----KLPPRSKR 263
                G  T+       W  D  G W   F    PLS +  +L  + M    K  P    
Sbjct: 211 NTWIAGNITSRANPVVNWSWD-VGMWAFIF----PLSCIPIVLCMLHMQWRAKKTPEWHT 265

Query: 264 VNSPAS----------IKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
           +    S          IK     +D IG                  GG +  +N    + 
Sbjct: 266 LKGQKSYYQEHGFIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIG 325

Query: 313 -LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS-SFSNWFCMMAMMTTSYYLPI 370
              +G  L    +I  E   A+DPILP   +++R+V  S   S     +  M   Y   +
Sbjct: 326 PFVLGFVLIPVLWIW-EYRFARDPILPYKLVKDRAVWSSMGISFLIDFIYYMAADYLYTV 384

Query: 371 YYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQIN 430
               V     +      + +F ST      A    + T    ++  G C+L ++    + 
Sbjct: 385 MIVAVNESVKSATRISTLSSFVSTVASPFFALLVTRCTRLKPFIMFG-CSLWMVAMGLLY 443

Query: 431 LMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTL 489
             +    +    I  L + G G ++      +++ +AV H + A  T+++Y     GS +
Sbjct: 444 HFRGGSQSHSGIIGALGVWGVGTTLFTYPVTVSVQSAVSHENMATVTALNYTLYRIGSAV 503

Query: 490 GVSIGGAIFRQSLNGLLSRKVLK 512
           G ++ GAI+ Q+L     +++LK
Sbjct: 504 GSAVSGAIWTQTLY----KQILK 522

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 3/109 (2%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPR 115
            + N+   +D    S    + + ++T    L   L  A  T   TIM  ++  FN E  +
Sbjct: 50  QVSNDSPWQDPTYFSSFGRELMFIVTC--MLAQLLNQAGQTHALTIMNVLSKSFNSESDK 107

Query: 116 ISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
            +W+  ++ L + +F  + G+L DI+G K +LM+  +  +V  L+CGL+
Sbjct: 108 QAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLS 156

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G  +D+FGR+P LM +N++FL+G ++      FW +   R I        + +  + IS+
Sbjct: 172 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIGSLISPLFISE 231

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF 254
           I P   R     + + +   G           +    GWR    I V LS + ++L   F
Sbjct: 232 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWR----ILVGLSLIPTVLQFSF 287

Query: 255 MKLPPRSKR 263
               P + R
Sbjct: 288 FCFLPDTPR 296

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 10/191 (5%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN---ELPRISWIATAYLLSSATFQP 132
           +K L+I    + G F + A G +   ++  I  +FN   EL  I+ +   Y +       
Sbjct: 98  EKSLLIIQCAFTGFFSSVA-GAIYYPVLTVIEKKFNITEELVNITVVV--YFIFQGLAPS 154

Query: 133 LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITI 192
             G L+D  GR+P+++ + +V+   C+   L+ ++  +V  R +       V ++ S   
Sbjct: 155 FMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGIC 214

Query: 193 SDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIA 252
            DI    +R  Y G  + F  +G+A         S    GWR  F     L+  S + + 
Sbjct: 215 GDITTRAERGAYVGYVSGFIVIGSAFGALIGAGLSST-WGWRSIFWF---LTIGSGICLM 270

Query: 253 VFMKLPPRSKR 263
           + + + P +KR
Sbjct: 271 ISIIVLPETKR 281

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 9/78 (11%)

Query: 490 GVSIGGA------IFRQSLNGLLSRKVLKFADKHPRKELLEIIEKASKSSEWVHDSAPEF 543
           GV+I GA        R+SL   L + V   +++HP+++L +I+ +A +SS W+  SAPEF
Sbjct: 582 GVAITGASILFNVALRKSLWTALEQLV---SEEHPQEQLQQILHRALESSHWIQHSAPEF 638

Query: 544 IRPTLIGCYHFACKDTFL 561
            + T+   +       FL
Sbjct: 639 AQETIYASFRHNFTTLFL 656

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G  +D+FGRKP LM +N++F++G ++      FW +   R I        + +  + IS+
Sbjct: 159 GTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGRLIMGFGVGIGSLISPLFISE 218

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF 254
           I P   R     + + +   G           +    GWR    I V LS + +++   F
Sbjct: 219 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNKVHNGWR----ILVGLSLIPTVIQFTF 274

Query: 255 MKLPPRSKR 263
               P + R
Sbjct: 275 FCFLPDTPR 283

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 87/219 (39%), Gaps = 28/219 (12%)

Query: 306 NSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMA--MMT 363
           +S + V L +GS L   F+I  E + A  P LP   L++R +       W  ++A  +M 
Sbjct: 194 HSDSIVPLVVGSVL-FVFYIVWESFMASYPALPFKLLKDRGI-------WIPILAGFLMD 245

Query: 364 TSYYLPIYYSGVLNMNPTRVGKRLMPN-----FFSTALGSLGAGYYMKRTGKYYWLTVG- 417
             YY    Y   + M       +   N      F T + S      ++ TG+  W  +G 
Sbjct: 246 LVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLKWYAIGG 305

Query: 418 ----FCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA 473
                 +L L    +      D         +V+ G G +      L  M A  PH   A
Sbjct: 306 FAIWMVSLGLFFRYRCGEGSHD----GMVAAVVLLGLGRTFTQFPLLTTMQARAPHTKMA 361

Query: 474 ATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK 512
             T + + + S GS +G SI GA++ Q     + +K+LK
Sbjct: 362 TVTGLFHVWGSVGSVVGASISGAVWTQK----MPKKLLK 396

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 99/460 (21%), Positives = 181/460 (39%), Gaps = 40/460 (8%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           ++ LS ++  +    DG +      +  S ++E   +S I     + SA  Q +Y +LSD
Sbjct: 76  ILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSD 135

Query: 140 IFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLR 199
           +FGR  L +   I+++VG ++                       V  +  I +SD   L+
Sbjct: 136 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLK 195

Query: 200 DRALYQGMCNFFF-------GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIA 252
            R LYQ +  + F       G  T+       W  D  G W   F    PLS +  +L  
Sbjct: 196 WRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWD-VGMWAFIF----PLSCVPIVLCM 250

Query: 253 VFMKLPPRSKRVNSPASIKN-----------KLLS-----VDWIGXXXXXXXXXXXXX-X 295
           + M+   R+++     ++K            K+L      +D +G               
Sbjct: 251 LHMQW--RARKTPEWHALKGQKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPL 308

Query: 296 XXXGGKEIAFNSKTFVA-LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV---LGSS 351
              GG +  +N    +    +G  L    +I  E   A+DPILP   +++R+V   +G S
Sbjct: 309 TLAGGVKTTWNDSRLIGPFVLGFVLIPILWIW-EYRFARDPILPYRLVKDRAVWSSMGIS 367

Query: 352 FSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411
           F   F         Y + I        + TR+    + +F ST      A    + T   
Sbjct: 368 FLIDFIYYMAADYLYTVMIVAVNESVKSATRIAT--LSSFVSTVASPFFALLVTRCTRLK 425

Query: 412 YWLTVGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHN 470
            ++  G C L ++    +   +    +    I  L + G G ++      +++ +AV H 
Sbjct: 426 PFIMFG-CALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYPVTVSVQSAVSHE 484

Query: 471 HHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
           + A  T+++Y     GS +G ++ GAI+ Q+L   + +++
Sbjct: 485 NMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRM 524

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 91/464 (19%), Positives = 170/464 (36%), Gaps = 43/464 (9%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           K+L+I+ +   G F  + D TL ST   +  + ++E   +S +     + S   Q +Y +
Sbjct: 59  KILLISTAFVCG-FGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSR 117

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LSD FGR  L ++  I +++G ++                          + ++ +SD  
Sbjct: 118 LSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFS 177

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFS---------DHGGGWRMAFLIQV-PLSAL 246
            L+ R  YQ          +        W S              W +A    + PLSAL
Sbjct: 178 SLKWRMFYQ--------YASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSAL 229

Query: 247 SSLLIAVFMK-----------LPPRSKRVNSPASIKNKLL---SVDWIGXXXXXXXXXXX 292
             + + ++MK           L  ++++  +    +N +     +D +G           
Sbjct: 230 PIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCI 289

Query: 293 XXXXXXGGK--EIAFNSKTFVALCIGSSLACAFFIGV--ELYGAKDPILPLSFLRNRSVL 348
                   +  +   NSK    L  G    C FFI +  E   AK P+LP   L +R + 
Sbjct: 290 LVPLTLANETSQKWHNSKIIATLVSG---GCLFFIFLYWEAKFAKSPLLPFKLLSDRGIW 346

Query: 349 GS-SFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKR 407
                + +      ++  Y  P+    +   + +      +P+F + A  S      + +
Sbjct: 347 APLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVA-ATASPFYSLLVAK 405

Query: 408 TGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILL-VIPGFGYSVLITVALLAMIAA 466
           T K     +G C   ++        +    +    I   VI G    +     ++ + A 
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSVIVILQAM 465

Query: 467 VPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
             H+  A  T I Y F   G+ +G S+ GAI+ Q++   L + +
Sbjct: 466 TTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNL 509

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 69/149 (46%), Gaps = 6/149 (4%)

Query: 59  DNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF--NELPR- 115
           ++EDD+   +  +      +LV+TL   +  F+   D   +S+ +  I ++    EL   
Sbjct: 69  NDEDDTSVMITFNQGVSPFILVLTLVASISGFMFGYDTGYISSALISIKTDLGGEELTYG 128

Query: 116 -ISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGAR 174
               I  A  L +     + G  +D++GRK  +M +N++FLVG ++     SFW +   R
Sbjct: 129 GKEIITAATSLGALITSLMAGTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGR 188

Query: 175 FISXXXXXXVTSMCSITISDIVP--LRDR 201
            I        + +  + IS+I P  +R R
Sbjct: 189 LIMGFGVGIGSLISPLFISEIAPKMIRGR 217

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 90/440 (20%), Positives = 164/440 (37%), Gaps = 30/440 (6%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG +      +  S ++E   +S I     + SA  Q +Y +LSD+FGR  L +   I++
Sbjct: 96  DGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILY 155

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
           +VG ++                       V  +  I +SD   L+ R LYQ    + F  
Sbjct: 156 VVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSLKWRLLYQFAPTWPFII 215

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKL----PPRSKR 263
                G  T+       W  D  G W   F    PLS +  +L  + M+      P    
Sbjct: 216 NTWIAGNITSKANPVENWSWDI-GMWAFIF----PLSCIPIVLCMLHMQWIARKTPEWHA 270

Query: 264 VNSPAS----------IKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
           +    S          ++     +D IG                  GG +  +N    + 
Sbjct: 271 LKDEKSYYQEHGFVKVLEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIG 330

Query: 313 -LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIY 371
              +G  L    ++  E   A+DPI+P   +++R V  S   ++         + YL   
Sbjct: 331 PFVLGFVLIPILWVW-EYRVARDPIIPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTV 389

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL 431
               +N +     +    + F + + S   G  M R  +     +  C L +L    +  
Sbjct: 390 MLVAVNESIKSATRISTLSSFVSVVASPFFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYR 449

Query: 432 MKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLG 490
            +    +    I  L + G G ++      +++ +AV H + A  T+++Y     GS +G
Sbjct: 450 YRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQSAVSHENLATVTALNYTLYRIGSAVG 509

Query: 491 VSIGGAIFRQSLNGLLSRKV 510
            ++ GAI+ Q+L   + +++
Sbjct: 510 AAVSGAIWTQTLYKQILKRM 529

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 3/76 (3%)

Query: 91  LAAADGTLVSTIMAHIASEF--NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           L  A  T   +IM  IA+ F  NE  R +W+  ++ L S +F  + G+L DI+G K +L 
Sbjct: 82  LNQAGTTQTLSIMNIIANSFGSNENSR-TWLMASFPLVSGSFILISGRLGDIYGLKKMLT 140

Query: 149 LNNIVFLVGCLMCGLT 164
           +  +V ++  L+CGLT
Sbjct: 141 IGYVVIIIWSLICGLT 156

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/224 (20%), Positives = 90/224 (40%), Gaps = 23/224 (10%)

Query: 59  DNEDDSRDGVASSPV--PPDKLLVITLSMYLG------IFLAAADGTLVSTIMAHIASEF 110
            +ED+  D +   PV    D  ++IT +  +        F+A+  G +      +I+S  
Sbjct: 75  QDEDEDEDRIVIKPVNDEDDTSVIITFNQSISPFIITLTFVASISGFMFGYDTGYISSAL 134

Query: 111 NELPR------ISWIATAYLLSSATFQPLY-----GKLSDIFGRKPLLMLNNIVFLVGCL 159
             + +      +++     + ++ +   L      G  +D+FGR+P LM +N++FL+G +
Sbjct: 135 ISINKDLDNKELTYGEREIITAATSLGALITSIGAGTAADVFGRRPCLMFSNLMFLIGAI 194

Query: 160 MCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACX 219
           +      FW +   R +        + +  + IS+I P   R     + + +   G    
Sbjct: 195 LQITAHRFWQMAAGRLVMGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIA 254

Query: 220 XXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
                  +    GWR    I V LS + +++   F    P + R
Sbjct: 255 YGCGAGLNHVNNGWR----ILVGLSLVPTVIQFTFFCFLPDTPR 294

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G  +D+FGR+P LM +N++FL+G ++      FW +   R I        + +  + IS+
Sbjct: 178 GTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMGFGVGIGSLISPLFISE 237

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF 254
           I P   R     + + +   G           +    GWR    I V LS + ++L   F
Sbjct: 238 IAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWR----ILVGLSLIPTVLQFSF 293

Query: 255 MKLPPRSKR 263
               P + R
Sbjct: 294 FCFLPDTPR 302

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 92/440 (20%), Positives = 165/440 (37%), Gaps = 30/440 (6%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           DG +      +  S + E   +S I     ++SA  Q +Y + SD+FGR  L +++ + +
Sbjct: 129 DGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVVFY 188

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQG-------M 207
            VG ++              F        V  +  + +SD   L+ R  YQ        +
Sbjct: 189 AVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRLFYQFAPTWPYII 248

Query: 208 CNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFM----------KL 257
             +  G  T+       W  D G  W   F    PLS++  +L  + M          KL
Sbjct: 249 NTWISGNITSAANPLKHWSWDIGM-WAFIF----PLSSIPIILCLIHMRWMASKTKEWKL 303

Query: 258 PPRSKRVNSP----ASIKNKLLSVDWIGXXXXXXXXXXXXX-XXXXGGKEIAFNSKTFVA 312
             + K         ++I +    +D IG                  GG    +N    +A
Sbjct: 304 LKQEKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTLAGGTSSKWNHGNIIA 363

Query: 313 LCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS-SFSNWFCMMAMMTTSYYLPIY 371
                 +    F   E   +K P++P   +++R+V  S + S     +  M   Y   + 
Sbjct: 364 PFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFLIDFIFYMAVDYLYTVL 423

Query: 372 YSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINL 431
             GV     +      + +F ST +GS      + R  +     V  C L +L    +  
Sbjct: 424 IVGVNESVKSATRISSLSSFVST-VGSPIFALLITRFTRLKPFIVAGCALWMLSMGLLYH 482

Query: 432 MKPDIATWRQFIL-LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLG 490
            +   ++    I  L + G G ++      +++ AAV H   A  T+++Y     GS +G
Sbjct: 483 YRGGASSHNGIIASLCVWGVGTTLFTYPINVSVQAAVSHADMATVTALNYTMYRIGSAVG 542

Query: 491 VSIGGAIFRQSLNGLLSRKV 510
            ++ GAI+ Q+L   L +++
Sbjct: 543 AAVSGAIWTQTLYKQLHKRM 562

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 109/287 (37%), Gaps = 19/287 (6%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           + + ++++L  +     G +  +I  + A+ F +  ++  I T   + ++     Y ++S
Sbjct: 63  ITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARMS 122

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           D FGR    M   +++ VG ++   TP+F GL     I          + +    D+  L
Sbjct: 123 DRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSGL 182

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDHGG--GWRMA---FLIQVPLSALSSLLIAV 253
           RDR     +      + T          + H     WR     F I VP S L  +L   
Sbjct: 183 RDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPYA 242

Query: 254 FMK--------LPP---RSKRVNSPASIKNKLLSVDWIGXXX-XXXXXXXXXXXXXXGGK 301
           + +        LPP   R K  N   ++   +  ++ IG                  GG 
Sbjct: 243 YAQYIGWRNGTLPPYKLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLLLPLTIAGGA 302

Query: 302 EIAFNSKTFVAL-CIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV 347
              +     +A+  +G  L   F I  EL  AK+P +P  +L + ++
Sbjct: 303 TSKWREGYIIAMIVVGGCLGFIFLIW-ELRFAKNPFIPRVYLGDPTI 348

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 126/303 (41%), Gaps = 30/303 (9%)

Query: 118 WIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFIS 177
           W+  ++ L S +F  + G+L DI+G K +L+L  ++ ++  L+ GL  S +   G  FI 
Sbjct: 95  WLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSLITGL--SGYSHSGIFFII 152

Query: 178 XXXXXXVTSMCSITISDIVPL-----RDRALYQGMCNFFFGLGTACXXXXXXWFS----- 227
                 +    S+ + +++ L     +   L + M     G  +         FS     
Sbjct: 153 ARAFQGLG--ISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVAT 210

Query: 228 DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXX 287
           +  G W  AF     L+A  +  I+ +  +P      N P ++    LS+DWIG      
Sbjct: 211 ESEGSWPWAFY-AYTLAAFINTFIS-YYSIPN-----NIPTNVNR--LSMDWIGSFTGVL 261

Query: 288 XXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV 347
                         +  +NS   + L + S +A   F   EL  A++P+LP   +RNR +
Sbjct: 262 GLILFNFVWNQAPAD-GWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIRNRQL 320

Query: 348 LGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---NPTRVGKRLMPNFFSTALGSLGAGYY 404
           +    +  F   +    ++Y   Y+S VLN+   +P   G        S  + ++  G+ 
Sbjct: 321 IMILTAMTFGWGSFGIWTFY---YFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGFL 377

Query: 405 MKR 407
           MK+
Sbjct: 378 MKK 380

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 86/201 (42%), Gaps = 9/201 (4%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF---NELPRISWIATAYLLSSATFQP 132
           +K+ ++    + G+F + A G++   +++ +  EF    E   +S +   Y +  A    
Sbjct: 97  EKIFLVIQCAFTGLFSSIA-GSIYYPVLSVMEKEFYITEEQVNVSVVV--YFIFQALSPT 153

Query: 133 LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITI 192
           L G L+D  GR+P+++ + +++   C+      ++  L+G R +       V ++ S  +
Sbjct: 154 LMGGLADSLGRRPVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPVIAVNSGIM 213

Query: 193 SDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIA 252
            D+    +R  Y G+ +    LGTA         S     WR  F   V  S +   LI 
Sbjct: 214 GDVTTKAERGGYMGLVSGTQVLGTAFGALIGAGLSSR-WSWRSIFWFLVIGSGIC--LIV 270

Query: 253 VFMKLPPRSKRVNSPASIKNK 273
             + LP   + V    SI  K
Sbjct: 271 SIIVLPETKRTVAGNGSITPK 291

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 60/119 (50%), Gaps = 1/119 (0%)

Query: 90  FLAAADGTLVSTIMAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           F+     ++++     +A EFN  L  IS++    +L+ A    +    + +FG++ L +
Sbjct: 89  FVGGGQTSILAAGSRSLAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYL 148

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGM 207
           +  IVF  G + C ++ S+  L+ +R +S      + S+ S T+++I    +RA   G+
Sbjct: 149 IGIIVFFFGSIGCSVSHSYESLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGV 207

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 54/127 (42%), Gaps = 4/127 (3%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           L++ FGRK  +M++ I + VG ++C  + S   +   RFI             I +S+ V
Sbjct: 159 LNEWFGRKSSIMISCIWYTVGAILCAASTSHHLMYAGRFILGVGVGIEGGCVGIYVSESV 218

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P   R     M  F   LG          F D  GGWR  F++   L   + LL+ +F  
Sbjct: 219 PSTVRGNLVSMYQFNIALGELFGYIVGVIFFDVHGGWR--FMVGSSLVFSTILLVGMF-- 274

Query: 257 LPPRSKR 263
             P S R
Sbjct: 275 FLPESPR 281

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 91/213 (42%), Gaps = 17/213 (7%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASE-------F 110
           +++EDD+   +  +      ++++T    +  F+   D   +S+ +  I ++       +
Sbjct: 48  VNDEDDTSVMITFNQKVSPFIIILTFVASISGFMFGYDTGYISSALVSIGTDLDNKTLTY 107

Query: 111 NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL 170
            E   I+   +   L +A F    G  +D+FGRKP +M +N++F++G ++     +FW +
Sbjct: 108 GEKEIITAATSLGALITAVFA---GVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFWQM 164

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHG 230
              R +        + +  + IS+I P   R     + +     G               
Sbjct: 165 AIGRLVMGFGVGIGSLISPLFISEIAPKMIRGRLTVVNSLCLTGGQLIAYACGAGLDKVH 224

Query: 231 GGWRMAFLIQVPLSALSSLL-IAVFMKLP--PR 260
            GWR    I V LS + +++   +FM LP  PR
Sbjct: 225 NGWR----ILVGLSLIPTVIQFTMFMFLPDTPR 253

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 8/174 (4%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  +FN +  +++     YLL       + G L+D++GR+P+++   ++F+V  +  
Sbjct: 114 LKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGI 173

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCN--FFFGLGTACX 219
              PS+  +V  R I         ++ S  +SD    R+R  + G  +     G G    
Sbjct: 174 AKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTFVGATSGLVLIGQGIGPL 233

Query: 220 XXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                  + H   WR  F   + +   S ++I  F+ LP   + +    SIK K
Sbjct: 234 LGAVITAALH---WRAVFWF-LTIGCGSCMIIGFFL-LPETKRTIVGNLSIKPK 282

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 4/149 (2%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRI- 116
           +++EDD+   +  +      ++V+T    +  F+   D   +S+ +  I ++ +      
Sbjct: 80  VNDEDDTSVMITFNQKVSPFIIVLTFVASISGFMFGYDTGYISSALVSIGTDLDHRALTY 139

Query: 117 ---SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
                I  A  L +       G  +DI+GRKP LM +N++F VG ++     SFW +   
Sbjct: 140 GDKEIITAATSLGALISSIFAGTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVG 199

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRA 202
           R I        + +  + I +I P   R 
Sbjct: 200 RLIMGFGVGIGSLISPLFIGEIAPKNIRG 228

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/353 (23%), Positives = 130/353 (36%), Gaps = 55/353 (15%)

Query: 63  DSRDGVASSPVP------------PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF 110
           + RDG   +  P            P K  +  LS  L   L  A  T  + +   ++ + 
Sbjct: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDL 82

Query: 111 N-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169
           N ++ +  W+  ++ L S +F  + GK+ DI+G K  L+   +V ++  L+CGL+     
Sbjct: 83  NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHN 142

Query: 170 L---VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXW- 225
           +   V AR         V       + +I      A      N  F L  AC        
Sbjct: 143 VDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEA-----KNLVFSLIGACAPIGATLG 197

Query: 226 --FSDHGG------GWRM-AFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLS 276
             FS   G      GW   A+ I   L+ L +L I     +P      N P ++      
Sbjct: 198 CVFSGLIGARTDLWGWTFYAYAITAALNGLVALWI-----IPN-----NIPTNVNE--YK 245

Query: 277 VDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPI 336
           +DWIG                       + S   + L I + +A   FI  E+  AK P+
Sbjct: 246 MDWIGSAIGVFGLILFNFVWNQ-APIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPL 304

Query: 337 LPLSFLRNRS---VLGSSFSNW--------FCMMAMMTTSYYLPIYYSGVLNM 378
           LP S L NR    +L S F  W        + M  M+   +Y P++  G   M
Sbjct: 305 LPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFM 357

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 93/228 (40%), Gaps = 12/228 (5%)

Query: 54  DYGSIDNEDDSRDGVASSPVPPDKLL-------VITLSMYLGIFLAAADGTLVSTIMAHI 106
           D  S+ + D+ ++  AS    P  LL       ++ L    G F ++    +    +  +
Sbjct: 59  DGDSLQSSDEEKNEQASESTSPYTLLTYKQKWGMVALLTMCG-FWSSLGSPIYYPALRQL 117

Query: 107 ASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP 165
             +F  +  +++     YLL       + G L+D+FGR+P++++  ++++V  +     P
Sbjct: 118 EKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLACAP 177

Query: 166 SFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXW 225
           S+  +V  R I         ++ S  + D     +R  + G  +    LG  C       
Sbjct: 178 SYGVIVFLRIIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQ-CFGSLIGA 236

Query: 226 FSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                  WR  F   + +   +S +IA F+ LP   + +    SI+ K
Sbjct: 237 VLAAAWNWRAIFWF-LTIGCGTSFIIA-FLLLPETKRTLVGNLSIRPK 282

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 83/217 (38%), Gaps = 35/217 (16%)

Query: 52  GTDYGSIDNEDDSR------DGVASSPV--------PPD--------------KLLVITL 83
           G D   +D+ED+ +      D     P+         PD              K+ ++  
Sbjct: 27  GPDLSEVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMALVLQ 86

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFN---ELPRISWIATAYLLSSATFQPLYGKLSDI 140
             Y G+F   A G +   +++ I  +F+   EL  I+ +   Y +       L G L+D 
Sbjct: 87  CAYTGLFSTMA-GAIYYPVLSVIEKQFHITEELVNITVVV--YFIFQGIAPTLMGGLADS 143

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
            GR+P+++    V+   C+      ++  +V  R +       V ++ S  I D+    +
Sbjct: 144 LGRRPVVLFAVTVYFGACIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAE 203

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAF 237
           R  Y G  + F  LG+A         S    GWR  F
Sbjct: 204 RGGYVGYISGFQVLGSAFGALIGAGLSSR-WGWRSIF 239

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/270 (20%), Positives = 108/270 (40%), Gaps = 55/270 (20%)

Query: 317 SSLACAF-FIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGV 375
           SSL+  F ++ V  Y AK+        RN+ +  +  S WF   A ++T+ ++ +    +
Sbjct: 374 SSLSLWFTYLAVVFYAAKES-------RNKGIYDAEISCWFLTGAYVSTTSFIFM----L 422

Query: 376 LNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPD 435
           + +         +    ST LG++ A  +++                   H+ IN++   
Sbjct: 423 MEIQDLNTKSLYLSLTLSTFLGAVVAKKFLE------------------DHIYINMV--- 461

Query: 436 IATWRQFILLVIPG-----FGYSVLITVALLAMIAAVPHNHHAATTSISYAFR------- 483
                Q ILLV+ G       +    T+ L A+ + +  +   A  S             
Sbjct: 462 ----IQLILLVLQGKVIDVHSFVTSKTIYLTALTSTLMFSFGVALGSYFSKLNKEKNIIT 517

Query: 484 -----STGSTLGVSIGGAIFRQSLNGLLSRKVLKF-ADKHPRKELLEIIEKASKSSEWVH 537
                +T +   + + G  F+  +   L R++ ++    H   EL   I+KA  S EW+ 
Sbjct: 518 ILGEGTTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIR 577

Query: 538 DSAPEFIRPTLIGCYHFACKDTFLFCTLCS 567
           + +P+ I  ++  CY  + +  F+F   C+
Sbjct: 578 EDSPDLISTSIFSCYLDSIRYVFIFNLFCT 607

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 90/464 (19%), Positives = 169/464 (36%), Gaps = 43/464 (9%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           K+L+I+ +   G F  + D TL ST   +  + ++E   +S +     + S   Q +Y +
Sbjct: 59  KILLISTAFVCG-FGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSR 117

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LSD FGR  L ++  I +++G ++                          + ++ +SD  
Sbjct: 118 LSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFS 177

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFS---------DHGGGWRMAFLIQV-PLSAL 246
            L+ R  YQ          +        W S              W +A    + PLS L
Sbjct: 178 SLKWRMFYQ--------YASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTL 229

Query: 247 SSLLIAVFMK-----------LPPRSKRVNSPASIKNKLL---SVDWIGXXXXXXXXXXX 292
             + + ++MK           L  ++++  +    +N +     +D +G           
Sbjct: 230 PIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSLGCI 289

Query: 293 XXXXXXGGK--EIAFNSKTFVALCIGSSLACAFFIGV--ELYGAKDPILPLSFLRNRSVL 348
                   +  +   NSK    L  G    C FFI +  E   AK P+LP   L +R + 
Sbjct: 290 LVPLTLANETSQKWHNSKIIATLVSG---GCLFFIFLYWEAKFAKSPLLPFKLLSDRGIW 346

Query: 349 GS-SFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKR 407
                + +      ++  Y  P+    +   + +      +P+F + A  S      + +
Sbjct: 347 APLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVA-ATASPFYSLLVAK 405

Query: 408 TGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILL-VIPGFGYSVLITVALLAMIAA 466
           T K     +G C   ++        +    +    I   VI G    +     ++ + A 
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGLSGLLCSNSVIVILQAM 465

Query: 467 VPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
             H+  A  T I Y F   G+ +G S+ GAI+ Q++   L + +
Sbjct: 466 TTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNL 509

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 90/221 (40%), Gaps = 21/221 (9%)

Query: 60  NEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN---ELPRI 116
           + +  R+   S   P +K +++ +    G F   A G +    +  I  +F+   EL  +
Sbjct: 2   DAEKVREAPHSRFGPREKFVLVLVCASTGFFSTIA-GAIYYPALNTIEGQFHISTELVNV 60

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           S +   Y L       L G L+D FGR+P+++ +  +++  C+    + ++  ++  R +
Sbjct: 61  SIVL--YFLFQGLSPTLMGGLADSFGRRPVVLWSVALYMAACIGIACSKTYAQILVLRCL 118

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGG---- 232
                  V ++ S  + D+     R  Y G+   F  +G+A            GGG    
Sbjct: 119 QSAGISPVIAVNSGIMGDVTTREQRGGYVGLTAGFQVIGSAFGALI-------GGGIVST 171

Query: 233 --WRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIK 271
             WR  F      S  S  L+  F+ LP   + +    SI+
Sbjct: 172 WSWRAVFWFLAIASGFS--LVVTFIMLPETKRSIVGNGSIQ 210

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 87  LGIFLAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKP 145
           +G  L  A  T   +IM  IA +F +E  + +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145

Query: 146 LLMLNNIVFLVGCLMCGLT 164
           +L+L   +  +  ++CGLT
Sbjct: 146 MLLLGYAILTIWSIICGLT 164

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 97/219 (44%), Gaps = 22/219 (10%)

Query: 306 NSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS---SFSNWFCMMAMM 362
            ++  V   IG  +A   F+  E   A+ P+ P S L++R V+ +   +F   FC+   M
Sbjct: 299 TAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIHFCVY--M 356

Query: 363 TTSYYLPIYYSGVLNMNPTRVGKRL--MPNFFSTALGSLGAGY---YMKRTGKY--YWLT 415
              Y   +    V      +  +R+  + NF S   G+L  G+   Y+KRT K+  + + 
Sbjct: 357 QADYMYTVLVIAV--HESVKAAQRITTLFNFVSIITGTL-LGFVIVYVKRTKKFILFGVC 413

Query: 416 VGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIAAVP-HNHHA 473
           V F    LL H      + D ++    I  L + GFG       A ++M A+   H   A
Sbjct: 414 VWFVAFGLLVHF-----RGDESSHSGIIGALCLLGFGGGFFNYSAQVSMQASTAAHQDLA 468

Query: 474 ATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLK 512
             TS+  A  + GS    +I GAI+   L   L++++ +
Sbjct: 469 VVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITE 507

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 95/237 (40%), Gaps = 25/237 (10%)

Query: 57  SIDNEDDSRDGVASSPVPP-------------DKLLVITLSMYLGIF--LAAADGTLVST 101
           SID E  S     S+ + P             +K L++    + G F  +AAA    V T
Sbjct: 36  SIDVEQSSCTRTKSARLEPHYTSPPYSRFGRREKFLLVVQCAFTGFFSTIAAAIYYPVLT 95

Query: 102 IMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           ++  +     E  +++     Y +       L G L+D  GR+P+++L+ +V+   C+  
Sbjct: 96  VIEDLFDISEE--KVNITVVVYFIFQGISPTLMGGLADYLGRRPIVILSVLVYFSACVGL 153

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
             + S+  ++  R +       V ++ S  + D+    +R  Y G  +    +G+A    
Sbjct: 154 ACSQSYAQIIALRCLQAAGISPVIAINSGIMGDVTTRAERGGYVGYVSGCQVVGSAFGAL 213

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRV-----NSPASIKNK 273
                S    GWR  F      S   + L+A  + LP   + V      +P S+ NK
Sbjct: 214 IGAGLSSR-WGWRSIFWFLAIGSG--ACLVATVLFLPETKRTVVGNGSVTPKSVINK 267

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 71/152 (46%), Gaps = 10/152 (6%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRIS 117
           +++EDD+   +  +      ++++T    +  FL   D   +S+ +  I ++ +   R+ 
Sbjct: 50  VNDEDDTSVMITFNQKVSPFIIILTFVASISGFLFGYDTGYISSALISIGTDLDN--RVL 107

Query: 118 WIATAYLLSSATF------QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171
                 ++++AT           G  +DI+GRKP LM++N+ F++G ++     +FW + 
Sbjct: 108 TYGDKEIITAATSLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQMA 167

Query: 172 GARFISXXXXXXVTSMCSITISDIVP--LRDR 201
             R I        + +  + I +I P  +R R
Sbjct: 168 VGRLIMGFGVGIGSLISPLFIGEIAPKMIRGR 199

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 75/175 (42%), Gaps = 6/175 (3%)

Query: 103 MAHIASEF--NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLM 160
           +  +  EF  NE  +++     YLL         G L+D +GR+P+++   +V++V  + 
Sbjct: 137 LRQLEKEFHLNE-SQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIG 195

Query: 161 CGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXX 220
               PS+  +V  R +         ++ S  +SD    R+R  + G  + F  +G     
Sbjct: 196 LARAPSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERGTFVGATSGFVLIGQGIGP 255

Query: 221 XXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLL 275
                 +     WR  F   V +   +S+LIA F+ LP   + +    SI+ K L
Sbjct: 256 LLGAVIAAR-WDWRAIFWFLV-IGCGTSMLIAFFL-LPETKRTIVGNLSIEPKKL 307

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNEL-PRISWIATAYLLSSATFQPLY 134
           D++L + LS  +G  L  A  T+  + M  +  E +    + SW+  ++ L S +F  + 
Sbjct: 62  DEVLFV-LSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILIS 120

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           G+L DI+G K +L+L  I   +  L+CGL+
Sbjct: 121 GRLGDIYGLKKMLLLGYIWLTIWSLICGLS 150

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 6/150 (4%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE---LP 114
           +++EDD+   +  +      ++++T    +  F+   D   +S+ +  I ++ +      
Sbjct: 66  VNDEDDTSVMITFNQSLSPFIIILTFVASISGFMFGYDTGYISSALISIGTDLDNKVLTY 125

Query: 115 RISWIATAYLLSSATFQPLY-GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
           R   I TA     A    ++ G  +D+FGRK  LM +N++F++G ++     +FW +   
Sbjct: 126 REKEIVTAATSLGALITSIFAGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAG 185

Query: 174 RFISXXXXXXVTSMCSITISDIVP--LRDR 201
           R I        + +  + IS+I P  +R R
Sbjct: 186 RLIMGFGVGIGSLIAPLFISEIAPKMIRGR 215

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 91/459 (19%), Positives = 167/459 (36%), Gaps = 39/459 (8%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           +++  S ++  F    D  +      +  S + +   +S +A    L SA  Q  Y +LS
Sbjct: 64  VILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYARLS 123

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           D+FGR  L +++ + +++G ++                       +  +  + +SD   L
Sbjct: 124 DVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGLFLILVLILSDCSSL 183

Query: 199 RDRALYQGMCNFFFGLGT-------ACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLI 251
           + R  YQ    + F + T       +       W S   G W   F    PL+ L  L  
Sbjct: 184 KWRLFYQYAPTWPFIIITWISGNIISRANPIENW-SWGIGMWAFIF----PLTCLPILFC 238

Query: 252 AVFMKLPPR----------SKRVNSPASIKNKLLSVDW----IGXXXXXXXXXXXXX-XX 296
            + M+   R           K       I   L+ + W    +G                
Sbjct: 239 MLHMRFKARKTPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVGIFIMTISLGCILVPLT 298

Query: 297 XXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNW- 355
             GG    + +   +   +   +    FI  E   AKDP+ P   L++R +  S   N+ 
Sbjct: 299 LAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRGIWASMCFNFL 358

Query: 356 ----FCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKY 411
               +CM A     Y  P+    V     +      + +F ST + S   GY + R+ + 
Sbjct: 359 MDFVYCMAA----GYLYPVLIVAVDESTKSATRITSLASFVST-VASPFMGYAVSRSTRL 413

Query: 412 YWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVAL-LAMIAAVPHN 470
               V  C +  L    +   +  + +    I  ++       L    + ++  +   H 
Sbjct: 414 KPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSIYPINVSAQSLTSHE 473

Query: 471 HHAATTSISYAFRSTGSTLGVSIGGAIFRQSL-NGLLSR 508
           + A+ T+++Y     G  +GV++ GAI+ Q+L N LL R
Sbjct: 474 NMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKR 512

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 11/134 (8%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFW-GLVGARFISXXXXXXVTSMCSITIS 193
           GKL DI+GR+  L+L  I+F++G L+   +   W      R I+      +  +  + IS
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAVLSPMLIS 193

Query: 194 DIVPLRDR----ALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSL 249
           ++ P   R    + YQ M  F   LG  C      +   +   WR    I V L  L S+
Sbjct: 194 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSY--SNSAQWR----IGVGLQFLWSI 247

Query: 250 LIAVFMKLPPRSKR 263
           ++   M   P S R
Sbjct: 248 IMVCAMMFVPESPR 261

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 6/145 (4%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEF---NELPRISWIATAYLLSSATFQP 132
           DK+++I    + G F + A G +   ++  I   F    E   IS +   Y +       
Sbjct: 121 DKIMLIAQCAFTGFFSSIA-GAIYYPVLTLIEGLFKITEEQANISVVV--YFIFQGIAPI 177

Query: 133 LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITI 192
           + G L+D  GR+PL++   +++   C+      ++  L+G R +       V ++ S   
Sbjct: 178 IVGNLADTNGRRPLILSCLLIYFCACVGLASCNTYAQLIGLRCLQAAGIAPVIAINSGIA 237

Query: 193 SDIVPLRDRALYQGMCNFFFGLGTA 217
            DI   R+R  Y G  + F  +G+A
Sbjct: 238 GDITTRRERGSYIGYVSGFVVIGSA 262

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 126/317 (39%), Gaps = 54/317 (17%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT------------ 164
           SW+  ++ L S +F  + G++ DIFG K +L++  ++ ++  L+CGLT            
Sbjct: 119 SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVS 178

Query: 165 ------------PSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF 212
                       P+  G++G  ++        T   +I IS I  +       G C FF 
Sbjct: 179 RAFQGLGIAFVLPNVLGIIGNVYVGG------TFRKNIVISFIGAMAPIGATLG-C-FFA 230

Query: 213 GL-GTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIK 271
           GL GT            +   W  AF     ++A+ +L+++++  +P      N P ++ 
Sbjct: 231 GLIGTM-----------NPNQWPWAFY-AYTITAVINLILSIY-AIPN-----NIPTNVH 272

Query: 272 NKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYG 331
               S+DWIG                       +N    + L I S L    F   E++ 
Sbjct: 273 R--FSMDWIGSGLGVIGLVLLNLVWNQAPIS-GWNQAYIIVLLIISVLFLVLFGVYEIHF 329

Query: 332 AKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNF 391
           AK P+LP + +++R ++    S +F   +    ++Y   +   + +  P   G       
Sbjct: 330 AKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFL 389

Query: 392 FSTALGSLGAGYYMKRT 408
               + +L  G+ +KR 
Sbjct: 390 IWGIIAALLVGFSIKRV 406

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 90  FLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           F++ A  T   +IM  +A E N E  R +W+  ++ LS  +F  + G+L DI+G K +L+
Sbjct: 110 FMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLL 169

Query: 149 LNNIVFLVGCLMCGLT 164
               +  +  L+CG +
Sbjct: 170 GGYAILTIWSLICGFS 185

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 64/147 (43%), Gaps = 20/147 (13%)

Query: 146 LLMLNNIVFLVGCLMCGLTP----SFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDR 201
           +L ++ I F+ GC+M  +TP     F  ++G  F+            SI +SD +P++  
Sbjct: 430 ILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQ-- 487

Query: 202 ALYQGMC--------NFFFGLGTACXXXXXXWFSDHGG----GWRMAFLIQVPLSALSSL 249
             YQGM         N+   +          + +D+G     G+R A +    L+ L  +
Sbjct: 488 --YQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGII 545

Query: 250 LIAVFMKLPPRSKRVNSPASIKNKLLS 276
           +  ++M +   + R NS ++ K K L 
Sbjct: 546 VSGIYMVINLITIRENSKSTNKPKHLE 572

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 265 NSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFF 324
           N P +I N  LS+DWIG                     + + S   + L + S  A   F
Sbjct: 285 NIPTNIYN--LSMDWIGAILGIFGLLILNFVFNQA-PIVGWQSAYIIVLLVLSFCALVIF 341

Query: 325 IGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM 378
           +  E+  AK P++P +   NR +L   F+ +    A  T ++Y   Y+S VLN+
Sbjct: 342 VVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFY---YFSFVLNV 392

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           V+ ++++L  +     G +  +I  + A+ F +  ++  I T   + S+     Y ++SD
Sbjct: 60  VLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSD 119

Query: 140 IFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLR 199
            FGR    +   +++ VG ++   TP+F GL     I          + +    D+  LR
Sbjct: 120 RFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLR 179

Query: 200 DR 201
           DR
Sbjct: 180 DR 181

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 68/145 (46%), Gaps = 6/145 (4%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN---ELPRISWIATAYLLSSATFQP 132
           +KL+++ +    GIF   A G +    +  I ++F+   EL  +S +   Y L       
Sbjct: 42  EKLVLVAICAASGIFSTIA-GPIYYPALTTIENQFHISTELVNVSVVL--YFLFQGLAPT 98

Query: 133 LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITI 192
           L G L+D FGR+P++M +  ++L  C+    + ++  ++  R +       V ++ S  +
Sbjct: 99  LMGGLADSFGRRPIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVIAVNSGIM 158

Query: 193 SDIVPLRDRALYQGMCNFFFGLGTA 217
            D+     R  Y G+   F  LG+A
Sbjct: 159 GDVTTRAQRGGYVGLTAGFQVLGSA 183

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +      + AS + +   +S I     ++SAT Q +Y + SDIFGR  LL++  I +
Sbjct: 130 DSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSLLLVAIICY 189

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGM 207
           +VG ++              F        V+ + ++ +SD   L+ R  YQ +
Sbjct: 190 VVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQAI 242

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 78/168 (46%), Gaps = 14/168 (8%)

Query: 57  SIDNEDDSRDGVASSPVP----PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN- 111
           S  NE D    +AS P       +K++++    + G F + A G +   +++ I +EFN 
Sbjct: 57  SNQNEPD----IASPPYSRFGTTEKMILVIQCAFTGFFSSIA-GAIYYPVLSVIENEFNI 111

Query: 112 --ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169
             E+  I+ +   Y +       + G L+D  GR+P+++ + +V+   C+    + ++  
Sbjct: 112 TEEMVNITVVV--YFIFQGIAPSIMGGLADSMGRRPVVLSSVLVYCCACIGLACSHTYAQ 169

Query: 170 LVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
           ++  R +       V ++ S  + DI    +R  Y G  + F  +G+A
Sbjct: 170 IIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYVSGFQVIGSA 217

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 53/125 (42%), Gaps = 3/125 (2%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LS+ FGRK  L+++ I + VG ++C    +   +   RF+             + I++ V
Sbjct: 160 LSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAGRFLIGVGVGIEGGGIGVYIAESV 219

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIA-VFM 255
           P   R     +  F   LG          F D  GGWR  +++   L   + LLI  +F+
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWR--YMVGSSLVFSTILLIGLLFL 277

Query: 256 KLPPR 260
              PR
Sbjct: 278 PESPR 282

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 45/81 (55%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           +   S ++  F    D ++  T M +  + ++    IS ++   L+ SA  Q ++G LSD
Sbjct: 71  IFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSD 130

Query: 140 IFGRKPLLMLNNIVFLVGCLM 160
           IFGR  L +++ ++++VG ++
Sbjct: 131 IFGRLTLFLVSIVLYIVGTII 151

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 91/442 (20%), Positives = 170/442 (38%), Gaps = 50/442 (11%)

Query: 95  DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVF 154
           D  +      +  S ++E   +S +     + SA  Q +Y +LSD FGR  L ++  +++
Sbjct: 84  DSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARLSDAFGRFRLFVVAIVLY 143

Query: 155 LVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFF-- 212
            +G ++                       V  +  + +SD+  LR R  YQ +  + +  
Sbjct: 144 SMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMSTLRWRLFYQFVPTWPYII 203

Query: 213 -----GLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSP 267
                G  T+       W  D G  W   F    PLS L   ++A  + +  R+++    
Sbjct: 204 NTWISGNITSAANPIENWSWDVGM-WAFIF----PLSCLP--ILACMIHMQWRARKTQEW 256

Query: 268 ASIKNK------------LLSVDW----IGXXXXXXXXXXXXX-XXXXGGKEIAF-NSKT 309
             +K +            L+S+ W    IG                  GG    + +S+ 
Sbjct: 257 KDLKTQKTYYQQHGLMKSLVSLFWKIDIIGVLLMAASLGCILVPLTLAGGTSSKWRDSRI 316

Query: 310 FVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV---LGSSFSNWFCMMAMMTTSY 366
                +G  L   FFI  + + A DPI+P   +++R V   LG SF        ++   Y
Sbjct: 317 IGVFVLGFVLIPIFFIWEKKF-ATDPIVPYKLVKDRGVWASLGISF--------LIDFIY 367

Query: 367 YLP---IYYSGVLNMNPTRVGKRLMPNFFS--TALGSLGAGYYMKRTGKYYWLTVGFCTL 421
           Y+    +Y   ++ +N +      + + +S  + + S      + R  +     +  C L
Sbjct: 368 YMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKPFIIFGCCL 427

Query: 422 SLLGHLQINLMKPDIATWRQFIL-LVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISY 480
             L    +   +   ++    I  L + G G +       +++ AAV H   A  ++++Y
Sbjct: 428 WFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQAAVSHEQMATVSALNY 487

Query: 481 AFRSTGSTLGVSIGGAIFRQSL 502
            F   GS +G ++ GAI+ Q L
Sbjct: 488 TFYRIGSAVGAAVSGAIWTQKL 509

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 89/426 (20%), Positives = 161/426 (37%), Gaps = 66/426 (15%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTP----------- 165
           +W+  ++ L+S +F  + G++ DI+G K   +  NI+F +  ++CG++            
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 166 -SFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXX 224
            +F GL G  F+       V +     I ++  +R   +       F G    C      
Sbjct: 173 RAFQGL-GVAFVLPNVMGLVGN-----IYNVGSMRKNIVIS-----FIG----CMAPVGQ 217

Query: 225 WFSDHGGG---------WRMAFLIQVPLSALSSLLIAVFMKLPPRSKRV--NSPASIKNK 273
            F    GG         W   F          +  IAVF+ L      +  + P +I N 
Sbjct: 218 TFGGMWGGLIVDSNKDQWPWIFF---------ATAIAVFINLIMGIYSIPNHVPTNIYN- 267

Query: 274 LLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAK 333
            L +DWIG                         +   V L +      AFFI  EL  A+
Sbjct: 268 -LKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFI-YELKKAE 325

Query: 334 DPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNM---NPTRVGKRLMPN 390
            P+LP    +NR ++    S +    A    ++Y   YY+  LN+   +P   G      
Sbjct: 326 SPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFY---YYAFNLNLRHFSPLWAGSTHFVF 382

Query: 391 FFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSL---LGHLQINLMKPDIATWRQFI-LLV 446
               +L ++   + + + G     +V FC  S+    G++  ++  PD   WR  + + +
Sbjct: 383 IIFGSLTAITVAFTINKVGP----SVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQI 438

Query: 447 IPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLL 506
           I   G  +    + + +   +P  +   + S+     +  ++L + +G     Q  NG  
Sbjct: 439 ILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNG-- 496

Query: 507 SRKVLK 512
            + VLK
Sbjct: 497 GKDVLK 502

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 60/150 (40%), Gaps = 7/150 (4%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
            S+ FGRK  L ++ + + VG ++C    +   +   RF+             + I++ V
Sbjct: 160 FSEYFGRKKSLAISCVFYTVGAIVCAAASNHHEMYAGRFLIGIGVGLEGGGIGVYIAESV 219

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIA-VFM 255
           P   R     +  F   LG          F D  GGWR  +++   L   ++L I  +F+
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGWR--YMVGSSLVFSTTLFIGLLFL 277

Query: 256 KLPPR----SKRVNSPASIKNKLLSVDWIG 281
              PR      RV    ++  +L  V+  G
Sbjct: 278 PESPRWLMHKGRVGESWNVWKRLRDVNEEG 307

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 71/174 (40%), Gaps = 15/174 (8%)

Query: 105 HIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           HI+ E     +++     Y +  A    L G L+D  GR+P+++ + I++   C+     
Sbjct: 113 HISEE-----QVNMTVVVYYIFQALSPTLMGGLADSLGRRPVVLSSVIIYFCACVGLARC 167

Query: 165 PSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXX 224
            ++  ++  R +       V ++ S  + D+    +R  Y G  + F  +GTA       
Sbjct: 168 NTYAQIIALRCVQAAGISPVIAINSGMMGDVTTKAERGGYVGYVSGFQVVGTATGAVFGA 227

Query: 225 WFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRV------NSPASIKN 272
             S    GWR  F      S   S+   V + L P +KR        +P SI N
Sbjct: 228 LLSSR-WGWRSIFWFLAIGSGACSI---VSLLLLPETKRTIVGNGSVTPKSIYN 277

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 71/174 (40%), Gaps = 4/174 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  +FN +   ++     YLL       + G L+D FGR+P+++   ++++V  +  
Sbjct: 123 LRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGL 182

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
              PS+  ++  R I         ++ S  + D     +R  + G  + F  LG  C   
Sbjct: 183 ACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLG-QCFGS 241

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLL 275
                      WR  F   + +   S  LIA F+ LP   + +    SIK K L
Sbjct: 242 LIGAVLTARWDWRSIFWF-LTIGCGSCFLIA-FLILPETKRTIAGNLSIKPKRL 293

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 70/172 (40%), Gaps = 4/172 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  +FN +   I+     YLL       + G L+D FGR+P+++   ++++V  +  
Sbjct: 124 LRQLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGL 183

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
              PS+  ++  R I         ++ S  + D     +R  + G  + F  LG  C   
Sbjct: 184 ACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLG-QCFGS 242

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                      WR  F   + +   S  LIA F+ LP   + +    SI+ K
Sbjct: 243 LIGAVLTARWDWRSIFWF-LTIGCGSCFLIA-FLVLPETKRTIAGNLSIRPK 292

>TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.241
           YIL121W
          Length = 484

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 68/161 (42%), Gaps = 3/161 (1%)

Query: 78  LLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGK 136
           + ++ +  + G+F + A G +   ++  I   F     +++     Y +       + G 
Sbjct: 1   MFLVIICSFTGVFSSVA-GAIYYPVLQVIQGLFEITEEQVNITIVVYFIFQGIAPSIIGN 59

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           L+D  GR+P++++   ++   C+      ++  LVG R +       V +M S  + D+ 
Sbjct: 60  LADSMGRRPIVIIAVTLYFCACVGLSCCNNYAQLVGLRCLQAAGISPVIAMNSGIMGDVT 119

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAF 237
              +RA Y G  + F  +GTA         S    GWR  F
Sbjct: 120 TRAERAGYVGYVSGFQIIGTALGALIGARLSSR-WGWRGIF 159

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 59/118 (50%), Gaps = 1/118 (0%)

Query: 90  FLAAADGTLVSTIMAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148
           F+     ++++     +A EF+  L  IS++    +L+ A    +    + IFG++ + +
Sbjct: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYL 152

Query: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQG 206
           +  I+F  G + C ++ ++  L+ +R +S      + S+ S T+++I    +RA   G
Sbjct: 153 VGIIIFFFGSIGCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLG 210

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 70/172 (40%), Gaps = 4/172 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  +FN +   ++     YLL       + G L+D FGR+P+++   +++++  +  
Sbjct: 124 LRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGL 183

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
              PS+  ++  R I         ++ S  + D     +R  + G  + F  LG  C   
Sbjct: 184 ACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLG-QCFGS 242

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                      WR  F   + +   S  LIA F+ LP   + +    SIK K
Sbjct: 243 LIGAVLTARWDWRAIFWF-LTIGCGSCFLIA-FLILPETKRTIAGNLSIKPK 292

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 4/127 (3%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           L++ FGRK  ++++ + + VG ++C  +     +   RF+             I IS+ V
Sbjct: 163 LNEWFGRKASIIISCVWYTVGAILCAASHDHHLMYAGRFMLGVGVGIEGGCVGIYISESV 222

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P   R     +  F   LG          F D  GGWR  F++   L   ++LLI +F  
Sbjct: 223 PSSVRGNLVSLYQFNIALGELFGYIIGVIFFDVKGGWR--FMVGSSLVFSTALLIGLF-- 278

Query: 257 LPPRSKR 263
             P S R
Sbjct: 279 FLPESPR 285

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 87/209 (41%), Gaps = 18/209 (8%)

Query: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYW 413
           N F M+A++ T  YLP+Y + V N +  ++  R++P + S     L    Y K+    Y 
Sbjct: 372 NMFSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARYAKK----YN 427

Query: 414 LTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHA 473
            ++    + L+G+ Q+  +      W  F+   IP  G +        ++I A   N   
Sbjct: 428 TSLLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVT--------SVIMANTKNMRD 479

Query: 474 ATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADKHPRKELLEIIEKAS-KS 532
               I       G +  + +   +F ++L+  L   +LK   +  +K+ L  I + + K+
Sbjct: 480 FAVGI-----LVGGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKELLKILEKTIKN 534

Query: 533 SEWVHDSAPEFIRPTLIGCYHFACKDTFL 561
            +W    AP   R  +   +  A    FL
Sbjct: 535 PQWALIDAPAITRGAITNSFALAIHQIFL 563

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/164 (19%), Positives = 77/164 (46%), Gaps = 12/164 (7%)

Query: 56  GSIDNEDDSRDGVASSPVPPD-----------KLLVITLSMYLGIFLAAADGTLVSTIMA 104
           GS D+   ++ G+  +P P +           +  +  + +    F+     +++++  +
Sbjct: 81  GSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFS 140

Query: 105 HIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL 163
            +++E    L +IS++    +LS           + +FG++ + ++  ++F++G + C  
Sbjct: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200

Query: 164 TPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGM 207
           + SF  L+ +R +S      V S+ S TI++I    +RA   G+
Sbjct: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 80/415 (19%), Positives = 151/415 (36%), Gaps = 49/415 (11%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFI 176
           SW  T+Y ++ A F    G+L DI G   L  ++   F +  L+C + P+F      R I
Sbjct: 67  SWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVMPNFPAFAVFRAI 126

Query: 177 SXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA 236
                  +       I  + P  +   Y  + +  F             F+    G++  
Sbjct: 127 QGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKIGYKGI 186

Query: 237 FLIQVPLSALSSLLIAVF------MKLPPRSKRVNSPASIKNKLLSVDWIGXXXXXXXXX 290
           F +   +  L S++   F      +  PPR  +        N++ S+D+IG         
Sbjct: 187 FYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQAT------NRVRSLDFIGSLIFVTGSI 240

Query: 291 XXXXXXXXGGKEIAFNS-KTFVALC------------------IGSSLACAFFIGVELYG 331
                   GG+  ++N   T+V L                   I   + C        + 
Sbjct: 241 LIVVGLTEGGE--SWNRPATYVTLVIGIILFFGFFFWNCSYARIVRGIRCCGIDTSRYFE 298

Query: 332 AKDPILPLSFLRNRS----VLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMN-PTRVGKR 386
               ++P+  L  ++    VL  + +N     A + +  Y+   YS     N P   G +
Sbjct: 299 KVQLLIPVDVLFMKNFIPIVLAFALNN-----ACLFSCIYIIDQYSQYEEKNSPLYAGVK 353

Query: 387 LMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHL---QINLMKPDIATWRQFI 443
           L+P      +G+    +   +      + +GF +L+L G +   Q++L+K D+  W+ F 
Sbjct: 354 LVPLIICMVIGNGLCAFESTKLKPKVGVVLGF-SLALAGSIILTQLHLIKEDM-FWKIFF 411

Query: 444 -LLVIPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAI 497
               + GFG ++    AL   +   P       + ++  F   G  +  S+  ++
Sbjct: 412 SSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSVMASV 466

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 71/172 (41%), Gaps = 4/172 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  EFN +  +++     YLL       + G L+D+FGR+P+++   ++++V  +  
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGL 184

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
              PS+  +   R I         ++ S  + D     +R  + G  +    LG  C   
Sbjct: 185 ACAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLG-QCFGS 243

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                      WR  F   + + +  +L++A F  LP   + +    SIK K
Sbjct: 244 LIGAVLTARWDWRAIFWF-LAIGSGVALIVAAFT-LPETKRTIVGNLSIKPK 293

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 47/81 (58%)

Query: 81  ITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           I  S++L  F+   D  +  ++ A+  + + +   +S +     +++A   PLY +LSD+
Sbjct: 77  IFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLYSRLSDV 136

Query: 141 FGRKPLLMLNNIVFLVGCLMC 161
           FGR  L++++ ++++ G ++C
Sbjct: 137 FGRIELIVVSVLLYVAGTIIC 157

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LS+ FGRK  L+++ I + +G ++C        +   RF+             + I++ V
Sbjct: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWR 234
           P   R     +  F   LG          F D  GGWR
Sbjct: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGWR 249

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 12/122 (9%)

Query: 51  QGTDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIF-------LAAADGTLVSTIM 103
           +GT + ++++E    +    +P    K        YL IF       L  A  T   +IM
Sbjct: 41  RGTAFTNLEDEMVECNQKWQNP----KYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIM 96

Query: 104 AHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG 162
             ++  F +E    SW+  ++ L S +F  + G+L DI+G K +L++  ++ ++  L+CG
Sbjct: 97  NILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG 156

Query: 163 LT 164
           +T
Sbjct: 157 IT 158

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 83/203 (40%), Gaps = 11/203 (5%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQP-LYG 135
           K ++I    + G F   A G +   +++ I  +FN   ++  +            P L G
Sbjct: 82  KTVLIAQCAFTGFFSTIA-GAIYYPVLSVIERKFNIDEQLVNVTVVVYFVFQGLAPTLMG 140

Query: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDI 195
             +D  GR+P++++  I++   C+    T ++  ++  R +       V ++ S  + DI
Sbjct: 141 GFADSLGRRPVVLIAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDI 200

Query: 196 VPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAF---LIQVPLSALSSLLIA 252
               +R  Y G    F  LG+A         S    GWR  F    I   +  L+SLLI 
Sbjct: 201 TTRAERGGYVGYAAGFQVLGSAFGALIGAGLSSR-WGWRAIFWFLTIGSGICFLASLLI- 258

Query: 253 VFMKLPPRSKRVNSPASIKNKLL 275
               LP   + ++   S+  K L
Sbjct: 259 ----LPETKRNISGNGSVMPKSL 277

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 66/150 (44%), Gaps = 6/150 (4%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE----L 113
           +++EDD+   +  +      ++++T    +  FL   D   +S+ +  I ++ +      
Sbjct: 62  VNDEDDTSVMITFNQSISPFIIILTFVASISGFLFGYDTGYISSALISIGTDLDNKVLTY 121

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
                I  A  L +       G  +DI+GRK  LM +N +F++G ++     +FW +   
Sbjct: 122 GEKEIITAATSLGALITSIFAGTAADIYGRKRCLMGSNFMFVIGAILQVSAHTFWQMAVG 181

Query: 174 RFISXXXXXXVTSMCSITISDIVP--LRDR 201
           R I        + +  + IS+I P  +R R
Sbjct: 182 RLIMGFGVGIGSLISPLFISEIAPKMIRGR 211

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 91  LAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLML 149
           L  A  T   +IM  ++  F +E    SW+  ++ L S +F  + G+L DI+G K +L++
Sbjct: 81  LNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 140

Query: 150 NNIVFLVGCLMCGLT 164
             ++ ++  L+CG+T
Sbjct: 141 GYVLVIIWSLICGIT 155

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 88/237 (37%), Gaps = 30/237 (12%)

Query: 112 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLV 171
           E    SW  TAY ++ A F    G++ DI G   L + +  +F +  L+C +  +F    
Sbjct: 58  EFTTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGTFA 117

Query: 172 GARFISXXXXXXVTSMCSITISDIVP--------LRDRALYQGM-----CNF--FFGLGT 216
             R           ++  I  + IVP        L D    Q       C F   FG+G 
Sbjct: 118 VFR-----------ALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGF 166

Query: 217 ACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIK-NKLL 275
                       + G + + F + + +S +S   I       P +K  +SP + K +  L
Sbjct: 167 IIGGAFTLTRIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTK--DSPKTTKWSDAL 224

Query: 276 SVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGA 332
           S+D+IG                 GG+        +V L +G +L   FFI    YG 
Sbjct: 225 SLDFIGSFMFISSTILIVVGLTEGGESWK-KPSAYVTLIVGIALFVLFFIWNICYGV 280

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 66/150 (44%), Gaps = 6/150 (4%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE----L 113
           +++EDD+   +  +      ++ +T    +  F+   D   +S+ +  I ++ +      
Sbjct: 66  VNDEDDTSVMITFNQSLSPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDHKVLTY 125

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
                +  A  L +       G  +DIFGRK  LM +N++F++G ++     +FW +   
Sbjct: 126 GEKEIVTAATSLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVG 185

Query: 174 RFISXXXXXXVTSMCSITISDIVP--LRDR 201
           R I        + +  + IS+I P  +R R
Sbjct: 186 RLIMGFGVGIGSLIAPLFISEIAPKMIRGR 215

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 53/119 (44%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
           ++++L  +     G +  +I  + A+ F +  ++  I T   + ++     Y ++SD FG
Sbjct: 68  VALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDRFG 127

Query: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDR 201
           R    +   +++ +G ++   TP+F GL     I          + +    D+  LRDR
Sbjct: 128 RIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDR 186

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 10/170 (5%)

Query: 105 HIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           HI  E     +I+     Y +  A    L G L+D  GR+P+++ +  ++   C+     
Sbjct: 132 HITEE-----QINISVVVYYVFQAVSPTLMGGLADSLGRRPVIITSVFLYFCACIGLACC 186

Query: 165 PSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA-CXXXXX 223
            ++  L+G R +       V ++ S  + D+    +R  Y G+ +    LGTA       
Sbjct: 187 NNYSQLIGLRCLQATGISPVIAVNSGLMGDVTTKAERGGYMGLVSGTQVLGTAFGALIGA 246

Query: 224 XWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
             FS    GWR  F   V  S +  L++++F+ LP   + V    SI  K
Sbjct: 247 ALFSRW--GWRSIFWFLVIGSGV-CLVLSLFI-LPETKRTVVGNGSITPK 292

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 87  LGIFLAAADGTLVSTIMAHIASEFNELP-RISWIATAYLLSSATFQPLYGKLSDIFGRKP 145
           +G  L+ A  T   +IM  +A E +    R +W+ +++ L+  +F  + G+L DI+G K 
Sbjct: 83  IGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKK 142

Query: 146 LLMLNNIVFLVGCLMCGLT 164
           +L+   I+  V  ++CGL+
Sbjct: 143 ILLGGYIITTVWSIICGLS 161

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 115/545 (21%), Positives = 202/545 (37%), Gaps = 57/545 (10%)

Query: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134
           P +  +I  S+++  +    DG +  T      S FN     S +     ++S+  Q  +
Sbjct: 72  PFQKFLIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWF 131

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
            + SDIF R+  ++++ + ++VG ++     S         I       +  +C I ++D
Sbjct: 132 ARASDIFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMAD 191

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA---FLIQVPLSALSSLLI 251
              L  R + +        + T          SD G  W+     + I  P S +   + 
Sbjct: 192 FSNLNWRVVAENAPMLPAIINTWVSGNIT---SDLGSKWQWGLGMWAIIFPASCIPLFVC 248

Query: 252 AVFMKLPPRS------KRVNSPASIKNK-------LLSVDWIGXXXXXXXXXXXXX-XXX 297
              M+   +       K    P+ I  K       +  +D+IG                 
Sbjct: 249 IYHMRYMAKKNNEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTT 308

Query: 298 XGGKEIAFNSKTF-VALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR---SVLGSSFS 353
            GG    +NS  F V   +G  +A   F   E   ++ PIL L  + +R   S L  SF 
Sbjct: 309 SGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFF 368

Query: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYY---MKRTGK 410
             FC+    T  Y   +        + TR+   LM   F   + +   G +   ++RT  
Sbjct: 369 IQFCLYVNDTYLYTFLLVAVDQTTKSGTRINS-LMS--FVNVITACCLGLFIVKIRRTQI 425

Query: 411 YYWLTVG----FCTLSLLGHLQINL-MKPDIATWRQFILLVIPGFGYSVLITVALLAMIA 465
           +  + +G    F    L  H    L  +  I T        + GFGY   I   L A + 
Sbjct: 426 F--IVIGCVSWFVVYGLYVHYNGGLGSRSGIIT-----ASCLSGFGYG-FIKSPLKASLQ 477

Query: 466 AVPHNHH--AATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV--LKFADKHPRKE 521
           A  ++H   A  T++  A  + G+  G ++ GAI+   L   L + +  +  AD      
Sbjct: 478 ASSNSHQNLAIVTALFLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSP 537

Query: 522 LLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIKEYK 581
           +     K  K  +W H +    +R  L+  Y    +   + C +  I  L S  ++++ K
Sbjct: 538 I-----KFIKQYKW-HTA----VRQHLVSSYGSVWRILNIVCLVLVIPMLVSSFLLRDRK 587

Query: 582 LHASL 586
           L  S+
Sbjct: 588 LSNSV 592

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 84/220 (38%), Gaps = 9/220 (4%)

Query: 60  NEDDSRDGVASSPVP-----PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-EL 113
            +D S       PVP     P     + +      F ++  G +   ++  I  +F+   
Sbjct: 51  TDDKSNTEPEDVPVPYTRFGPRAKFGLVMQCAFTGFFSSIAGAIYYPVLTVIEKKFSITE 110

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
            +++     Y +       L G L+D  GR+P+++ + +++   C+   L+ ++  ++  
Sbjct: 111 EQVNITVVVYFIFQGLSPSLMGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIIL 170

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R +       V ++ S  + D+    +R  Y G    F  LG+A         S     W
Sbjct: 171 RCLQAAGISPVIAINSGIMGDVTTKAERGGYVGYVAGFQILGSALGALIGAALSSR-WDW 229

Query: 234 RMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
           R  F      S   +L+   F  LP   + V    SI+ K
Sbjct: 230 RAIFWFLAIGSGACALV--SFFVLPETKRTVVGNGSIRPK 267

>KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040W Hypothetical ORF
          Length = 502

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 36/71 (50%)

Query: 133 LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITI 192
           L+G ++D  GR P   +  +++++G ++     + W L+  RFI        + +  + I
Sbjct: 68  LFGIMTDKLGRAPTFRVLALIWIIGSIISAAVLNVWMLIAGRFIRGIAVGSFSVLLPVYI 127

Query: 193 SDIVPLRDRAL 203
            ++VP + R L
Sbjct: 128 GEVVPEQRRGL 138

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/270 (18%), Positives = 101/270 (37%), Gaps = 5/270 (1%)

Query: 5   NSKNDLTSRTNFLNPVRDDILQDASTDIPGFVAXXXXXXXXXXXXCQGTDYGSIDNEDDS 64
            ++ DL++R++F N + D +       I                        S ++E D 
Sbjct: 21  KNEEDLSARSSFANSINDSVNSGDGDPIQLHDPHQLEHPAPIPNENSLVRTKSTNDEPDV 80

Query: 65  RDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAY 123
                S   P +K++++    + G F + A  ++   ++  I   F+     ++     Y
Sbjct: 81  TTAPYSRFGPREKMILVVQCAFTGFFSSIAS-SIYYPVLTVIEKLFDISEESVNITVVVY 139

Query: 124 LLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXX 183
            +       + G L+D  GR+P+++ +  V+   C+      ++  ++  R +       
Sbjct: 140 FIFQGLSPSIMGGLADSLGRRPVVLFSVAVYFCACVGLACAQTYPQIIVLRCLQAAGISP 199

Query: 184 VTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPL 243
           V ++ S  + D+    +R  Y G  + F  LG +         S     WR  F      
Sbjct: 200 VIAINSGIMGDVTTRAERGGYVGYVSGFQVLGNSFGALIGAGISST-WSWRAIFWFLAIG 258

Query: 244 SALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
           S +   L+A F+ LP   + +    SI  K
Sbjct: 259 SGIC--LLASFIVLPETKRTIAGNGSIIPK 286

>Kpol_543.5 s543 complement(10929..12629) [1701 bp, 566 aa] {ON}
           complement(10929..12629) [1701 nt, 567 aa]
          Length = 566

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 4/127 (3%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           L+D +GRK  L + ++ F++  +   L+ S   L+  RF+             I +S+I 
Sbjct: 115 LADKYGRKTTLAVCSVGFIISAVWLALSMSLTILILGRFLVGIAVGIAAQCVPIYLSEIS 174

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P R R     + +     G           SD    WR  F      SA+ ++L  + + 
Sbjct: 175 PTRIRGTILALNSIAITSGQLIAYIVSYLISDFSQSWRFLF----GFSAIPAILFILLLD 230

Query: 257 LPPRSKR 263
             P S R
Sbjct: 231 FIPESPR 237

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 98/223 (43%), Gaps = 19/223 (8%)

Query: 299 GGKEIAFNS-KTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFC 357
           GG+E  +++ +  V   +G + A   F+  E+  A+ P+ P   L+NR ++ +     F 
Sbjct: 295 GGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFL 354

Query: 358 MMAMMTTSYYLPIYYSGVL------NMNPTRVGKRLMPNFFSTALGSLGAGYYM---KRT 408
             A    S YL   Y+ +L        + TR+ K  + +F S   G L +G+ +   +RT
Sbjct: 355 QFAYQMQSTYL---YTVLLVAVDESKKSATRINK--LFSFVSVITGFL-SGFVVAKVRRT 408

Query: 409 GKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIA-AV 467
            ++ +  +G   +S    L I       +     +   I GFG   L   A  ++ A A 
Sbjct: 409 KEFIFFGIGVWFISF--GLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASIQASAY 466

Query: 468 PHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
            H   A  TS+  A  S GS  G ++ G+I+   L G +S  +
Sbjct: 467 SHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWTNVLPGKISEGI 509

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 44/86 (51%)

Query: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134
           P K  +I  S++   +    D ++  T      S +N+   +S ++    + SA  Q  +
Sbjct: 57  PVKRFLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWF 116

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLM 160
            + +D+FGR  +LM++ + ++VG ++
Sbjct: 117 ARSADMFGRTTILMISIVFYVVGTVV 142

>CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008c FLR1
          Length = 557

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (44%), Gaps = 6/105 (5%)

Query: 103 MAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG 162
           + H+    N    +S     Y L    F PL  ++S I GR P+ M+   +F +  + C 
Sbjct: 146 VGHVVGTLN----LSLYVLGYGLGPIVFSPL-TEISSI-GRLPVYMITFFLFTMLQIGCA 199

Query: 163 LTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGM 207
           L P+F GLV  RFI+        S    T+ DIV     AL  G+
Sbjct: 200 LAPNFAGLVILRFITGVLCSPALSTGGATLGDIVSQNYLALVLGL 244

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 70/172 (40%), Gaps = 4/172 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  EFN +   I+     YL+       + G L+D FGR+P+++   +V++V  +  
Sbjct: 124 LRQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIILGGMLVYVVASVGL 183

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
              PS+  ++  R +         ++ S  + D     +R  + G  + F  LG  C   
Sbjct: 184 ACAPSYGVIIFLRCVQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLG-QCFGS 242

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                      WR  F   + +   +  LIA F+ LP   + +    S++ K
Sbjct: 243 LIGAVLTARWDWRSIFWF-LTIGCGTCFLIAFFI-LPETKRTIAGNLSVRPK 292

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%)

Query: 123 YLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXX 182
           YLL         G L+D FGR+P+L++  ++++V  +     PS+  +V  R +      
Sbjct: 144 YLLFQGLAPTCSGGLADKFGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGIS 203

Query: 183 XVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
              ++ S  + D     +R  + G  + F  LG A
Sbjct: 204 PSIAISSGVVGDFTVKSERGTFVGATSGFVLLGQA 238

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 81  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 130

>Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/182 (18%), Positives = 73/182 (40%), Gaps = 4/182 (2%)

Query: 58  IDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNE----L 113
           +++EDD+   +  +      ++ +T    +  F+   D   +S+ +  I ++ +      
Sbjct: 66  VNDEDDTSVMITFNQSLSPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDNKVLTY 125

Query: 114 PRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGA 173
                +  A  L +       G  +D+FGRK  LM +N++F++G ++     +FW +   
Sbjct: 126 GEKEIVTAATSLGALITSIFAGTAADLFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVG 185

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGW 233
           R I        + +  + IS+I P   R     + + +   G           +    GW
Sbjct: 186 RLIMGFGVGIGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNHVNNGW 245

Query: 234 RM 235
           R+
Sbjct: 246 RI 247

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 4/116 (3%)

Query: 60  NEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISW 118
           +E D R  +  S V P   L +  S +  + + A D  +VS  +  IA + N    +++W
Sbjct: 28  HEMDPRRTL--STVKPKTWLFVA-SAFFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTW 84

Query: 119 IATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGAR 174
             T  L++      LYG + D FG+K   M+N  +  +  L+ G   +F   +  R
Sbjct: 85  GMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISILQLLTGFATTFPYFIACR 140

>AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1)
          Length = 594

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 78/165 (47%), Gaps = 17/165 (10%)

Query: 52  GTDYGSIDNEDDSRDGVASSPVPPDK-------------LLVITLSMYLGIFLAAADGTL 98
           G D G +D+   ++ G+  +P P                L ++ +  +   F+     ++
Sbjct: 42  GHDTG-VDDLQRTKKGIVLNPQPSKHTRDPLNWPIWRRDLALVCVGWH--CFVGGGQTSM 98

Query: 99  VSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVG 157
           ++   + +++E +  + ++S++    +L+ A    +    + +FG++ + ++  ++FL G
Sbjct: 99  LAAGFSKLSAELHVPISQVSFLVGPMMLALAIGSVVASPTAVLFGKRMVYLMGILIFLGG 158

Query: 158 CLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRA 202
            + C L+ SF  L+  R +S      V S+ S TI++I    +RA
Sbjct: 159 SIGCALSNSFASLLIFRMVSGFGLSTVESLPSATIAEIYFAHERA 203

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           ++SW A+AY L+  TF  + G+L DIFG K   +L    + +  L+ G +
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFS 131

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 64/154 (41%), Gaps = 11/154 (7%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFW-GLVGA 173
           R+  + + + +  A      GKL D++GR+  L+    +F+VG ++   + S W      
Sbjct: 122 RMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIG 181

Query: 174 RFISXXXXXXVTSMCSITISDIVPLRDR----ALYQGMCNFFFGLGTACXXXXXXWFSDH 229
           R I+      +  +  + IS++ P   R    + YQ M  F   LG  C      +   +
Sbjct: 182 RIIAGIGMGVIAVLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSY--QN 239

Query: 230 GGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR 263
              WR+A    V L  L  +++   M   P S R
Sbjct: 240 SKQWRIA----VGLQFLWCIIMVSGMTFVPESPR 269

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 108/512 (21%), Positives = 187/512 (36%), Gaps = 58/512 (11%)

Query: 56  GSIDNEDDSRDGVASSPV------PPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASE 109
           G  +   +   GV +S V       P +  ++ L ++   +    D  L S       S 
Sbjct: 36  GEKEPHLEESAGVYNSEVYAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSS 95

Query: 110 FNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWG 169
           + +   +S +     + SA  Q  + + SD+FGR  +L++  + ++VG ++         
Sbjct: 96  YKQHSLLSTVNAIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSK 155

Query: 170 LVGARFISXXXXXXVTSMCSITISDIVPLRDRA------LYQGMCNFFFGLGTACXXXXX 223
                 +       V  M  I +SD   L  R       +   + N +   G        
Sbjct: 156 FAAGACLFQLGYDGVVMMVQILVSDFSNLNWRVTAVAFPVLPNVINTWVS-GDIASAVDE 214

Query: 224 XWFSDHG-GGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKR------VNSPASIKNK--- 273
            W    G G W   F    PLS +   ++ + MK   R          + P  I  K   
Sbjct: 215 NW--KWGIGMWAFIF----PLSCIPFGILLLHMKYLARKNNDTLKSSFDKPEDITWKQYL 268

Query: 274 ----LLSVDWIGXXXXXXXXXXXXXXXXXGG--KEIAFNSKTFVALCIGSSLACAFFIGV 327
               L  +D+IG                  G   +    ++  V   +G  +A   F+  
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 328 ELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRL 387
           E+  AK P+ P   +++R V  +     F   A      Y+  Y   ++ +N T+     
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQTAFYMQKTYM--YTILLVAVNQTKKSATR 386

Query: 388 MPNFFS--TALGSLGAGYYM---KRTGKY--YWLTVGFCTLSLLGHLQ--INLMKPDIAT 438
           + + F+  TAL     G  +   +RT ++  + + V F +  LL       N     IA 
Sbjct: 387 INSLFTFVTALSGTLLGLVIVKVRRTKEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAA 446

Query: 439 WRQFILLVIPGFGYSVLITVALLAMIA-AVPHNHHAATTSISYAFRSTGSTLGVSIGGAI 497
                 L + GFG   +      +M A A+ H   A  TS+  A  + G+++G S+ GAI
Sbjct: 447 ------LCLLGFGNGFIKYPTKASMQASALTHEMMAIITSLFMAISTIGTSVGSSVAGAI 500

Query: 498 FRQSL-----NGLLSRKVLKFADKHPRKELLE 524
           +   L      GL +  +  FA   P K +L+
Sbjct: 501 WTNVLPDKIEKGLNNSTLANFAYNSPTKFILQ 532

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 93/466 (19%), Positives = 177/466 (37%), Gaps = 50/466 (10%)

Query: 79  LVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           +++  S++L  +    DG +     A+  + +     +S +     + +A  Q  + + +
Sbjct: 44  ILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLSTVNCIKAVIAAAGQLCFARAA 103

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           DIFGR  +++++ + ++VG ++     +         I       +  +  I   D   L
Sbjct: 104 DIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIYQLGYTGIILILEIIAMDFSNL 163

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWR-----MAFLIQVPLSALSSLLIAV 253
             R L   +    F + T          S  G  W+      AF+   PLSAL  L    
Sbjct: 164 NWRLLASFVPAIPFIINTWISGDVV---SAVGANWKWGIGMWAFIF--PLSALPLLGCMF 218

Query: 254 FMKLPPR---SKRVNSPASIKNKL-----------LSVDWIGXXXXXXXXXXXXXXXXXG 299
            M+   R   S R+ +  S+   +             +D +G                  
Sbjct: 219 HMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLIMVCVVFGCILIPFTLA 278

Query: 300 G--KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSN--- 354
           G  K+    ++  V   IG  +A   F+  E+  AK P++P + +++R +  +       
Sbjct: 279 GSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVIKDRGIWSALIIAIHI 338

Query: 355 ---WFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNF-FSTALGSLGAGY---YMKR 407
              W+   + M T   + +  S        +   R+   + F + L  LG G+   Y+++
Sbjct: 339 NFIWYMQGSFMYTVLIIAVNES-------VKSATRITSLYSFVSVLTGLGLGFVIAYIRK 391

Query: 408 TGKYYWLTVGFCTLS--LLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIA 465
           T K+    +G   +S  LL H + +          Q +L    GFG          ++ A
Sbjct: 392 TKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLL----GFGAGFFTYTTQTSIQA 447

Query: 466 -AVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
            A  H   A  T++  +F + GS LG S+ GAI+   L   L +++
Sbjct: 448 SAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRI 493

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 31/48 (64%)

Query: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           +W+  ++ L S +F  + GK+ DI+G K  L++  +V ++  L+CGLT
Sbjct: 93  TWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLT 140

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 45/81 (55%), Gaps = 3/81 (3%)

Query: 88  GIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPL 146
           G+ LA+    +V  ++  I + FN    +  W  T+Y+++ A F   +G++ DI G   +
Sbjct: 33  GLDLASVGAMIV--LVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIM 90

Query: 147 LMLNNIVFLVGCLMCGLTPSF 167
           + + +++F +  L+C + P+F
Sbjct: 91  MCVFSVIFGIFSLLCAVVPNF 111

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 355 WFCMMAMMTTSYYLPIYYSGVLNMN---PTRVGKRLMPNFFSTALGS----LGAGYYMKR 407
           W  +       +  PIY  G+ N+N   P    KRL+ NF +TAL S    +G   Y+  
Sbjct: 362 WNVVQTKKLMDFSSPIYIDGIPNLNSLPPKEQSKRLLENFRATALSSVTGLIGLNDYLDI 421

Query: 408 TGKYYWLTVGFCTLSLLGHLQINL 431
             KYY    G   +S    L +N+
Sbjct: 422 ADKYYDPNYGRHKMSYSELLLLNI 445

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 22/168 (13%)

Query: 87  LGIFLAAAD-GTLVSTIMAH-IASEFNELPR------ISWIATAYLLSSATFQPLYGKLS 138
           LG+FL   D G +   +  H   + FN   R      +S +    L+SS     L G+L 
Sbjct: 114 LGVFLFGYDQGVMSGCLTGHYFKNHFNNPSRAAIGNMVSILEIGALVSSL----LVGRLG 169

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           + +GR+  +   +++F++G L  G       L+  R IS      ++++  I  S+I P 
Sbjct: 170 EKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLLSTIVPIYQSEISPP 229

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXW------FSDHGGGWRMAFLIQ 240
            +R   +  C  F   G         W      F +    WR+  L+Q
Sbjct: 230 HNRG--KLACIEF--TGNIVGYAASVWIDYGCSFIEGNASWRIPLLLQ 273

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYG 135
           K L+   +  L   L  A  T    IM  ++  FN E    +W+  ++ L++ +F  + G
Sbjct: 68  KELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISG 127

Query: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           +L DI+G K +L++  ++ +V  ++ GL+
Sbjct: 128 RLGDIYGLKKMLIVGYVIVIVWSIISGLS 156

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 87  LGIFLAAADGTLVSTIMAHIASEFNELP-RISWIATAYLLSSATFQPLYGKLSDIFGRKP 145
           +G FL+    T V + M  +A E +    R  W+  A+ L       + G+L DIFG K 
Sbjct: 131 IGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKK 190

Query: 146 LLMLNNIVFLVGCLMCGLT 164
           +L+L  I+  +  L+CG +
Sbjct: 191 VLLLGYIITTIWTLICGFS 209

>Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 bp,
           602 aa] {ON} ANNOTATED BY YGOB -
          Length = 602

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 83/198 (41%), Gaps = 7/198 (3%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATA-YLLSSATFQPLY 134
           DKL ++ +    G +   A  T+    ++ I  EFN    +  +    Y L    F  + 
Sbjct: 82  DKLFLVVICALSGFYSTIAQ-TIYFPALSIIEKEFNVSVSLVNVTVVVYSLCQGIFPVIM 140

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G L+D  GR+P+ M   +V+   C+      +F  ++  R +       + ++ +  + D
Sbjct: 141 GGLADRLGRRPVAMFCIMVYFCACIGIACCRTFGEMIFLRCLQGGGISPIIAINNGLMGD 200

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSL-LIAV 253
           I    +R  Y G+ + F  LG+A        F+    GWR  F     LSA S + L+ V
Sbjct: 201 ITVKSERGGYVGLTSGFQVLGSALGGLLGALFTAR-WGWRSIFWF---LSAGSGVTLLFV 256

Query: 254 FMKLPPRSKRVNSPASIK 271
              LP   + +    SIK
Sbjct: 257 VTALPETKRSIVGNGSIK 274

>KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON} 
          Length = 529

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 60/144 (41%), Gaps = 13/144 (9%)

Query: 60  NEDDSRDGVASSPVPPDKLLVITLSM-----YLG--IFLAAADGTLVSTIMAHIASEFNE 112
           N DD  D   + P      + I + M     Y+G  I+    +G      + H+ +  N 
Sbjct: 68  NGDDDPDNPQNWPQAKKNFITIEIMMLTCITYMGSSIYTPGQEGIQNDFHVGHVTATLN- 126

Query: 113 LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVG 172
              +S     Y L    F PL  +++ I GR+ L ++   +F+V  + C    +  GL+ 
Sbjct: 127 ---LSLYVLGYGLGQVFFSPL-SEVAKI-GRQQLYIITYFLFMVFQIGCATVQNIEGLII 181

Query: 173 ARFISXXXXXXVTSMCSITISDIV 196
            RFIS        S    TI+DI+
Sbjct: 182 LRFISGILCSPSLSTGGATIADII 205

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 84  SMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
           S ++   L  A       IM  +A   + +  + +W+  A+ L S +F  + G++ DI+G
Sbjct: 68  SCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYG 127

Query: 143 RKPLLMLNNIVFLVGCLMCGLT 164
            K  L++  +  +V  L+CGLT
Sbjct: 128 LKKTLLVGYLFLIVWSLICGLT 149

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGK 136
           ++L+++ +   G F  + D TL ST   +  + + E   +S I     + S   Q ++ +
Sbjct: 57  RILILSTAFLCG-FGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSR 115

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLM 160
           LSD FGR  L  + +I++++G ++
Sbjct: 116 LSDYFGRLELFTVASILYIIGTIV 139

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 103 MAHIASEFN---ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCL 159
           +  + +EF+   EL  I+     YLL       + G L+D++GR+P+++L  +++++  +
Sbjct: 106 LKELEAEFDVNEELINIT--VVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASI 163

Query: 160 MCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
               + S+  +V  R +       + ++ S    D     +R  + G  + F  +G A
Sbjct: 164 GLACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAVSGFTLMGQA 221

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 81/209 (38%), Gaps = 12/209 (5%)

Query: 73  VPPD-------KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYL 124
           VPP        K ++I    + G F   A G +   +++ I  EF+ +   ++     Y 
Sbjct: 49  VPPHSRFSRSFKTVLIAQCAFTGFFSTIA-GAIYYPVLSVIEGEFDIDEQLVNITVVVYF 107

Query: 125 LSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXV 184
           +         G  +D  GR+P+++   I++   C+      ++  ++  R +       V
Sbjct: 108 VFQGLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPV 167

Query: 185 TSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLS 244
            ++ S  + DI    +R  Y G    F  LG+A         S    GWR  F      S
Sbjct: 168 IAINSGIMGDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFR-WGWRAIFWFLAIGS 226

Query: 245 ALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
            +    +A F+ LP   + ++   S+  +
Sbjct: 227 GIC--FLASFLILPETKRNISGNGSVTPR 253

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 82/202 (40%), Gaps = 11/202 (5%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY-G 135
           K+++I    + G F   A G +   +++ I  +F+   ++  +            P + G
Sbjct: 60  KIVLIAQCAFTGFFSTIA-GAIYYPVLSVIEKKFDINEQLVNVTVVVYFVFQGLAPTFMG 118

Query: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDI 195
             +D  GR+P++++  +++L  C+      ++  ++  R +       V ++ S  + DI
Sbjct: 119 GFADSLGRRPVVLVAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDI 178

Query: 196 VPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAF---LIQVPLSALSSLLIA 252
               +R  Y G    F  LG+A         S    GWR  F    I   +  L SLL+ 
Sbjct: 179 TTRAERGGYVGYVAGFQVLGSAFGALIGAGLSSR-WGWRAIFWFLAIGSGVCFLGSLLV- 236

Query: 253 VFMKLPPRSKRVNSPASIKNKL 274
               LP   + +    SI  KL
Sbjct: 237 ----LPETKRNIAGNGSITPKL 254

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 80/206 (38%), Gaps = 12/206 (5%)

Query: 73  VPPD-------KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYL 124
           VPP        K ++I    + G F   A G +   +++ I  EF+ +   ++     Y 
Sbjct: 73  VPPHSRFSRSFKTVLIAQCAFTGFFSTIA-GAIYYPVLSVIEGEFDIDEQLVNITVVVYF 131

Query: 125 LSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXV 184
           +         G  +D  GR+P+++   I++   C+      ++  ++  R +       V
Sbjct: 132 VFQGLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPV 191

Query: 185 TSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLS 244
            ++ S  + DI    +R  Y G    F  LG+A         S    GWR  F      S
Sbjct: 192 IAINSGIMGDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFR-WGWRAIFWFLAIGS 250

Query: 245 ALSSLLIAVFMKLPPRSKRVNSPASI 270
            +    +A F+ LP   + ++   S+
Sbjct: 251 GIC--FLASFLILPETKRNISGNGSV 274

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 70/172 (40%), Gaps = 4/172 (2%)

Query: 103 MAHIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           +  +  EFN +  +++     YLL         G L+DI+GR+P++++  I+++   +  
Sbjct: 87  LRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSVGL 146

Query: 162 GLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXX 221
             + S+  LV  R +         ++ S  + D     +R  + G  + F  LG A    
Sbjct: 147 ACSNSYGVLVFLRILQSACISPTIAISSGFVGDFTLKFERGTFVGATSGFALLGQAFGSL 206

Query: 222 XXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNK 273
                +     WR  F   V    +  L+I  F  LP   + +    S+K K
Sbjct: 207 IGAALA-AAWDWRAIFWFLVIGCGVCMLII--FTLLPETKRTLVGNLSVKPK 255

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 91/247 (36%), Gaps = 33/247 (13%)

Query: 127 SATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTS 186
           SA  Q  Y + SDIFGR P+L+L+ + + +G L+               I          
Sbjct: 104 SAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVL 163

Query: 187 MCSITISDIVPLRDRALYQ------GMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
           +  + +SD   L+ R +         + N + G              D G  W+  F + 
Sbjct: 164 VTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNIT---------EDVGNRWQWGFGMW 214

Query: 241 V---PLSALSSLLIAVFMK-LPPRSKR-----VNSPASIKNK-------LLSVDWIGXXX 284
               PL+++  L     MK L  ++K      ++ P SI             +D +G   
Sbjct: 215 AFIFPLASIPLLCCLAHMKYLAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLIL 274

Query: 285 XXXXXXXXXX--XXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFL 342
                           G  E   ++K  V   +G +LA   F+  EL  A +PI PL  +
Sbjct: 275 LVAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLI 334

Query: 343 RNRSVLG 349
           ++R + G
Sbjct: 335 KDRGIYG 341

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 43/78 (55%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
            S++L  +    DG +  T  A+  S +++   +S +     + +A  Q  + +LSDIFG
Sbjct: 75  FSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG 134

Query: 143 RKPLLMLNNIVFLVGCLM 160
           R  +L+++ I +++G ++
Sbjct: 135 RFSILVISVIFYIMGTVI 152

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 81/418 (19%), Positives = 153/418 (36%), Gaps = 61/418 (14%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT----PSFWGL 170
           ++SW A AY L+  TF  + G+L D++G K   ++    + +  L+ G +      F+  
Sbjct: 84  QLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQIFFDC 143

Query: 171 VGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGM------CNFFFGLGTACXXXXXX 224
             A F        + +  +I     VP R +A+   +        F  G   +       
Sbjct: 144 CRA-FQGIGPALLLPNAIAILGRTYVPGRRKAMILSLFGATAPAGFVLGAVFSSIFGQLT 202

Query: 225 WFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRS------KRVNSPASIKN----KL 274
           W+      W M   I     A++ +L+   M LP         +R++ P S+       L
Sbjct: 203 WWP--WAYWAMG--IVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVL 258

Query: 275 LSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKD 334
           L+  W                    G  + + +    +L I S++    F  +E   A  
Sbjct: 259 LNFAW------------------NQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APH 299

Query: 335 PILPLSFLRNRS--VLG------SSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKR 386
           P+LPLS L + +  VLG      SSF  W          YY  ++   +   +P     +
Sbjct: 300 PLLPLSALSSDAAFVLGCVGAGWSSFGIWI---------YYFWLFLEELRGHSPLLTSAQ 350

Query: 387 LMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLV 446
             P   S    +L  G+ + R      +       ++ G L        +   + F+ ++
Sbjct: 351 FAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSII 410

Query: 447 IPGFGYSVLITVALLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNG 504
           +  +G  +    A + +  ++PH H     S+     +   ++G+ + G +  +  NG
Sbjct: 411 VMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNG 468

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 44/86 (51%)

Query: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134
           P   +++  S++L  +    DG++  T  A   S +++   +S +     + +A  Q  Y
Sbjct: 71  PIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITTVIAAAGQICY 130

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLM 160
            + SDIFGR  +L++  + + VG ++
Sbjct: 131 ARASDIFGRMTILIIGLVFYAVGTII 156

>Kwal_47.18976 s47 (1049766..1051370) [1605 bp, 534 aa] {ON} YKL217W
           (JEN1) - carboxylic acid transporter protein homolog
           [contig 188] FULL
          Length = 534

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 88/227 (38%), Gaps = 14/227 (6%)

Query: 58  IDNEDDSRDGVASSPVPP----DKLLVITLSMYLGIFLA----AADGTLVSTIMAHIASE 109
           +   +  R+  A  P+ P      +       ++  FLA    A D   VS  MA IA +
Sbjct: 41  VPTREKLREAHAQYPINPFPALSHMNAKQTQFFIVGFLAWTWDALDFFAVSLNMAEIAKD 100

Query: 110 FNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFW 168
            ++ +  +S   T  LL       ++G L D +GRK    ++ ++ +V  +  G   SF 
Sbjct: 101 LDKSIKDMSHAITLVLLLRVIGAIIFGYLGDRYGRKVPYCISMVLIVVVQIGTGFVKSFP 160

Query: 169 GLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSD 228
             +G R +       +  + S T  +  P   +++  G+    + LG            D
Sbjct: 161 AFLGCRALFGIVMGSIFGVASATALEDAPQESKSILSGIFQEGYALGYLLGVVFKRAIVD 220

Query: 229 HGG-GWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKL 274
           +   GWR  F      SA   +L  V+  L P S+      + + +L
Sbjct: 221 NSSHGWRAFFW----FSAGPPVLFIVWRLLLPESEAYTRRTTEEKRL 263

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 101/464 (21%), Positives = 180/464 (38%), Gaps = 54/464 (11%)

Query: 85  MYLGIFLAA----ADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDI 140
           ++  IFL A     DG +  T  A+  S +++   +S +     + +A  Q  + +LSDI
Sbjct: 73  LFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132

Query: 141 FGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRD 200
           FGR  +L+++ I + VG ++     +                 V  +  +  SD   L  
Sbjct: 133 FGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILILEVIASDFSNLNW 192

Query: 201 RALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWR-----MAFLIQVPLSALSSLLIAVFM 255
           R L   +    F + T          S  G  W+      AF++  PL+ +   L  + M
Sbjct: 193 RLLALFVPALPFIVNTWISGDVT---SAIGTNWKWGIGMWAFIL--PLACIPLGLCMLHM 247

Query: 256 ----------KLPPRSKRVNS----PASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGG- 300
                     KL P  + +N+      SI      +D IG                  G 
Sbjct: 248 RYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLVPFTLAGG 307

Query: 301 -KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFS------ 353
            KE    +   V   IG  +A   ++  E+  ++ P+ P   +++R VL + F       
Sbjct: 308 LKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALFIAFFINF 367

Query: 354 NWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYM---KRTGK 410
           NW+     M T   + ++ S     + TR+    + +F S  +G++  G+ +   +RT  
Sbjct: 368 NWYMQGDYMYTVLVVAVHES---IKSATRITA--LYSFVSVIVGTI-LGFILIKVRRTKP 421

Query: 411 Y--YWLTVGFCTLSLLGHLQINLMKPDIATWRQFI-LLVIPGFGYSVLITVALLAMIA-A 466
           +  + ++    +  LL H      + D       I  L + GFG      V   ++ A A
Sbjct: 422 FILFGISCWIVSFGLLVH-----YRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASA 476

Query: 467 VPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKV 510
             H   A  TS+  A  + GS  G S+ GA++   L   +S+++
Sbjct: 477 GTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRI 520

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           ++SW A++Y L+  TF  + G+L DIFG +   +L    + +  L+ G +
Sbjct: 82  QLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFS 131

>SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]
           {ON} similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 730

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 69/168 (41%), Gaps = 22/168 (13%)

Query: 87  LGIFLAAADGTLVSTIMA--HIASEFNELPRI------SWIATAYLLSSATFQPLYGKLS 138
           LG+FL   D  ++S I+   +    F+E  R+      S +    L+SS     + G+L 
Sbjct: 128 LGVFLFGYDQGVMSGIITGPYFKQHFHEPSRVAIGNMVSILEVGALVSSL----MVGRLG 183

Query: 139 DIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPL 198
           + +GR+  +   +++F+ G  +         L+  R +S      ++++  I  S+I P 
Sbjct: 184 EKWGRRRTIKYGSLIFVFGGAIQTFASRMSDLIIGRIVSGLGVGLLSTIVPIYQSEISPP 243

Query: 199 RDRALYQGMCNFFFGLGTACXXXXXXW------FSDHGGGWRMAFLIQ 240
            +R   +  C  F   G  C      W      + +    WR+   IQ
Sbjct: 244 HNRG--KLACIEF--TGNICGYASSVWVDYGCSYFESNASWRVPLFIQ 287

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
            S +L  F    DG +    M +  + ++    IS +    ++ SA  Q +Y  LSD+FG
Sbjct: 75  FSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYAGLSDVFG 134

Query: 143 RKPLLMLNNIVFLVGCLM 160
           R  L +++ + ++VG ++
Sbjct: 135 RLSLFIVSIVFYVVGTII 152

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 87/225 (38%), Gaps = 23/225 (10%)

Query: 299 GGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWF-C 357
           GG    + S   +A  +   +  A FI  E   A  PI P   L++R +    +  +   
Sbjct: 308 GGVSTQWQSAKLIAPFVLGFVLIAIFIYWESKLALAPIAPFKMLKDRGIWAPLWIMFLIA 367

Query: 358 MMAMMTTSYYLPIYYSGV--LNMNPTRVGK--RLMPNFFSTALGSLGAGY-----YMKRT 408
            +  M   Y   I    V   +++ TR+      +   F+  LG + A       YM   
Sbjct: 368 FVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPVLGFIVARSSRLKPYMVLG 427

Query: 409 GKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVALLAMIAAVP 468
              Y++T+G      +G      +   +  W     L    F Y V +++      +   
Sbjct: 428 CSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCL----FDYPVTVSIQ-----SVTS 478

Query: 469 HNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKF 513
           H + A  T++SY   S G  +  S+ GAI+ Q    LL  K+L++
Sbjct: 479 HENMATVTALSYTIFSIGGAVAASVSGAIWTQ----LLYPKLLEY 519

>TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {ON}
           Anc_5.469 YDR387C
          Length = 549

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 49/127 (38%), Gaps = 4/127 (3%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           LSD +GR+  L   + +F+VG +   L+ S   L+  R +             + +S++ 
Sbjct: 115 LSDTYGRRKTLAFCSAIFIVGGIWMALSKSLSLLIMGRLVVGVAIGIAAQCVPVFLSEVS 174

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P   R     + +     G           +D    WR  F I    SA+ +++    MK
Sbjct: 175 PASIRGTVLTLNSLAITGGQFLSYVAAYMLADLKHSWRYLFGI----SAIPAVIFLALMK 230

Query: 257 LPPRSKR 263
             P S R
Sbjct: 231 FIPESPR 237

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 76/175 (43%), Gaps = 18/175 (10%)

Query: 59  DNEDDSRDGVASSPV-------PPDKLLVITLSMYLGIFLAAAD--GTLVSTI----MAH 105
           ++  DSRD V SS V        P  LL      ++   L +A    +L S I    +  
Sbjct: 53  ESSSDSRDRVESSGVNSKLPQGAPFTLLSHGQKWFMVALLTSAGFWSSLGSPIYYPALKQ 112

Query: 106 IASEFN---ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG 162
           +  +FN   E+  I+     YL+       + G L+D++GR+P++++  ++++   +   
Sbjct: 113 LEKKFNVSEEMVNIT--VVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASIGLA 170

Query: 163 LTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
            + S+  +V  R +       + ++ S  + D     +R  + G  + F  +G A
Sbjct: 171 CSQSYGVIVFLRCLQSAGISPIIAINSGVVGDFTLKHERGTFVGAVSGFTLMGQA 225

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 57/139 (41%), Gaps = 3/139 (2%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G  +D  GR+P++++  +++   C+      ++  ++  R +       V ++ S  + D
Sbjct: 118 GGFADSLGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGD 177

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVF 254
           +    +R  Y G    F  LG+A         S    GWR  F      S +    +A F
Sbjct: 178 VTTRAERGGYVGYVAGFQVLGSAFGALIGAGLSSR-WGWRAIFWFLAIGSGIC--FLASF 234

Query: 255 MKLPPRSKRVNSPASIKNK 273
           + LP   + ++   S+  K
Sbjct: 235 LILPETKRNISGNGSVTPK 253

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 77  KLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYLLSSATFQPLYG 135
           K  +  L+  L   L  A  T  ++ M  I S FN +    +W+  ++ L S +F  + G
Sbjct: 80  KEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSG 139

Query: 136 KLSDIFGRKPLLMLNNIVFLVGCLMCGL 163
           ++ DI+G K  ++   IV ++  L+CG 
Sbjct: 140 RIGDIYGLKRTMIGGLIVMIIWSLICGF 167

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%)

Query: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142
            S++L  +    DG +  T  A+  S +++   +S +     + +A  Q  + +LSDIFG
Sbjct: 75  FSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG 134

Query: 143 RKPLLMLNNIVFLVGCLM 160
           R  +++++ I + VG ++
Sbjct: 135 RFSIMIVSVIFYSVGTII 152

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 4/82 (4%)

Query: 83  LSMYLGIFLAAA----DGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLS 138
           ++++  IFL A     DG +  T  A+  S +++   IS +     + +A  Q  + + S
Sbjct: 52  VALFFSIFLVAYAYGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARAS 111

Query: 139 DIFGRKPLLMLNNIVFLVGCLM 160
           D+FGR  +L++  + ++VG ++
Sbjct: 112 DVFGRLSILIIAVLFYVVGTVI 133

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 44/81 (54%)

Query: 80  VITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSD 139
           V+  S++L  +    DG++ S    +  + ++    +S I+   L+  A+ Q  + +LSD
Sbjct: 69  VLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQVFFARLSD 128

Query: 140 IFGRKPLLMLNNIVFLVGCLM 160
           +FGR  LL++  + + VG ++
Sbjct: 129 VFGRLTLLIVATVFYSVGTII 149

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 80/206 (38%), Gaps = 15/206 (7%)

Query: 76  DKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISW-----IATAYLLSSATF 130
           +K +++    + G F      T+   I   + SE  E+  IS          Y +     
Sbjct: 79  EKTILVLQCAFTGFF-----STIAGAIYYPVLSEIEEIFHISEESVNITVVVYFIFQGIS 133

Query: 131 QPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSI 190
             + G L+D  GR+P+++ +  V+   C+      ++  +V  R +       V ++ S 
Sbjct: 134 PSIMGGLADTMGRRPIVLCSIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIAINSG 193

Query: 191 TISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLL 250
            + DI    +R  + G  + F  +G+A         S     WR  F      S +   L
Sbjct: 194 IMGDITTRAERGGFVGYVSGFQVMGSAFGALIGAGISST-WSWRAIFWFLAIGSGIC--L 250

Query: 251 IAVFMKLPPRSKRVNSPASI--KNKL 274
           I  F+ LP   + +    SI  K+KL
Sbjct: 251 IISFIILPETKRTIVGNGSIIPKSKL 276

>TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.155
           YBR241C
          Length = 481

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 40/94 (42%)

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
           G+L+D +GR+ +    +++ ++G +M   + S+ G +  R +          +  + I++
Sbjct: 105 GRLADRYGRRKVTFFTSMIGIIGSMMLFGSNSYTGFIVGRIVVGIASGASIVVTPLIINE 164

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSD 228
           I P   R     M   F  LG          F+D
Sbjct: 165 IAPPEWRGALGSMNQVFINLGILLTQSLALKFAD 198

>TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 43/208 (20%), Positives = 83/208 (39%), Gaps = 22/208 (10%)

Query: 53  TDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIFLAAADGTLVSTIMAHIA-SEF- 110
            D   ++  DDS   +     P    + + +   +  F    +G  + TI   +A ++F 
Sbjct: 42  NDEYPLEQSDDSPSQIEIPKKPASAYISVCVMCLMVAFGGFINGWDIGTIGGFVAQTDFV 101

Query: 111 --------NELPRISWIATAYLLS-----SATFQPLYGKLSDIFGRKPLLMLNNIVFLVG 157
                   N  P +S + T  L++      A      G++ D++GR+  L++  I+F+ G
Sbjct: 102 KRFGSLNSNGEPYLSKVRTGLLVAIFNIGCAIGSVTLGRVGDVYGRRLGLIMATIIFVAG 161

Query: 158 CLM-CGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDR----ALYQGMCNFFF 212
            ++    T  ++     R I+      +  +  + IS++ P   R    + YQ M  F  
Sbjct: 162 VVIQIASTDKWYQYFIGRIIAGIGMGVIAVLSPMLISEVSPKHLRGAMVSCYQLMITFGI 221

Query: 213 GLGTACXXXXXXWFSDHGGGWRMAFLIQ 240
            LG  C      +  D+   WR+   +Q
Sbjct: 222 FLGNCCNYGTKTY--DNSIQWRVGLGLQ 247

>KLLA0B14861g Chr2 complement(1305927..1307690) [1764 bp, 587 aa]
           {ON} uniprot|P07921 Kluyveromyces lactis KLLA0B14861g
           LAC12 Lactose permease
          Length = 587

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 52/127 (40%)

Query: 137 LSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISDIV 196
           L D  GRKP +++  +  ++G ++  LT +   L+G R+          +      +++ 
Sbjct: 136 LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSALIGGRWFVAFFATIANAAAPTYCAEVA 195

Query: 197 PLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMK 256
           P   R    G+ N  + +G+          + +      AF I + L  +   L+ +F  
Sbjct: 196 PAHLRGKVAGLYNTLWSVGSIVAAFSTYGTNKNFPNSSKAFKIPLYLQMMFPGLVCIFGW 255

Query: 257 LPPRSKR 263
           L P S R
Sbjct: 256 LIPESPR 262

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 70/170 (41%), Gaps = 11/170 (6%)

Query: 57  SIDNEDDSRDGVASSPVPPDKLL--------VITLSMYLGIFLAAADGTLVSTIMAHIAS 108
           S+D E  + D  A    PP  +L        V  L+M    F ++    +    +  +  
Sbjct: 70  SLDGELSTPDEEAQEHTPPHSMLSYWNKWGMVAVLTMCG--FWSSLGSPIYYPALKQLEK 127

Query: 109 EFNELPRISWIATAYLLSSATFQP-LYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSF 167
           +FN    +  ++    L    F P + G L+DI+GR+P+++   +V++V  +      S+
Sbjct: 128 KFNVDENLVNVSVVVYLIFQGFAPAVSGGLADIYGRRPVILFGMLVYVVASIGIAACNSY 187

Query: 168 WGLVGARFISXXXXXXVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
             ++  R +       + ++ S  + D     +R  + G  +    +G A
Sbjct: 188 GVIIFLRCLQSTGISPLIAISSGAVGDFTVKAERGTFVGAVSGLVLMGQA 237

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 115 RISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLT 164
           ++SW + AY L+  TF  + G+L D+FG K L ++  + + +  L+ G +
Sbjct: 78  QLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFS 127

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 112 ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSF 167
           E    SW  T+Y ++ A      G+L DI G   L  ++   F + CL+C +  +F
Sbjct: 65  EYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVTNF 120

>KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {ON}
           Anc_5.469 YDR387C
          Length = 546

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 73/195 (37%), Gaps = 16/195 (8%)

Query: 81  ITLSMYLGIFLAAADGTL-------VSTIMAHIASEFNELPRISWIATAYLLSSATFQPL 133
           ITL M L +F A   G L       +S ++ ++         ++ +   ++ +S +    
Sbjct: 37  ITLRMALILFAATIGGLLFGYDTGVISGVLINLDPADLNRTEMTSLNEEFITASTSVGSF 96

Query: 134 YGKL-----SDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMC 188
           +G L     +D  GRK  L    +VF+V  +   L+ S   LV  R I            
Sbjct: 97  FGSLLAFPLADKAGRKFTLAACCVVFVVAAIWMALSSSLIWLVSGRMIVGVAVGAAAQCV 156

Query: 189 SITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVPLSALSS 248
            I +S+I P + R     + +     G         +  D    WR  F I    SA+ +
Sbjct: 157 PIYLSEISPAKVRGFILTLNSVAITGGQLLSYIIAYFLGDARHAWRYLFAI----SAIPA 212

Query: 249 LLIAVFMKLPPRSKR 263
           +   + +   P S R
Sbjct: 213 IFFLLVLDFVPESPR 227

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 56/295 (18%), Positives = 108/295 (36%), Gaps = 22/295 (7%)

Query: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134
           P K +++  S++L  +  + D TL  T      + F+E   +S++     + SA  +  +
Sbjct: 52  PMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFF 111

Query: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXVTSMCSITISD 194
            + +DIFGR  +  +  + ++VG ++   +           I       +  +  + +SD
Sbjct: 112 ARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYSFGESGIDMVMQLLVSD 171

Query: 195 IVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSDHGGGWRMA---FLIQVPLSALSSLLI 251
              L  R L  G+      +  A         SD    W+     F I VP++ +   + 
Sbjct: 172 FSHLNWR-LVAGVIPMLPNVINAWASGTIV--SDFSDNWQWGIGMFAIIVPVACIPLAVC 228

Query: 252 AVFMKLPPRSKRVNS---PASIKNKL-----------LSVDWIGXXXXXXXX--XXXXXX 295
              M+   +  + N    P    N+L             +D +G                
Sbjct: 229 LFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLITLGASLGCILVPFT 288

Query: 296 XXXGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVLGS 350
                 +    + T V   IG ++    +I  E + AK P+ PL  +R+R V  +
Sbjct: 289 LTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLRLIRDRGVYAA 343

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 45/266 (16%)

Query: 103 MAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161
           M  +A  FN    + +W+  ++ L S +F  + G++ DI+G K  L+   +V L+  L+C
Sbjct: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158

Query: 162 G------------LTPSFWGLVGARFISXXXXXXVTSMCSITISDIVPLRDRAL--YQGM 207
           G            L  +F GL G  FI       + +     I     LR   +  + GM
Sbjct: 159 GFANYTHNDAFFILCRAFQGL-GIAFILPNVMGLIGN-----IYKANTLRKNFVISFVGM 212

Query: 208 CNFFFGLGTACXXXXXXWFSDHGGGWRMAFLIQVP-----LSALSSLLIAVFMKLPPRSK 262
           C     +G A            GG W      + P     +    ++++A+ M +   S 
Sbjct: 213 CA---PIGAAL-----------GGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSI 258

Query: 263 RVNSPASIKNKLLSVDWIGXXXXXXXXXXXXXXXXXGGKEIAFNSKTFVALCIGSS-LAC 321
               P +I      +DW G                 G  +  +N    +AL I S  L  
Sbjct: 259 PSTVPTNIHG--FGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALLIVSVFLLI 315

Query: 322 AFFIGVELYGAKDPILPLSFLRNRSV 347
           AFFI  E+  AK P+LP   ++NR +
Sbjct: 316 AFFI-YEIKFAKSPLLPPEVIKNRHI 340

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/95 (18%), Positives = 46/95 (48%)

Query: 123 YLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXX 182
           YL+       + G L+D++GR+P++++  ++++   +    + S+  +V  R +      
Sbjct: 131 YLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFLRCLQSAGIS 190

Query: 183 XVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTA 217
            + ++ S  + D    ++R  + G  + F  +G A
Sbjct: 191 PIIAINSGVVGDFTVKQERGTFVGAVSGFTLMGQA 225

>Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii AAR192C
          Length = 489

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 39/216 (18%), Positives = 86/216 (39%), Gaps = 17/216 (7%)

Query: 71  SPVPPDKLL-----VITLSMYLGIFLAAADGTLVSTIMAHIASEFN-ELPRISWIATAYL 124
           +P+P  +L+     +  LS +  + + A D  +V+  +  ++ +FN +   I+W  T  L
Sbjct: 31  NPIPVLRLINSRTWLFVLSAFGSLTIEATDFFIVALNVKKLSGDFNVKTASITWGITLAL 90

Query: 125 LSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISXXXXXXV 184
           ++      ++G + D +G+K   ++N  + +   ++ G   SF   +  R +        
Sbjct: 91  MTRTIGAVIFGYVGDRYGQKTSFLVNLSIMMALQIIIGFATSFRYFLACRALFGIALGGC 150

Query: 185 TSMCSITISDIVPLRDRALYQGMCNFFFGLGTACXXXXXXWFSD-HGGGWRMAFLIQVPL 243
               +    D +P        G+    + LG  C        +D     WR  F      
Sbjct: 151 FGTATTQCLDDLPKEAYGWVSGVFQQAYALGYLCAVVLTRALADTTHKTWRSCFW----F 206

Query: 244 SALSSLLIAVFMKLPPRS------KRVNSPASIKNK 273
            + ++L++ +F  + P +      KR+     + N+
Sbjct: 207 VSGTTLMMLIFRTMLPETDAFLERKRIKEQKKLNNE 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,356,492
Number of extensions: 2120973
Number of successful extensions: 7914
Number of sequences better than 10.0: 441
Number of HSP's gapped: 7874
Number of HSP's successfully gapped: 518
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)