Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16544g5.712ON1044104451630.0
TDEL0B020805.712ON1025107724410.0
NCAS0G001705.712ON1030106122170.0
KLTH0E00814g5.712ON974106819560.0
Skud_9.125.712ON106487018040.0
Smik_9.135.712ON106087518020.0
KLLA0A00396g5.712ON1012107617900.0
YIL156W (UBP7)5.712ON107189517290.0
Suva_9.305.712ON106287017230.0
SAKL0E15136g5.712ON103787216540.0
KNAG0L022005.712ON116191916540.0
Kwal_55.196455.712ON97083614610.0
CAGL0H06721g5.712ON108169014390.0
TBLA0E017605.712ON121257014001e-174
NDAI0F002005.712ON110557813731e-171
TPHA0D046605.712ON104546312861e-159
Kpol_2001.785.712ON40343111441e-147
YKR098C (UBP11)5.712ON71746810371e-126
Suva_11.3355.712ON72446510321e-126
Smik_11.3625.712ON72146410231e-124
AFR296C5.712ON11695649191e-105
Kpol_304.65.712ON5625198701e-104
KAFR0D021605.712ON8465098741e-102
Ecym_40095.712ON15172477252e-78
Skud_11.3385.712ON7122646384e-70
KAFR0H001505.712ON6562895932e-64
CAGL0G02563gsingletonON6312475283e-56
YER144C (UBP5)8.188ON8055283122e-28
Skud_5.2818.188ON8235363007e-27
TBLA0F036108.188ON11442633001e-26
TDEL0B042208.188ON8252982935e-26
TPHA0C027708.188ON9702412892e-25
KLLA0E10275g8.188ON7965522854e-25
Suva_5.2728.188ON7885122854e-25
Kpol_1032.288.188ON8822442802e-24
Kwal_14.20088.188ON4242842722e-24
KNAG0D019308.188ON9862432783e-24
NDAI0C059008.188ON8265672765e-24
KAFR0C025908.188ON9782872712e-23
Skud_4.3238.188ON9262392694e-23
Smik_4.3078.188ON9292392685e-23
KLTH0H07678g8.188ON8612622667e-23
Smik_5.3098.188ON8052402651e-22
YDR069C (DOA4)8.188ON9262392651e-22
Suva_2.2288.188ON9272402642e-22
AFR007W8.188ON8482442632e-22
SAKL0H18986g8.188ON8932762605e-22
ZYRO0G06798g8.188ON8772412552e-21
NDAI0A036808.188ON11162562542e-21
CAGL0G05247g8.188ON9472602543e-21
NCAS0B042808.188ON9222502533e-21
Ecym_61848.188ON8512432471e-20
CAGL0I06765g8.188ON8872722472e-20
NCAS0A039108.188ON7955382087e-16
AFR627C1.137ON12871931882e-13
Kpol_2001.541.137ON12231951846e-13
NCAS0I031401.137ON12011981764e-12
Suva_6.2761.137ON12562001749e-12
TDEL0C056401.137ON11782031721e-11
Ecym_81401.137ON12641931721e-11
CAGL0L01639g1.137ON11472121684e-11
Smik_10.371.137ON12472001667e-11
KNAG0C021801.137ON12311961668e-11
Skud_10.221.137ON12551971659e-11
YJL197W (UBP12)1.137ON12542031641e-10
KNAG0G015908.188ON6711241612e-10
Kwal_33.136281.137ON11601991613e-10
KAFR0F015601.137ON11712091594e-10
KLTH0F03674g1.137ON11981971594e-10
ZYRO0C17908g1.137ON12042061551e-09
TPHA0A025401.137ON12861131533e-09
NDAI0B004801.137ON12531221523e-09
SAKL0C04246g1.137ON12971831417e-08
TBLA0J006001.137ON14621241372e-07
KLLA0C03476g1.137ON12521191353e-07
NCAS0D023905.18ON12111301319e-07
NCAS0E026107.390ON7171291301e-06
NCAS0A143707.390ON7291311292e-06
KNAG0C035807.390ON7761311272e-06
ZYRO0B03300g7.390ON8131291245e-06
KNAG0B023707.390ON7531301246e-06
Smik_2.497.390ON7451331238e-06
NDAI0A016707.390ON8461291221e-05
CAGL0A04477g7.390ON7701281211e-05
Kwal_26.91518.742ON4541311201e-05
YBL067C (UBP13)7.390ON7471331183e-05
Suva_2.507.390ON7501331183e-05
Suva_13.4955.18ON12301111183e-05
CAGL0M11198g8.742ON4611281164e-05
Skud_2.387.390ON7481281174e-05
KLTH0D12760g8.742ON4531301155e-05
TPHA0P006807.390ON7271311157e-05
Kpol_513.255.18ON11902321157e-05
NDAI0I025305.18ON11971051157e-05
Ecym_62488.742ON4661051138e-05
KNAG0J008003.270ON7651141131e-04
ZYRO0C09812g2.69ON7021361131e-04
TPHA0E008707.390ON7151311121e-04
NDAI0E041807.390ON8271291122e-04
TBLA0D010708.742ON4831951112e-04
YMR304W (UBP15)5.18ON12301121122e-04
KLLA0D08459g2.69ON7501371112e-04
KLLA0C06974g8.742ON4461211102e-04
Kpol_534.231.369ON4961051102e-04
CAGL0M13783g5.18ON11961041112e-04
Smik_13.5215.18ON12311121112e-04
KNAG0A019708.540ON4711581102e-04
Skud_13.4785.18ON12311121112e-04
KNAG0E012905.18ON11961061112e-04
TDEL0G004105.18ON11861091103e-04
CAGL0K10494g1.369ON4951851093e-04
Kwal_34.162681.369ON4491551083e-04
TBLA0C070205.18ON12471131103e-04
TPHA0G005608.742ON4632531083e-04
NDAI0C059508.202ON10801411084e-04
TPHA0L022905.18ON11931071085e-04
KNAG0G029308.742ON459951075e-04
Smik_14.1442.69ON7631351075e-04
Kpol_1045.417.390ON7121231075e-04
Suva_14.1562.69ON7881351076e-04
Ecym_56715.18ON11761051076e-04
Skud_14.1482.69ON7761351068e-04
Kwal_26.95985.18ON11911061068e-04
KNAG0C019401.369ON4991081059e-04
YER098W (UBP9)7.390ON7541271059e-04
SAKL0H04994g8.742ON4541041059e-04
Ecym_27171.369ON4831031050.001
NDAI0H035501.369ON5021041050.001
SAKL0H00418g5.18ON11901051060.001
Smik_13.4318.742ON4711281040.001
NDAI0E008108.742ON4931311040.001
TPHA0J026205.443ON1225501050.001
ZYRO0D07062g5.18ON11931051050.001
KAFR0A042108.742ON4401201030.001
TBLA0E025703.270ON7851471040.001
AGL357W5.18ON11661281040.001
Ecym_46857.390ON7781321030.002
ABL145W2.69ON7491311020.002
KAFR0A075802.69ON8021391020.002
Kwal_33.144302.69ON5111281010.002
TBLA0C012001.369ON5031051010.002
CAGL0I05522g7.390ON7241271010.003
TDEL0C015707.390ON7651321010.003
CAGL0H10186g3.270ON7782321010.003
Smik_5.2447.390ON7491271010.003
YPL072W (UBP16)8.540ON4991741010.003
TPHA0A025101.369ON5051081000.003
KAFR0I026005.18ON12131061010.003
KLTH0H13354g1.369ON4951491000.003
SAKL0E13002g2.69ON7391371010.003
NCAS0D006001.369ON4931081000.003
KLTH0B09944g5.18ON11891261010.003
KAFR0K018107.390ON7141311000.004
YNL186W (UBP10)2.69ON7921351000.004
KLLA0E01013g8.202ON7742101000.004
Kpol_1044.242.69ON7241391000.004
NDAI0F034102.69ON870131990.005
Suva_5.2177.390ON754130990.006
KNAG0F012202.69ON784133980.006
YMR223W (UBP8)8.742ON471138960.009
NCAS0I016203.270ON79584970.009
NCAS0B005808.742ON46696960.009
ZYRO0A05962g8.742ON465119960.009
Suva_6.831.369ON500140950.012
SAKL0G02728g5.443ON123754960.013
Skud_5.2237.390ON748127950.015
TBLA0B019308.202ON1019142950.016
CAGL0I06600g8.202ON816141950.016
Suva_13.4078.742ON471136940.016
TPHA0M010903.270ON78075950.016
Skud_6.941.369ON499140930.022
Klac_YGOB_Anc_5.18b5.18ON1166103940.022
KLLA0A10791g1.369ON484122930.023
YFR010W (UBP6)1.369ON499106930.023
Skud_13.3928.742ON473130930.025
AEL242W8.540ON61383930.027
TBLA0B097602.69ON898137930.028
Skud_16.2098.540ON503164920.031
TPHA0E017105.443ON1283205930.033
TDEL0D024001.369ON494106920.033
Ecym_55448.202ON834105920.036
TDEL0B036708.742ON463134900.046
TDEL0D035503.270ON780124910.046
AGR139C8.202ON78974910.048
AFR551W8.742ON469106900.051
ZYRO0F01276g3.270ON776115900.060
Smik_7.3141.369ON499140890.061
KAFR0L017307.390ON701130900.063
TBLA0D006207.390ON1171131900.064
Ecym_45145.443ON124635900.070
ZYRO0G01188g1.369ON500130890.074
SAKL0F12430g7.390ON754132890.078
Kpol_1064.488.742ON466181870.11
Smik_5.3188.202ON909145870.12
Kpol_219.1singletonON24980850.13
Kpol_1018.937.390ON75542870.14
ZYRO0D03982g8.540ON82172870.14
Ecym_11668.540ON69677870.14
Suva_4.2953.270ON782114870.15
KAFR0C045201.369ON499105860.16
TDEL0A016208.202ON795141860.17
TDEL0B030608.540ON73477860.17
ZYRO0B11044g8.202ON826141860.20
SAKL0H18656g8.202ON772158850.21
NDAI0A074103.270ON810144850.22
YER151C (UBP3)8.202ON912144850.23
KLLA0F18700g3.270ON77049850.24
CAGL0K10252g5.443ON126727850.26
Smik_16.1638.540ON501168840.28
NCAS0C021108.540ON49477830.31
KLLA0E23387g8.540ON78277830.35
NDAI0C015505.443ON129541840.36
ZYRO0G01606g5.443ON130526840.37
KLLA0E20351g7.390ON69727830.37
AEL029W1.369ON446107820.39
Kpol_251.73.270ON480122820.41
CAGL0H05335g8.540ON48384820.42
NCAS0A038408.202ON917141830.42
Kpol_1016.15.443ON125127820.51
KNAG0A054502.307ON764120820.51
TBLA0A064705.443ON132028820.52
KLLA0E02377g5.443ON1220195820.58
YOR124C (UBP2)5.443ON127251820.59
SAKL0D03322g3.270ON765118810.66
KAFR0B023708.202ON829138810.72
KAFR0C004103.270ON769129810.72
KLTH0F15862g5.443ON124126810.75
Kwal_55.213935.443ON123326800.85
AGR370W7.390ON74021800.87
SAKL0H10076g8.540ON76777800.96
Skud_15.2865.443ON127851801.0
Suva_8.1765.443ON127039801.0
KAFR0E009308.540ON49877791.2
AGR023C3.270ON780114791.2
TPHA0D043508.202ON85477791.2
Skud_5.2898.202ON910144791.2
ACL164C5.443ON138927791.3
TDEL0D025805.443ON127226791.3
Suva_5.2808.202ON905144791.3
TBLA0H036008.540ON482408781.4
SAKL0D10120g1.369ON49226781.4
KNAG0B041905.443ON126226781.6
Smik_15.3015.443ON127251781.7
NCAS0H021005.443ON126957771.9
Kpol_1062.235.443ON126627772.2
KLTH0E12540g8.540ON75277772.3
KAFR0D050705.443ON122739772.3
Kwal_27.120308.540ON74977762.9
KAFR0A069102.307ON678115753.3
Kpol_1024.448.540ON49678753.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16544g
         (1044 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...  1993   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   944   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     858   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   758   0.0  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   699   0.0  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   698   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   694   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   670   0.0  
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   668   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   641   0.0  
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   641   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   567   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   558   0.0  
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   543   e-174
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     533   e-171
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   499   e-159
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   445   e-147
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   404   e-126
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   402   e-126
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   398   e-124
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   358   e-105
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   339   e-104
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   341   e-102
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   283   2e-78
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   250   4e-70
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   233   2e-64
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   207   3e-56
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   124   2e-28
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   120   7e-27
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   120   1e-26
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   117   5e-26
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   115   2e-25
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   114   4e-25
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   114   4e-25
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   112   2e-24
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   109   2e-24
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   111   3e-24
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   110   5e-24
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   108   2e-23
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   108   4e-23
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   107   5e-23
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   107   7e-23
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   106   1e-22
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   106   1e-22
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   106   2e-22
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   105   2e-22
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   104   5e-22
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   102   2e-21
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             102   2e-21
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   102   3e-21
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    102   3e-21
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   100   1e-20
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   100   2e-20
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     85   7e-16
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    77   2e-13
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    75   6e-13
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    72   4e-12
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    72   9e-12
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    71   1e-11
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    71   1e-11
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    69   4e-11
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    69   7e-11
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    69   8e-11
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    68   9e-11
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    68   1e-10
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    67   2e-10
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    67   3e-10
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    66   4e-10
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    66   4e-10
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    64   1e-09
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    64   3e-09
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    63   3e-09
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    59   7e-08
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    57   2e-07
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    57   3e-07
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    55   9e-07
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    55   1e-06
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    54   2e-06
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    54   2e-06
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    52   5e-06
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    52   6e-06
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    52   8e-06
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    52   1e-05
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    51   1e-05
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    51   1e-05
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    50   3e-05
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    50   3e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    50   3e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    49   4e-05
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    50   4e-05
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    49   5e-05
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    49   7e-05
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    49   7e-05
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    49   7e-05
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    48   8e-05
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    48   1e-04
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    48   1e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    48   1e-04
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    48   2e-04
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    47   2e-04
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    48   2e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    47   2e-04
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    47   2e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   2e-04
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    47   2e-04
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    47   2e-04
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    47   2e-04
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    47   2e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    47   2e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    47   3e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    47   3e-04
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    46   3e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    47   3e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    46   3e-04
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    46   4e-04
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    46   5e-04
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    46   5e-04
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    46   5e-04
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    46   5e-04
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    46   6e-04
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    46   6e-04
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    45   8e-04
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    45   8e-04
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    45   9e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    45   9e-04
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    45   9e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    45   0.001
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    45   0.001
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    45   0.001
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    45   0.001
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    45   0.001
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    45   0.001
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    45   0.001
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    44   0.001
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    45   0.001
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    45   0.001
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    44   0.002
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    44   0.002
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    44   0.002
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    44   0.002
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    44   0.002
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    44   0.003
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    44   0.003
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    44   0.003
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.003
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    44   0.003
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.003
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    44   0.003
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    43   0.003
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    44   0.003
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.003
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    44   0.003
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    43   0.004
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    43   0.004
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    43   0.004
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    43   0.004
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    43   0.005
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    43   0.006
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    42   0.006
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    42   0.009
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    42   0.009
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       42   0.009
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    42   0.009
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    41   0.012
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    42   0.013
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    41   0.015
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    41   0.016
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    41   0.016
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    41   0.016
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    41   0.016
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    40   0.022
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    41   0.022
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    40   0.023
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    40   0.023
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    40   0.025
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    40   0.027
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    40   0.028
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    40   0.031
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.033
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    40   0.033
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    40   0.036
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    39   0.046
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    40   0.046
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    40   0.048
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    39   0.051
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    39   0.060
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.061
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    39   0.063
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.064
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    39   0.070
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    39   0.074
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    39   0.078
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    38   0.11 
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    38   0.12 
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    37   0.13 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    38   0.14 
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    38   0.14 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    38   0.14 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    38   0.15 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    38   0.16 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    38   0.17 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    38   0.17 
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    38   0.20 
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    37   0.21 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    37   0.22 
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    37   0.23 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    37   0.24 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    37   0.26 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    37   0.28 
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    37   0.31 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    37   0.35 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    37   0.36 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    37   0.37 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    37   0.37 
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    36   0.39 
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    36   0.41 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    36   0.42 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    37   0.42 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    36   0.51 
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    36   0.51 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    36   0.52 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    36   0.58 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    36   0.59 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    36   0.66 
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    36   0.72 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.72 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    36   0.75 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    35   0.85 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    35   0.87 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    35   0.96 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    35   1.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    35   1.0  
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    35   1.2  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    35   1.2  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    35   1.2  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    35   1.2  
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    35   1.3  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    35   1.3  
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    35   1.3  
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    35   1.4  
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    35   1.4  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    35   1.6  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    35   1.7  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    34   1.9  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    34   2.2  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    34   2.3  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    34   2.3  
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    34   2.9  
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    33   3.3  
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    33   3.5  
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    33   4.4  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   5.0  
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    33   5.4  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    33   5.9  
CAGL0J08030g Chr10 complement(785064..791717) [6654 bp, 2217 aa]...    33   6.4  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    32   7.2  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    32   7.6  

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score = 1993 bits (5163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/1044 (93%), Positives = 975/1044 (93%)

Query: 1    MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
            MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN
Sbjct: 1    MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60

Query: 61   RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
            RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE
Sbjct: 61   RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120

Query: 121  VDSVLDRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNF 180
            VDSVLDRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNF
Sbjct: 121  VDSVLDRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNF 180

Query: 181  HSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKS 240
            HSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKS
Sbjct: 181  HSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKS 240

Query: 241  ELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDG 300
            ELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDG
Sbjct: 241  ELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDG 300

Query: 301  DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF 360
            DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF
Sbjct: 301  DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF 360

Query: 361  NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYME 420
            NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYME
Sbjct: 361  NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYME 420

Query: 421  MDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSS 480
            MDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSS
Sbjct: 421  MDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSS 480

Query: 481  NKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKEMPPPVPPKIQLEQQE 540
            NKEGKEKSANAKHIEPVPWKPPALPERMRNL      ATLPITKEMPPPVPPKIQLEQQE
Sbjct: 481  NKEGKEKSANAKHIEPVPWKPPALPERMRNLPPPPPPATLPITKEMPPPVPPKIQLEQQE 540

Query: 541  DKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITG 600
            DKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITG
Sbjct: 541  DKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITG 600

Query: 601  LRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMN 660
            LRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMN
Sbjct: 601  LRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMN 660

Query: 661  GGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLL 720
            GGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLL
Sbjct: 661  GGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLL 720

Query: 721  YDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILS 780
            YDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCG       TFYILS
Sbjct: 721  YDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGYSSYSYSTFYILS 780

Query: 781  LAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRH 840
            LAIPKP        KGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRH
Sbjct: 781  LAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRH 840

Query: 841  NKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLFPRKRXXXXXXXXXXXXXXXXXXX 900
            NKQ         PEPRKAKKKDEEGSSLKSKTKFLLFPRKR                   
Sbjct: 841  NKQSSSSGSTASPEPRKAKKKDEEGSSLKSKTKFLLFPRKRKSSSSKSLSPFNLLNSSSS 900

Query: 901  XXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNI 960
                                IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNI
Sbjct: 901  SSNTNNNSSSNSGSKKNSFSIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNI 960

Query: 961  VLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSH 1020
            VLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSH
Sbjct: 961  VLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSH 1020

Query: 1021 GNLSQGVNKVSSKDVYVLFYERID 1044
            GNLSQGVNKVSSKDVYVLFYERID
Sbjct: 1021 GNLSQGVNKVSSKDVYVLFYERID 1044

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  944 bits (2441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1077 (48%), Positives = 675/1077 (62%), Gaps = 85/1077 (7%)

Query: 1    MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
            M+     FTPEYS+ELLR V+++YEDDIK ++   KLE L DL++HT YL+ES+   +  
Sbjct: 1    MADTEVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHE 60

Query: 61   RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
            +N QDALTA+IIGCY+LYLI+PQS +FQ RNK++ + N L K+Y+NQ NMTNVLLMVKDE
Sbjct: 61   KNNQDALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDE 120

Query: 121  VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLP----KMHKKWD 172
            VDS+LDR+ R+ K+ E    R RA+S PD   +S ++ L +  N + LP    +   K +
Sbjct: 121  VDSILDRNAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIH-NENPLPLGDHQAASKSE 179

Query: 173  FIRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSA--VPSSLSVDT-VGKEAPELSLS 229
              R D N   +D  + P+W AP LEPNDQL++ALD+    PS +++D  +  +   +S S
Sbjct: 180  QGREDMNNLQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQPMATKELAISTS 239

Query: 230  PLGYPKHKSKSELT---VEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVA 286
                 +  S    T   +EE +   QD   H+       +LG +   +  W+A VDR   
Sbjct: 240  RKALSRRASAMGPTPYPIEELDISGQDGNSHYD------ELGFN---KTLWNANVDRQTT 290

Query: 287  HRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNR 346
            HRKDSYHSVYM +G  D   +   +  +   Q ++RLQKQSIIT+PELF+ILS+ +E  +
Sbjct: 291  HRKDSYHSVYMFEGGSD---DHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESEK 347

Query: 347  LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSF 406
            LLLID RL  R K N+I+AP  V IDPR LWD  T TP+++ + LDE +K   F +RGS+
Sbjct: 348  LLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSY 407

Query: 407  DFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQF 466
            D+IVYYTDMKTYM +D+DY+F  + L+ AS  V+LRSLP++LLGGYEKWK ++K Y    
Sbjct: 408  DYIVYYTDMKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDH 467

Query: 467  GIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERM-----------------R 509
            G+ +D+Y+YRPY  +K+    +++ +  E   WKPPA+P R+                 +
Sbjct: 468  GVNMDNYIYRPYGESKKALPDTSSKRTPELPSWKPPAIPPRIRKRPPPPPPISVPVPTEK 527

Query: 510  NLXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLS 569
                        ++ E  P  PP +     E    TRP   T  +    P +    +Q  
Sbjct: 528  PPAAPPPPIPPKVSLETHPEEPPAVDDHSVET---TRPTRITRKAIGSRPLHTHPHDQRL 584

Query: 570  QLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEP 629
             L      QR +S+PTIE+S+N YV+LSITGLRNLG TCYINSMLQCLFAT  FRDLF  
Sbjct: 585  SL------QRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVS 638

Query: 630  SNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQD 689
              +E FFN    +  +LSKSF++L RKMY+NGGCSVVPTSFLK+ + LRPD  IPDDQQD
Sbjct: 639  GKFEEFFNQNYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQD 698

Query: 690  AQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPI 749
             QEFLM+T+DRLHDELSNQ  V N +P+LLLYD     V  +EYK+WFE S+I    +PI
Sbjct: 699  TQEFLMVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPI 758

Query: 750  DKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFT 809
            D IFQGQ+EN L C++CG       TFY+LSLAIPKP        K   V LEDCINMFT
Sbjct: 759  DHIFQGQIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKR--VKLEDCINMFT 816

Query: 810  SDEVMSRENAWDCPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKK--DEEGSS 867
            +DE++S ENAWDCPKCG  V    ++    H K+          E R++K         S
Sbjct: 817  NDEILSGENAWDCPKCGSAV----TDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKS 872

Query: 868  LKSKTKFLLFPRKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFV 927
             +SK+ F +    +                                        +  NF+
Sbjct: 873  KRSKSPFRMLGSTKFPLAMEDWKSKELSTK------------------------KTLNFI 908

Query: 928  TLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHY 987
             LPPVL+IHLSRFYYDLTKKN+T++TYPL+LNI+LKNNET +YRLYAVVNH GNLISGHY
Sbjct: 909  FLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNHTGNLISGHY 968

Query: 988  TSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
            TSLVNK   H L+  RQ+WYYFDDEVVK ET HGN+ QG+ KVSS DVYVLFYER+D
Sbjct: 969  TSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVLFYERLD 1025

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1061 (46%), Positives = 660/1061 (62%), Gaps = 67/1061 (6%)

Query: 8    FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
            FTPEYS+ELLR ++ +Y++DIK +Y  LKLE L DL++HT YL+E F       N +DAL
Sbjct: 10   FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 68   TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
            T++I+GCY+L+LI+PQS QFQ+RNK++ +++ LKKLYENQ +MTNVLLMVKDE++++L++
Sbjct: 70   TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 128  DF-RKLKD----VERKRAFSSPD-NGLDSEISRLTLAGNGSTLP--KMHKKWDFIRSDSN 179
               R++ +    + R+RA+S PD N L  ++  L+++      P  K+     F  SDS+
Sbjct: 130  TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSDSD 189

Query: 180  -FHSHDTGNVPLWKAPNLEPNDQLKLAL---DSAVPSSLSVDTVGKEAPELSLSPLGYPK 235
              +  +  + PLW AP LEP DQLKLA+   ++  P  +  +   +E  +L   P   P+
Sbjct: 190  VINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQP-SIPE 248

Query: 236  HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSV 295
              S +  +++  +      +    +  +   + +  + + F +   DR+  HRKDSYHSV
Sbjct: 249  -LSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPSNNRSFRETNADRSQTHRKDSYHSV 307

Query: 296  YMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLR 353
            YM D +     +K   F +S   +Q ++RLQKQSIIT+ EL SILS   ER +LLLIDLR
Sbjct: 308  YMIDEE---STDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKLLLIDLR 364

Query: 354  LQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYT 413
               R   N+I+APN+V IDP +LWD  T TP+ ++  L++ L N +FN+R  F+++VYYT
Sbjct: 365  WSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLDNELFNRRHEFEYVVYYT 424

Query: 414  DMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDY 473
            DMKTYM  DFDY F  + L+       LRS P+YLLGGY+KWK  L  Y  ++ I + DY
Sbjct: 425  DMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEYDINIPDY 484

Query: 474  LYRPY-----SSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKEMPP 528
            LYRPY     S   E  E++ N   +EP  W+PP LP R+R        A LP+      
Sbjct: 485  LYRPYDKALKSETPEEFEETKNKHVLEPPSWRPPELPVRIRKRPPPPPPALLPVPPSP-- 542

Query: 529  PVPPKIQLEQQEDKNHTRPRSRTVSSPAEVP----KNVVAPEQLSQLDSYPMRQRQFSVP 584
                 ++    +D N  RP+   ++  +  P    +N   P  L Q  +     R+ S+P
Sbjct: 543  ----PVKPRIVDDVN--RPKKTLMNLHSARPLLHERNYQIPPHLQQTTTL---TRRPSIP 593

Query: 585  TIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFN-PELEDT 643
            TIERS N YV+LSITGLRNLG TCYINSMLQCLFAT  FRDLF  S Y  F N  +  ++
Sbjct: 594  TIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFPNS 653

Query: 644  GKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHD 703
              +S SF++L +KMY+NGGCSVVPTSFLK CN LRPD  IPDDQQD QEFLM+ +DRLHD
Sbjct: 654  PMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHD 713

Query: 704  ELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHC 763
            ELSNQ EV+N +P L+LYD    +VQ EEYK WFE S+I    SPID+IFQGQ+ENGL C
Sbjct: 714  ELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENGLQC 773

Query: 764  KKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCP 823
            ++CG       TFY+LSLAIPKP        K   V LEDCINMFT+DE++S ENAWDCP
Sbjct: 774  QRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKR--VKLEDCINMFTNDEMLSGENAWDCP 831

Query: 824  KCGVTVQ-KEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLFPRKRX 882
             CG   Q + +  ++Q                   + KK  +G   + K++F   P +  
Sbjct: 832  NCGSNAQDRVRVNTDQ-------------------SVKKKRQGEEHRHKSRFFGLPTR-- 870

Query: 883  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHLSRFYY 942
                                                  I+  NF+ LPPVLVIHLSRF+Y
Sbjct: 871  ---PHRSLSPFRKSGSSSTNSTSKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFY 927

Query: 943  DLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENN 1002
            DLTKKN+TVITYPLILNIVLKNNE  KY+LY +VNH GNLISGHYTSLVNK   H+L +N
Sbjct: 928  DLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHN 987

Query: 1003 RQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERI 1043
            +Q+WYYFDDEVVK E +HG++  G++KVSSKDVYVLFYER+
Sbjct: 988  QQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERL 1028

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1068 (41%), Positives = 591/1068 (55%), Gaps = 132/1068 (12%)

Query: 8    FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
            ++PEYS+ELL+ V+D+Y  DI  ++  L+LE L DL++H  YL+ES+   +     +D L
Sbjct: 5    YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64

Query: 68   TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
            TA++ GC+++YLIIP S QFQ+R+K++ ++  LKK Y+++ NMTNVLLMV + ++S + +
Sbjct: 65   TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES-MSK 123

Query: 128  DFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSHDTGN 187
            D  +   + RKRA+S P       I  L+ A + +  P    + +F              
Sbjct: 124  DEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEF-----------ENG 172

Query: 188  VPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGK-------------EAPELSLSPLGYP 234
              +W AP LEPND LK++L S   S+ S  +  +             E PEL    LG  
Sbjct: 173  TTMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEPELHALSLGGS 232

Query: 235  KHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHS 294
            + +  S         P +  R     +  T Q     D   F D K++R   HRKDSYHS
Sbjct: 233  RTRRSSV--------PARASR-----KLGTTQASNSSD---FNDQKINRYATHRKDSYHS 276

Query: 295  VYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRL 354
            V+M + D+D       TF       + RLQKQS++T  +L  IL ++ +R+ LLLIDLR 
Sbjct: 277  VHMSNDDYD-----AFTF------NLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRF 324

Query: 355  QSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTD 414
              R++ N+ILAPN++ +DP +LW+ N  +P+     L+  L N + N R  F++IVYYTD
Sbjct: 325  SKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTD 384

Query: 415  MKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYL 474
            MKT+M++DFDY  VF+ L+  S + +L+  P  LLGGYE+WK  L K  +Q     D +L
Sbjct: 385  MKTFMKLDFDYQLVFFQLIYTSNK-NLKCTPKVLLGGYEQWKKFLSKS-SQAYCDKDAFL 442

Query: 475  YRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPI--TKEMP----- 527
            Y   SS   G+            P    +LPE              PI  T+EM      
Sbjct: 443  Y---SSTNNGRN----------APVTSHSLPEHYPVAPPSIPPPPPPIAKTEEMTKTPYN 489

Query: 528  -PPVPPKIQLEQQED------KNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQ 580
              P P  +   Q+ D      +NHTR             KN +    +  L       + 
Sbjct: 490  RAPFPTPLVQAQRADHFPASSQNHTRD------------KNEIQKHSVPALSGNGNYSKH 537

Query: 581  FSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPEL 640
             ++PTIE+S N+YVALSITGLRN+G TCY+NSMLQCLFAT  FRDLF  + YE +F+ + 
Sbjct: 538  TAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKY 597

Query: 641  EDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDR 700
             +  +LSK F+VL +KMYMNGGCSVVPT FLK CN LRPDF IP DQQD QEFL+  + +
Sbjct: 598  TNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQ 657

Query: 701  LHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENG 760
            LHDELS    V N +P LLL+D +   V ++EY  WFE  +     SPID IFQGQ+ENG
Sbjct: 658  LHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENG 717

Query: 761  LHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAW 820
            L C++CG        FY+LSLAIP          K   V LEDCIN+FTSDE ++ ENAW
Sbjct: 718  LFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKK---VRLEDCINLFTSDEQLTNENAW 774

Query: 821  DCPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLFPRK 880
            DCPKCG +                        PE  K KK            +FLL P  
Sbjct: 775  DCPKCGTSASG-------------------TGPEEEKKKK------------RFLLNPDT 803

Query: 881  RXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIH 936
            R                                           I+  NF++LP VL IH
Sbjct: 804  RASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFISLPTVLTIH 863

Query: 937  LSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRD 996
            LSRF+YDLTKKN  VITYPLIL+IVLKN + +KYRLYA+ NH GNLISGHYTSLVNK+ D
Sbjct: 864  LSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLD 923

Query: 997  HDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
            HDL   +Q+WYYFDDE VK + +HG++  G+  +SS DVYVLFYE+ID
Sbjct: 924  HDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKID 971

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/870 (46%), Positives = 532/870 (61%), Gaps = 76/870 (8%)

Query: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
           M  +TT FTPEYS+ELLR V+D+Y +DIK +Y  LKLE L DL++HT YLYE + D M++
Sbjct: 1   MHPHTTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRH 60

Query: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
               DALTA+IIGCY+++LIIPQS QFQ RNK++ ++  LKK+YEN++NMTNV+LMVK E
Sbjct: 61  NRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHK-KWDFIR 175
           +  VLD   +    +E    +KRAFS P N L  +++ L+L   G   P  H  K  F  
Sbjct: 121 IGVVLDESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAG---PHGHGFKASFTE 177

Query: 176 SDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPK 235
            D+   S      P+W APNLEPNDQLKLAL                 PE+  +P+ YP+
Sbjct: 178 EDAEQSS------PVWTAPNLEPNDQLKLAL----------------LPEVIPTPI-YPE 214

Query: 236 HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSV 295
              K+   V      +    + +     +  L        F +  VDR++ HRKDSYHS+
Sbjct: 215 SGRKTSSPVRPSVLLEDVPYNCYDGGASSASLNPS-----FGEITVDRSITHRKDSYHSI 269

Query: 296 YMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLR 353
           YM D D    +N      E++  +Q++  LQKQSIIT+PELFSILSN  ER ++LLIDLR
Sbjct: 270 YMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLR 329

Query: 354 LQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIVYY 412
           +  R + N+I+APN+V IDP +LWD  T TPV    +L+  L+ N IF  R  F+++VYY
Sbjct: 330 IPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYY 389

Query: 413 TDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD 472
           TD+KT+M M+FDY+F+F+ L++ SQ+  L S+P+ LLGGYEKWK  L  Y  ++ + ++D
Sbjct: 390 TDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIED 449

Query: 473 YLYRPYS-------------SNKEGKEKSAN--AKHIEPVPWKPPALPERMRNLXXXXXX 517
           YLYRPYS             SN +    S    AK  EP  WKPP LP R+R        
Sbjct: 450 YLYRPYSQKAHQQQQQEQQQSNAQDSSSSKESSAKVPEPPSWKPPDLPIRLRKRPPPPPP 509

Query: 518 ATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMR 577
            ++P T  +PPP+PPKI +   ++    +P    + +   V K  +   ++ Q      +
Sbjct: 510 VSMPTTPGIPPPLPPKIMVYSHDNSFSRKP---PIPAKQHVKKQQLNSNEIIQRKRQQQK 566

Query: 578 QRQFS-------------VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFR 624
            R +              +PTIE+S+N YV+LSITGLRNLG TCYINSM+QCLFA  +FR
Sbjct: 567 HRHYGQQLLQPQPQRAYNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFR 626

Query: 625 DLFEPSNYERFFNP----ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPD 680
            LF  +NY+ +  P        + KLS S ++L  KMY+NGGCSVVPT FLK+ N LRPD
Sbjct: 627 TLFISANYKNYLQPPKGSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPD 686

Query: 681 FNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENS 740
             IPDDQQD QEFLM+ +DRLHDELSNQ  V N +P LLLY+A+  KV   EYK WF+ +
Sbjct: 687 LKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKN 746

Query: 741 LINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGN--W 798
           +I    SPID IFQGQ+EN L CK+CG       TFY+LSLAIP+         +     
Sbjct: 747 VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKR 806

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKCGVT 828
           V LEDCINMFT DEV+S ENAWDCP+CG T
Sbjct: 807 VKLEDCINMFTDDEVLSGENAWDCPRCGPT 836

 Score =  182 bits (461), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            ++  NFVTLP +LVIHLSRFYYDLTKKN TVITYPLILNI+LKNNET+KYRL+ VVNH G
Sbjct: 941  VKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTG 1000

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             L+SGHYTSLVNK+ +H ++  R +WYYFDDEVVK +  HG  S    K+SS DVYVLFY
Sbjct: 1001 TLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHG--SDKNLKISSSDVYVLFY 1058

Query: 1041 ERI 1043
            ER+
Sbjct: 1059 ERV 1061

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/875 (46%), Positives = 524/875 (59%), Gaps = 93/875 (10%)

Query: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
           M  +TT FTPEYS ELLR V+D+Y +DIK +Y  LKLE L DL++HT YL+E + D M +
Sbjct: 1   MHPHTTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHH 60

Query: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
               DALTA++IGCY+++LIIPQS QFQ RNK++ ++  LKK+YEN++NMTNV+LMVK E
Sbjct: 61  GRPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 120

Query: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHK-KWDFIR 175
           +  VLD   + +  +E    +KRAFS P N L  +++ L+L   G   P+ H  K     
Sbjct: 121 IGVVLDESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAG---PQQHNIKVPLTE 177

Query: 176 SDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPK 235
            D +  S      P+W APNLEPNDQLKLAL   +P  +   T  +  PE         K
Sbjct: 178 DDMDQSS------PVWTAPNLEPNDQLKLAL---LPEVIPTSTFNE--PER--------K 218

Query: 236 HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSV 295
             S +  +V  ++ P      +H     T  L        F D   DR+V HRKDSYHSV
Sbjct: 219 STSPARPSVLLEDVPCT----YHDNDASTASLNPP-----FRDITADRSVTHRKDSYHSV 269

Query: 296 YMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLR 353
           YM D D+   +N      E++  +Q++  LQKQSIIT+PELFSILSN+ ER ++LLIDLR
Sbjct: 270 YMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLR 329

Query: 354 LQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIVYY 412
           +  R   N+I+APN+V +DP +LWD  T TPV    +L+  LK N  F  R  FD+IVYY
Sbjct: 330 IPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYY 389

Query: 413 TDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD 472
           +D+KT+M ++FDY+F+F+ L++ SQ+  L ++P+ LLGGYEKWK  L  Y  ++ I V+D
Sbjct: 390 SDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVED 449

Query: 473 YLYRPYSSNKEGKE---------------KSANAKHIEPVPWKPPALPERMRN------- 510
           YLYRPYS     ++               K    K  EP  WKPP LP R+R        
Sbjct: 450 YLYRPYSQKARAQQQQQQQQPNSQDSSSSKETPTKVPEPPSWKPPDLPIRLRKRPPPPPP 509

Query: 511 ----------LXXXXXXATLPITKEMP--PPVPPKIQLEQ-QEDKNHTRPRSRTVSSPAE 557
                               P    +P  PP+P K  +++ Q + N    R R      +
Sbjct: 510 ASMPTTPEIPPPLPPKIMVYPHEGSVPRKPPIPAKQHVKKKQSNSNEIIQRKRQQQHYGQ 569

Query: 558 VPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
                    QL Q    P+  + +S+PTIER+ N YV+LSITGLRNLG TCYINSM+QCL
Sbjct: 570 ---------QLLQ----PLPPKDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCL 616

Query: 618 FATNMFRDLFEPSNYERFFNPELED----TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKI 673
           FA   FR LF  SNY+ +  P   +    + KLS S S+L  KMY+NGGCSVVPT FLK+
Sbjct: 617 FAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKV 676

Query: 674 CNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEY 733
            N LRPD  IPDDQQD QEFLM+ +DRLHDELSNQ  V N +P LLLY+A+  KV   EY
Sbjct: 677 INQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEY 736

Query: 734 KQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXX 793
           K WF+ ++I    SPID IFQGQ+EN L CK+CG       TFY+LSLAIP         
Sbjct: 737 KHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKL 796

Query: 794 XKGN--WVNLEDCINMFTSDEVMSRENAWDCPKCG 826
            +     V LEDCINMFTSDEV+S ENAWDCP+CG
Sbjct: 797 GRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            ++  NFVTLP +LVIHLSRFYYDLTKKN TVITYPLILNI+LKNN+T+KYRL+ VVNH G
Sbjct: 938  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTG 997

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             LISGHYTSLVNK+ +H ++  R +WYYFDDEVVK +  HG  S    K+SS DVYVLFY
Sbjct: 998  TLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG--SDKNLKISSSDVYVLFY 1055

Query: 1041 ERI 1043
            ER+
Sbjct: 1056 ERV 1058

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1076 (39%), Positives = 590/1076 (54%), Gaps = 111/1076 (10%)

Query: 8    FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
            +TPEYS ELL  V+++Y  D+K +YA LKLE L +L++    L+ES+ + +     +D L
Sbjct: 5    YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCL 64

Query: 68   TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
              Y+IG ++++LIIP S QF ARNK++ +++ LKKLY++++NM+NVLLMV  +VDSVL++
Sbjct: 65   CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124

Query: 128  DFRKLK----DVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSH 183
            +   L     D  RKRAFS  +  +  ++  L L              D    D ++ S 
Sbjct: 125  NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQL-----------NNADQKSVDDDYKSF 173

Query: 184  DTGNVPLWKAPNLEPNDQLKLAL------DSAVPSSLSVD-TVGKEAPE------LSLSP 230
             +     WKAP L+PND+L LA+      +S+  +S+S+D  + KE  +      +S   
Sbjct: 174  ASTE---WKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKL 230

Query: 231  LGYPKHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDA--KVDRAVAHR 288
            LG        + T   ++ P    RH     ++ H+L   +D     +     DR+  HR
Sbjct: 231  LGSIHKPDLLDRTGIIRKVP----RHQSLPTEQHHKLYAQNDSSLMLENMDSFDRSRTHR 286

Query: 289  KDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLL 348
            KDSYHSVY+ D   D   N  +T        + R Q+++ I    LFS+L + + R  LL
Sbjct: 287  KDSYHSVYLGDELEDL--NNIST-------GLARHQQENTIDCFALFSLLKDAESRENLL 337

Query: 349  LIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDF 408
            LIDLRL  R++ N+++APN++ IDP +L+D    T +     L + + N I +K   +D 
Sbjct: 338  LIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDN 397

Query: 409  IVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGI 468
            IVYYTD K++M + F+Y  + + L+      ++   P  LLGGYE+WKA L K L     
Sbjct: 398  IVYYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFLNKQLRDSEF 454

Query: 469  RVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRN----------------LX 512
                +L+R   S    K  S  +   + +    P++  +  N                  
Sbjct: 455  DKSLFLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPP 514

Query: 513  XXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPE-QLSQL 571
                  + P      PPVP  I                  +SPA + K  +A E +  Q 
Sbjct: 515  LPGSPLSAPTIVYNRPPVPLPI------------------NSPAPLLKPSIAKELRTPQR 556

Query: 572  DSYPMRQRQ----FSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLF 627
            + + ++ +     FS+PTIERS N++V+LSITGLRN+G TCYINSMLQCLF  + FRDLF
Sbjct: 557  NDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLF 616

Query: 628  EPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQ 687
                Y R+ NP+  +T  +SK FS+L RKMY+NGGCSVVP  FLK C+ LRPDF+IP DQ
Sbjct: 617  LGGKYHRYLNPKRSNT-IISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQ 675

Query: 688  QDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFS 747
            QD QEFL+  +D LHDELS  T+V N +P LLL+D E   V  +EY +WF+  L N   S
Sbjct: 676  QDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLS 735

Query: 748  PIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINM 807
            PID IFQGQ+EN L C++CG       TFY+LSLAIP              + LEDCIN+
Sbjct: 736  PIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINL 795

Query: 808  FTSDEVMSRENAWDCPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSS 867
            +T DE+++ ENAWDCPKCG          N                + +K K        
Sbjct: 796  YTQDELLTGENAWDCPKCGTHSNSSDGSMNSDET-----------VDKKKKKNFLSVNGD 844

Query: 868  LKSKTKFLLFPRKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFV 927
             KS++KF      R                                       I+  NF+
Sbjct: 845  HKSRSKFFKLSSSR-----------SGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFI 893

Query: 928  TLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHY 987
            T+P +LVIHLSRF+YDLTKKNET+I YPLIL++VLKNNE  +YRLY ++NH GNL+SGHY
Sbjct: 894  TMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHY 953

Query: 988  TSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERI 1043
            TSLVNK+  H++   +Q+WYYFDDEVVK E +HG+  +G+  +SS DVYVLFYERI
Sbjct: 954  TSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERI 1009

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/895 (43%), Positives = 527/895 (58%), Gaps = 111/895 (12%)

Query: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
           M  + T FTPEYS+ELLR V+D+Y +DIK +Y  LKLE L DL++HT YL+E + D + +
Sbjct: 10  MHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHH 69

Query: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
               DALTA+IIGCY+++LIIPQS QFQ RNK++ ++  LKK+YEN++NMTNV+LMVK E
Sbjct: 70  DRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKE 129

Query: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHK-KWDFIR 175
           +  VLD   +    +E    +KRAFS P + L  +++ L+L    +  P+ H  K  F  
Sbjct: 130 IGVVLDESVKHGAGIEHRITKKRAFSVPADDLSGQVASLSL---DTAAPQDHGLKGTFTE 186

Query: 176 SDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPK 235
            D+   S      P+W APNLEPNDQLKLAL                 PE+  +P  + +
Sbjct: 187 DDAEQSS------PVWTAPNLEPNDQLKLAL----------------LPEVIPTP-AFRE 223

Query: 236 HKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQH------FWDAKVDRAVAHRK 289
            + K+ + V               + ++   +  +DD         F +   DR+V HRK
Sbjct: 224 PERKTSVPVRPSV-----------LLEDVPSIYHEDDTSFASLNPPFREITADRSVTHRK 272

Query: 290 DSYHSVYMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRL 347
           DSYHSVYM D  +   +N      E++  +Q++  LQKQSIIT+PELFSILSN+ ER ++
Sbjct: 273 DSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKV 332

Query: 348 LLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSF 406
           LLIDLR+  R   N+I+APN+V +DP +LWD  T TP+    +L+  LK N  F  R  F
Sbjct: 333 LLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRNKF 392

Query: 407 DFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQF 466
           D+IVYYTD+KT+M ++FDY F+F+ L++ SQ+  L ++P+ LLGGYEKWK  L  Y  ++
Sbjct: 393 DYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEY 452

Query: 467 GIRVDDYLYRPYS-----------------SNKEGKEKSANAKHIEPVPWKPPALPERMR 509
            I ++DYLYRPYS                 S      K ++ K  EP  WKPP LP R+R
Sbjct: 453 HISIEDYLYRPYSQKARLQQEQQQQQQQPDSQDSFSAKESSTKVPEPPSWKPPDLPIRLR 512

Query: 510 N---------------------LXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPR 548
                                            I+++  PP+P K  +++++  ++   +
Sbjct: 513 KRPPPPPPVSMPTTPEIPPPLPPKIMVHSQVSSISRK--PPIPAKQHVKKEQLNSNEIIQ 570

Query: 549 SRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATC 608
            +         + ++ P            QR +++PTIERS N YV+LSITGLRNLG TC
Sbjct: 571 RKRQHQHQHYDQQILQP------------QRAYNIPTIERSPNVYVSLSITGLRNLGNTC 618

Query: 609 YINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTG-----KLSKSFSVLIRKMYMNGGC 663
           YINSM+QCLFA   FR LF  S Y+ +  P +   G     KLS S S+L  KMY+NGGC
Sbjct: 619 YINSMIQCLFAAKTFRTLFISSKYKSYLQP-IRSNGSHYSPKLSNSLSMLFNKMYLNGGC 677

Query: 664 SVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDA 723
           SVVPT FLK+ N LRPD  IPDDQQD QEFLM+ +DRLHDELS+Q  V N +P LLLY+A
Sbjct: 678 SVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSDQQHVANDYPNLLLYNA 737

Query: 724 ETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAI 783
           +  KV   EYK WF+ ++I    SPID IFQGQ+EN L CK+CG       TFY+LSLAI
Sbjct: 738 DALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAI 797

Query: 784 PKPXXXXXXXXKGN--WVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSES 836
           P+         +     V LEDCINMFTSDEV+S ENAWDCP+CG T     S S
Sbjct: 798 PRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASVSTSVS 852

 Score =  178 bits (452), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            ++  NFVTLP +LVIHLSRFYYDLTKKN TV+TYPLILNI+LKNN+T+KY+L+ VVNH G
Sbjct: 949  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTG 1008

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             LISGHYTSLVNK+ +H++   R +WYYFDDEVVK +  HG  S    K+SS DVYVLFY
Sbjct: 1009 TLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHG--SDKNLKISSSDVYVLFY 1066

Query: 1041 ERI 1043
            ER+
Sbjct: 1067 ERV 1069

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/870 (45%), Positives = 531/870 (61%), Gaps = 80/870 (9%)

Query: 1   MSANTTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKN 60
           M  +TT FTPEYS+ELLR V D+Y +DIK +Y  LKLE L DL++HT YL+E + D M++
Sbjct: 1   MHPHTTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRH 60

Query: 61  RNKQDALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE 120
               DALTA++IGCY+++LIIPQS QFQ RNK++ +++ LKK+YEN++NMTNV+LMVK E
Sbjct: 61  ERPNDALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKE 120

Query: 121 VDSVLDRDFRKLKDVE----RKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRS 176
           +  VLD   + +  +E    +KRAFS P   L  +++ L+L   G   P+ H     +  
Sbjct: 121 IGVVLDDSVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAG---PRGH-----LHK 172

Query: 177 DSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKH 236
            S+       + P+W APNLEPNDQLKLAL                 PE+  +P  +P+ 
Sbjct: 173 TSSTEEDADQSSPVWTAPNLEPNDQLKLAL----------------LPEVIPTP-AFPES 215

Query: 237 KSKSELTVEEK---EHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYH 293
             K+   V +    E     H  + G    +        +Q F +   DR+V HRKDSYH
Sbjct: 216 GRKTSTPVRQSVLLEDVPYTHNDNDGTSASS--------DQPFGEITADRSVTHRKDSYH 267

Query: 294 SVYMDDGDHDFGENKGATFPESE--VQAMKRLQKQSIITSPELFSILSNKKERNRLLLID 351
           SVYM D D    +N      E++  +Q+++ LQKQSIIT+PELF+ILSN+ E  +LLLID
Sbjct: 268 SVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLID 327

Query: 352 LRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLK-NSIFNKRGSFDFIV 410
           LR+  R   N I+APN+V IDP +LWD  T  PV    +L++ L+ N  F  R  F ++V
Sbjct: 328 LRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVV 387

Query: 411 YYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRV 470
            Y+D+KT+M M+FDY F+F+ L++ SQ+  L ++P+ LLGGYEKWK  L  Y  Q+ I +
Sbjct: 388 CYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISI 447

Query: 471 DDYLYRPYSSNKEGKEKSAN-----------------AKHIEPVPWKPPALPERMRNLXX 513
           DDYLYRPYS  ++ +++                    AK  EP  WKPP LP R+R    
Sbjct: 448 DDYLYRPYSQKQQQQQQQQQQQQQPSSQDSSSSKESSAKIPEPPSWKPPDLPIRLRKRPP 507

Query: 514 XXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLSQ--- 570
                T+P T E PPP+PPKI +   ++    +P    + +   V K  +   ++ Q   
Sbjct: 508 PPLPVTMPTTPENPPPLPPKIMVHPHDNFQLRQP---PIPARQHVKKQQLNSNEIIQKKR 564

Query: 571 ---------LDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATN 621
                        P  QR + +PTIE+S+N YV+LSITGLRNLG TCYINSM+QCLFA  
Sbjct: 565 QHQHQHYDQQLLQPQPQRVYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAK 624

Query: 622 MFRDLFEPSNYERFFNPELED---TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLR 678
           +FR LF  S Y+ +      +   + +LS S ++L  KMY+NGGCSVVPT FLK+ N LR
Sbjct: 625 VFRTLFISSKYKSYLQQSRGNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLR 684

Query: 679 PDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFE 738
           PD  IPDDQQD QEFLM+ +DRLHDELSNQ  V N +P LLLYDA+  KV  +EYK WF+
Sbjct: 685 PDLKIPDDQQDTQEFLMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFD 744

Query: 739 NSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGN- 797
            ++I    SPID IFQGQ+EN L CK+CG       TFY+LSLAIP+         + N 
Sbjct: 745 KNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNE 804

Query: 798 -WVNLEDCINMFTSDEVMSRENAWDCPKCG 826
             V LEDCINMFTSDEV+S ENAWDCP+CG
Sbjct: 805 KRVKLEDCINMFTSDEVLSGENAWDCPRCG 834

 Score =  180 bits (457), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            ++  NFVTLP +LVIHLSRFYYDLTKKN TVITYPLILNI+LKNN+T+KYRL+ VVNH G
Sbjct: 940  VKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTG 999

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             LISGHYTSLVNK+ +H+++  R +WYYFDDEVVK +  HG  S    K+SS D YVLFY
Sbjct: 1000 TLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG--SDKSLKISSSDAYVLFY 1057

Query: 1041 ERI 1043
            ER+
Sbjct: 1058 ERV 1060

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/872 (42%), Positives = 511/872 (58%), Gaps = 85/872 (9%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           +TPEYS+ELL+ V+D+Y  DIK +Y  LKLE L DL++H  YL+ES+   +K  N++DAL
Sbjct: 5   YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVL-- 125
           TA+IIG +++YLIIPQS QF  RNK++ ++  L+K Y+++ +MTNVLLMV  +VD++L  
Sbjct: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 126 DRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGS--TLPKMHKKWDFIRSDSNFHSH 183
            RDF   K + RKRA+S P   L +++  LTL        LP++ K+ D + + ++ ++ 
Sbjct: 125 SRDFDDTK-ITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYT- 182

Query: 184 DTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKSELT 243
                 +W AP LEP+DQLKLAL+    SS +  ++     +         +  S     
Sbjct: 183 -----TIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSIGESSSDEFEP 237

Query: 244 VEEKEHPQQDH----------RHHHGVQQ-ETHQLGKDDDEQ--HFWDAKVDRAVAHRKD 290
           +  +E    DH          RHH  V   +T +  KD  E   + +   VDR   HRKD
Sbjct: 238 IPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKD 297

Query: 291 SYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLI 350
           SYHSVYM + D D  E           Q + RLQKQ +I+  EL  IL +  ERN +LL+
Sbjct: 298 SYHSVYMLNEDDDTNEYDF-------FQNLSRLQKQYVISCEELMDILQSD-ERNNVLLV 349

Query: 351 DLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKN-SIFNKRGSFDFI 409
           DLR+  R+  N+I+APN++ IDPR LWDV+ K P++    L++++ +   F  R  F +I
Sbjct: 350 DLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYI 409

Query: 410 VYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIR 469
           VYYTDMKT++ +DFDY  VF+ L+ AS    LRS P  LLG YE+WK  + +Y     I 
Sbjct: 410 VYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIV 469

Query: 470 VDDYLYRPY-SSNKEGKEKSANAKHIEPVP------------------------WKPPAL 504
             DYL+RPY SS K  K+K      ++P+                           PP L
Sbjct: 470 TGDYLFRPYASSAKSQKDK------VKPISAPPVPATRPPPPPLPAQAPPALPSQAPPTL 523

Query: 505 PERMRNLXXXXXXATLPITKEMP----PPVPPK--IQLEQQEDKNHTRPRSRTVSSPAEV 558
           P +             P T+ +P    PP+PPK  I L          P  +  +     
Sbjct: 524 PSQA------------PPTQSIPAVHLPPLPPKSAINLHYSVATGMQPPMPQVTTVSHAH 571

Query: 559 PKNVVAPEQLSQLDSY-PMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
               ++  + SQ   Y P+  +  SVPTIE+S+N YV+LSITGLRNLG+TCYINSMLQCL
Sbjct: 572 RHRYLSHSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631

Query: 618 FATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFL 677
           FAT  FRD+F    Y  + +       ++S+SF +L +KMYMNGGCSVVP+ FLK CN +
Sbjct: 632 FATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSM 691

Query: 678 RPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWF 737
           RPDF IP+DQQD QEFL+  +D+LHDELS+  +V N +P+LLL+D +  +V  +EY +WF
Sbjct: 692 RPDFKIPNDQQDTQEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWF 751

Query: 738 ENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGN 797
           E+S+     SPID IFQGQ+EN L C++CG       TFY+LSLAIP P        K  
Sbjct: 752 EDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKK- 810

Query: 798 WVNLEDCINMFTSDEVMSRENAWDCPKCGVTV 829
            V LEDCIN+FTSDEV+S ENAWDCP+CG ++
Sbjct: 811 -VLLEDCINLFTSDEVLSGENAWDCPRCGTSM 841

 Score =  195 bits (495), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 104/123 (84%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I+  NF+T+PP+LVIHLSRF+YDLTKKN TVITYPLILNIVLKNNE  KYRLY +VNH G
Sbjct: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFG 972

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NLISGHYTSLVNK+  H++ + +Q+WYYFDDEVVK + +HG+   G+  VSS DVYVLFY
Sbjct: 973  NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032

Query: 1041 ERI 1043
            ERI
Sbjct: 1033 ERI 1035

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/919 (41%), Positives = 523/919 (56%), Gaps = 112/919 (12%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           FTPE S EL + V  +Y DDI      L+L+ L DL++HT +LYE +   +      DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
            ++I GC+++YL++PQS QF  RN+   V++ ++ LYE+QVNMTNVLLMVK+EV  VL+ 
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 128 --DFRKLKD-VERKRAFSSPDNG-LDSEISRLTLAGNGSTL---PKMHKKWDF------- 173
             D   L + + R RA+S PD   +   + +LTL     T    P+  KK          
Sbjct: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193

Query: 174 --IRSDSNF--------HSHDTG-------NVPLWKAPNLEPNDQLKLALD--SAVPSSL 214
             + SDS F        H  D+G       + PLW+AP LEPNDQLKLA +     P ++
Sbjct: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGAI 253

Query: 215 SVDTVGKEAPELSLSPLGYPKH----------------------KSKSELTVEEKEHPQQ 252
           S  +   E  ++    +GY +                        S+S +T         
Sbjct: 254 SRGSDADEEEDVDDLEIGYEEMGIYGLAHHSVAPPQHAPPPVPLSSQSPITSGGTPAAID 313

Query: 253 D----HRHHHGVQQETHQL-----GKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDGDHD 303
           D     R  H + Q T        G   D + F D   DR++ HRK+SYHSVYM +    
Sbjct: 314 DLMMRRRRTHTMTQMTPAAQTVPPGGAHD-RSFKDFTPDRSLTHRKNSYHSVYMLEESES 372

Query: 304 FGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYI 363
              N       + +Q+++RLQKQSIIT+PELFSILSN+++  +LLLIDLRL  RY  + I
Sbjct: 373 SQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKI 432

Query: 364 LAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDF 423
           +APN V IDP+MLW+ N+  P+ +I+ L+ +L N +FN+R  FD++VY++DMKT+M+++F
Sbjct: 433 IAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNF 492

Query: 424 DYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYR------- 476
           DY F F+ L+  ++   L+ +P+ LLGGYEKWK V+ +Y  Q+ I V DYL R       
Sbjct: 493 DYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVRITEGEDD 552

Query: 477 ----------PYSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKEM 526
                     PY            A      PWKP  +P  +R        A++P + ++
Sbjct: 553 TPARHDCQELPYRQQNFAGINGPGAVE----PWKPHEVPATIRKRPPPPPPASVPQSPDV 608

Query: 527 PPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQ------ 580
            P +PP+I L    D   ++ R+   S+   V   ++  ++ + L   P ++ Q      
Sbjct: 609 VPVIPPRIML----DSKVSQHRAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQEPFRS 664

Query: 581 --------FSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNY 632
                   +S+PTIE++ N YV+LSITGLRNLG TCYINSM+QCLFAT  FR+LF    Y
Sbjct: 665 ATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKY 724

Query: 633 ERFFNPELEDTGK------LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDD 686
           + F        G       +S++F +L +KMY+NGGCSVVP SFLK C+ LRPDF IPDD
Sbjct: 725 KEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD 784

Query: 687 QQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKF 746
           QQD  EFLML +DRLHDELSNQ  V+N +P+L+LYD +   VQ +EYK+WF+ S+I    
Sbjct: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844

Query: 747 SPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCIN 806
           SPID IFQGQ+EN LHC++CG       TFY+LSLAIPK         K   V+LE+C+N
Sbjct: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKR--VSLEECLN 902

Query: 807 MFTSDEVMSRENAWDCPKC 825
           M+TSDEV+S ENAWDCP C
Sbjct: 903 MYTSDEVLSGENAWDCPNC 921

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 101/123 (82%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I+  NF+ +P  L+IHLSRFYYDLTKKN T++TYPLILNIVLK+NE +KY+LY VVNH G
Sbjct: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTG 1098

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NLISGHYTS+V+K  DH L +N   WYYFDDEVVK ET HG++  GV K+SS DVYVLFY
Sbjct: 1099 NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158

Query: 1041 ERI 1043
            ERI
Sbjct: 1159 ERI 1161

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/836 (38%), Positives = 467/836 (55%), Gaps = 45/836 (5%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           ++PEYS+ELL+ V+++Y  DI  +Y  L+LE L DL++H  YL+ES+   ++ +   + L
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
           TA+++GC+++YLIIP S QF +R+K++ ++  L+K Y+++ NMTNVLLMV   ++SV  R
Sbjct: 65  TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESV-SR 123

Query: 128 DFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSHDTGN 187
           D  +   + RKRA+S P   L  ++  LTL+   ++            +++   + +  +
Sbjct: 124 DELESAKIMRKRAYSVPHKKLSDKMQALTLSPETAS-----------STNAGPETDNEND 172

Query: 188 VPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKSELTVEEK 247
             +W AP LEPND LK+ L      + SV +         +   G        E+ V   
Sbjct: 173 STMWTAPELEPNDHLKVNLGG---HNSSVSSRSSNEQAFKVGNEGNSSSSDDIEMAVHST 229

Query: 248 EHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDGDHDFGEN 307
              Q+  R    ++ E  Q          +  KVDR   HRK SYHSV+M   ++D    
Sbjct: 230 TQDQRPRRSSVPIKVEAPQNSLQSTVDDIYCQKVDRYNTHRKGSYHSVHMTGDEYD---- 285

Query: 308 KGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPN 367
              TF  +      RLQKQSIIT  +L  IL + +E  RLLL+DLR   R++ N+I+APN
Sbjct: 286 -SFTFNTA------RLQKQSIITCDKLLRIL-DSEEAERLLLVDLRFIKRFETNHIVAPN 337

Query: 368 MVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLF 427
           +V +DP  LWD      +   + L+   KN        F  IVYYTDMKT+M +DFDY  
Sbjct: 338 LVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDYQL 397

Query: 428 VFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDD-YLYRPYSSNKEGKE 486
           VF+ ++  S    +   P  LLGGYE+WK  L K + Q  + + + +L+R       GKE
Sbjct: 398 VFFQMLYTSN-WRISCTPKVLLGGYEQWKKFLAK-VPQSRVPIKEAFLFRL---KPGGKE 452

Query: 487 KSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTR 546
             A+A   +      P               A        P P+P K  + Q    + +R
Sbjct: 453 TVASAIIHQKASTPLPPSIPPPPPPVEKVSKADSGSYTRAPFPLPAKEMVIQSSLDSISR 512

Query: 547 PRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGA 606
                     ++P ++ +     ++    M   + ++PTIE+S+N+YVALSITGLRN+G 
Sbjct: 513 ---------TQIPSHLESHYTHEKVLQNKMHHAEGTIPTIEQSSNEYVALSITGLRNMGN 563

Query: 607 TCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVV 666
           TCYINSMLQCLFAT  FRDLF    YE +F+    +  +LSK F++L +KMYMNGGCSVV
Sbjct: 564 TCYINSMLQCLFATRKFRDLFLSPKYEDYFSKRYSNPHQLSKYFNILFKKMYMNGGCSVV 623

Query: 667 PTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETS 726
           PT FLK CN LRPD  IP +QQD QEFL+  + +LHDELS    V N +P LLL+D E+ 
Sbjct: 624 PTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDELSESNHVANDYPNLLLHDDESL 683

Query: 727 KVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKP 786
            V ++EY +WFE+++     SPID IFQGQ+ENGL C++CG        FY+LSLAIP  
Sbjct: 684 AVDQKEYDKWFESNISENGISPIDAIFQGQMENGLLCQRCGHSSYNYSMFYVLSLAIPAS 743

Query: 787 XXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRHNK 842
                   K   + LEDCIN+FTSDE ++ ENAWDCPKCG  V     + +++  K
Sbjct: 744 MSSFGQKKK---MRLEDCINLFTSDEKLTNENAWDCPKCGSAVSGNGPDGDKKKRK 796

 Score =  186 bits (472), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 98/123 (79%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I+  NFV+LP VL IHLSRF YDLT KN  VITYPL L+IVLKNNE + YRLYA+ NH G
Sbjct: 848  IKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNYRLYAIANHFG 907

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NLISGHYTSLVNK+  HDL N RQ+WYYFDDEV K + +HGN+  G+  VSS DVYVLFY
Sbjct: 908  NLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSVSSSDVYVLFY 967

Query: 1041 ERI 1043
            E+I
Sbjct: 968  EKI 970

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/690 (45%), Positives = 428/690 (62%), Gaps = 63/690 (9%)

Query: 149 DSEISRLTLAGNGSTLPKMH---KKWDFIRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLA 205
           ++EI  L+L  +   +   H   K      +DS+   +     P+W AP+L+PNDQLKLA
Sbjct: 236 NNEIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295

Query: 206 LDSAVPS----SLSVDTVGKEAPELSLSPLGYPKHKSKSELTVEEKEHPQQDHRHHHGVQ 261
           L + + S     L  DT+G +          Y +  SK +                    
Sbjct: 296 LGTELLSPPVMGLDGDTLGDDI---------YYETVSKGD-------------------- 326

Query: 262 QETHQLGKDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDGDHDFGEN--KGATFPESEVQA 319
            +    GKD     F D   +R + HRKDSYHS+YM D D++  +N   G+    + +Q 
Sbjct: 327 -DVSYRGKD-----FEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSN---AFIQG 377

Query: 320 MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379
           ++RLQKQSIIT+PELFSILSN +ER++LLLIDLRL  R   N+I+APN+V IDP  LWD 
Sbjct: 378 LERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDN 437

Query: 380 NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEV 439
              +P+   ++L++RL N +FN R  +D+IVYY+DMKTYM  ++DY F+ + L+  S + 
Sbjct: 438 EANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGK- 496

Query: 440 SLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYS-SNKEGKEKSANAKHIEPVP 498
            L S+P+ LLGGYEKWK V+  Y++Q+ I +DDYLYRPY+ SN +G++ +A    I  VP
Sbjct: 497 HLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNNA---QIPDVP 553

Query: 499 -WKPPALPERMRNLXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAE 557
            WKPP +P  +R         ++PI  E PPP+P KI+LE  E+   +   S+ +  PA+
Sbjct: 554 TWKPPPVPVMVRKRPPPPVPVSIPIPPETPPPLPQKIKLESIEESAPSD-NSQYIRPPAK 612

Query: 558 VPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
           +P + +   +   L       R+FS+PTIE+++N YVA S+TGLRNLG TCYIN MLQ L
Sbjct: 613 LPIHALHSPRNQTL------TRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSL 666

Query: 618 FATNMFRDLFEPSNYERF-FNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNF 676
           FATN  ++LF    Y  +   P       +S +F+ L  KMYMNGGC+VVP+ FLKICNF
Sbjct: 667 FATNELKNLFISGKYREYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNF 726

Query: 677 LRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQW 736
           LRPD  IPDDQQD QEFL+  ++RLHDELSNQ  V+N +P LLLYD +   V KE+YK+W
Sbjct: 727 LRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKW 786

Query: 737 FENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKG 796
           F+ +++    SP+D +FQGQ+EN L C++CG       TFY+LSLA+PKP        K 
Sbjct: 787 FDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKP--SAPAFYKS 844

Query: 797 NWVNLEDCINMFTSDEVMSRENAWDCPKCG 826
             V LEDCINMFTSDEV++ ENAWDCPKCG
Sbjct: 845 GRVKLEDCINMFTSDEVLTGENAWDCPKCG 874

 Score =  195 bits (496), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 108/124 (87%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I+  NF++LP VL+IHLSRFYYDLTKKN+ V++YPL+LNIVLKN E ++Y+LY++VNH G
Sbjct: 958  IKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTG 1017

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NLISGHYTSLVNK+  H+L N  Q+WYYFDDEVVK E +HGN+ +G+ KVSSK+VYVLFY
Sbjct: 1018 NLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFY 1077

Query: 1041 ERID 1044
            ER+D
Sbjct: 1078 ERVD 1081

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 98/149 (65%), Gaps = 3/149 (2%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           FTPE+S +LL  ++ IY D+I+P +  LKL+ L DL++  + + E +   + + +   A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCV-DVDTSKAV 62

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
             +I GC+++YL++P+S QFQ R+K++ ++  L+ LYE+Q+NMTNV+ MVK+EV  + ++
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

Query: 128 --DFRKLKDVERKRAFSSPDNGLDSEISR 154
             +F+  + V+  +   +   G D+ +++
Sbjct: 123 CDNFQDNEGVDDSKPLGNNLKGADNMLNQ 151

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  543 bits (1400), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 273/570 (47%), Positives = 365/570 (64%), Gaps = 23/570 (4%)

Query: 279 AKVDRAVAHRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSIL 338
           + VDR+V HRKDSYHSVYM +  ++   N G       +++++ +QKQ +IT PELFS+L
Sbjct: 444 SPVDRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLL 503

Query: 339 SNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNS 398
           SN  ER ++LLIDLR   R+  N+I+APN++ ++P++LWD  T TPV     L++ + N 
Sbjct: 504 SNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINNP 563

Query: 399 IFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAV 458
           +F+KR +F ++VYY+DMKTYM M FDYLF  + L+V      ++SLP+ LLGGYEKW  V
Sbjct: 564 LFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYKV 623

Query: 459 LKKYLTQFGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRN--LXXXXX 516
           +  Y+ Q+ I ++DY+YR  +    G+  + N K    + W PP LP R+R         
Sbjct: 624 INSYVNQYSITMNDYVYRKDAGASAGRPLNNNEKPKMEI-WTPPQLPIRIRKRAPPPPPS 682

Query: 517 XATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPM 576
               P + +MPPP+PPKI L       H  P    + SP E         Q+  LD++  
Sbjct: 683 SLPKPNSGKMPPPLPPKINL-------HGNPSLPPIHSPLE--------NQVHSLDTHKQ 727

Query: 577 R---QRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYE 633
                R FS+P +E+S N YV+LSITGLRNLG TCYINSMLQCLFAT  FR++F    YE
Sbjct: 728 NGAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYE 787

Query: 634 RFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEF 693
           ++ + ++    +LSKSF++L +KMYMNGGCSVVPT FLK CN LRPD  IPDDQQD QEF
Sbjct: 788 KYMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEF 847

Query: 694 LMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIF 753
           LML +DRLHDELSNQ EV   +P+L+ YD +  +VQ  +Y +W+  S+ +   SPID +F
Sbjct: 848 LMLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVF 907

Query: 754 QGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEV 813
           QGQ E+GL C++CG       TFYILSLAIPK         K   VNLEDCI MFT+DE+
Sbjct: 908 QGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKR--VNLEDCIKMFTNDEI 965

Query: 814 MSRENAWDCPKCGVTVQKEKSESNQRHNKQ 843
           +S ENAWDCP+CG    K++     R  K 
Sbjct: 966 LSDENAWDCPRCGSAAPKQEPIHRHREKKH 995

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I++ NFV  P +LVIHLSRFYYDLTKKN TVITYPL LNI LKN E  +Y+LY +VNH G
Sbjct: 1089 IKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYGLVNHTG 1148

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             L+SGHYTSLVNK+ DH+L + +Q+W+YFDDE+VK E +HG++  GV  +SS  VYVLFY
Sbjct: 1149 TLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSHVYVLFY 1208

Query: 1041 ERI 1043
            +RI
Sbjct: 1209 QRI 1211

 Score =  146 bits (368), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 147/281 (52%), Gaps = 78/281 (27%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           +TPEYS ELL+ V++IY ++ K HY  LKLE L DL+DH+ +L+E+++  +++ +  DAL
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
           +A+I+G +++Y IIPQSTQF  +N+ +++++ LK LYE+++NMTNVL MVK E+  +LD 
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 128 DFRKLKD-----------VERKRAFSSP----------DNGLDSEIS------------- 153
           +++   +           + R+RAFS P          D  LDS++              
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDNSMDTLNTSSTTV 189

Query: 154 -----------------------RLTLAGNGST-------------------LPKMHKKW 171
                                  R+TLA + +                    LP+ ++  
Sbjct: 190 LSNKGTSAGPSFSNNSVTPNPTFRITLAKDANNMSANGNNSNSNSGINSSLQLPR-YQYT 248

Query: 172 DFIRSDSNFHSHDTG-NVPLWKAPNLEPNDQLKLALDSAVP 211
           + + SD  +   DT  + PLW AP L+  +QLKLA D+  P
Sbjct: 249 NEVHSDVEYSIEDTDESSPLWTAPQLDSKNQLKLAPDAGNP 289

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  533 bits (1373), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 282/578 (48%), Positives = 366/578 (63%), Gaps = 37/578 (6%)

Query: 282 DRAVAHRKDSYHSVYM-DDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSN 340
           DRA  HRKDSYHS+YM DDG  D       + P   + +++RLQKQ IIT+ ELFSILSN
Sbjct: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPY--IHSLERLQKQCIITAQELFSILSN 388

Query: 341 KKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERL----K 396
             E+++LLLIDLR   R+  N+I+APN++ IDP +LW+  T TP+ DI+ L+  L     
Sbjct: 389 PIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKA 448

Query: 397 NSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQ-EVSLRSLPSYLLGGYEKW 455
             +   R  F++IV+YTD KTYM  +FDY F F+ L+V S+   +++S P++LLGGY+KW
Sbjct: 449 RKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKW 508

Query: 456 KAVLKKYLTQFGIRVDDYLYRPYSSNKEG---KEKSANAKHIEPVPWKPPALPERMRN-- 510
           K VL  Y  Q+   + DYLY+P+  + +     +   ++  ++P  WKPP LP RMR   
Sbjct: 509 KKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHDDLVDSHILQPPSWKPPELPLRMRKRP 568

Query: 511 ------------LXXXXXXATLP---ITKEMPPPVPPKIQ----LEQQEDKNHTRPRSRT 551
                       +      +TLP    T E  P +  K +    L   + + H      +
Sbjct: 569 PPPPPVAIPTPPVPHLLTNSTLPPISSTTEQSPGIVLKTKTMTDLHSTKSQQHRNQYLTS 628

Query: 552 VSSPAEVPKNVVAPEQLSQLDSYPM--RQRQFSVPTIERSNNKYVALSITGLRNLGATCY 609
                E+ ++     +  Q     M  R R+FS+PTIE+S N YV+LSITGLRNLG TCY
Sbjct: 629 YQHQVELARDDETRRKYHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCY 688

Query: 610 INSMLQCLFATNMFRDLFEPSNYERFFN-PELEDTGKLSKSFSVLIRKMYMNGGCSVVPT 668
           INSMLQCLFAT +FRDLF  S ++ F N  +  +T K+S SF++L +KMY+NGGCSVVPT
Sbjct: 689 INSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPT 748

Query: 669 SFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKV 728
           SFLK CN LRPD  IPDDQQD QEFLM+ +DRLHDELSNQ EV+N +P LLLYD    KV
Sbjct: 749 SFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKV 808

Query: 729 QKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXX 788
           Q +EYK WF+ ++I    SPID IF GQ+EN L C++CG       TFY+LSLAIPKP  
Sbjct: 809 QNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSS 868

Query: 789 XXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCG 826
                 K   V LE+CINMFTSDEV+S ENAWDCPKCG
Sbjct: 869 TTFSRSKR--VKLEECINMFTSDEVLSGENAWDCPKCG 904

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 91/123 (73%), Positives = 107/123 (86%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I+  NF+ LPP+LVIHLSRFYYDLTKKN TVITYPLILNIVLKNNE  KYRLY +VNH+G
Sbjct: 981  IKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSG 1040

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NLISGHYTSLVNK  +HDL + +Q+WYYFDDE VK E +HG++ +G+ +VSS+DVYVLFY
Sbjct: 1041 NLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFY 1100

Query: 1041 ERI 1043
            ERI
Sbjct: 1101 ERI 1103

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 141/226 (62%), Gaps = 29/226 (12%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYE-SFSDEMKNRNKQDA 66
           FTPEYS+ELL+ V+ IY DDIK +Y  LKLE L DL++HT YL E  F+    N N +D 
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 67  LTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLD 126
           LTA+I+GCY+L+LIIPQS QFQ++NK++ ++  LKKLYEN+ +MTNVLLMVKDE+++VLD
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 127 RDFR------KLKDVERKRAFSSPDNGLDSEISRLTLAG--------------------N 160
            D          + ++R+RA+S   N L +++  L+++                     N
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 161 GSTLP-KMHKKWDFIRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLA 205
              LP  +H   +F   + N    D  + PLW AP+LEP DQLKLA
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRAS-PLWTAPSLEPKDQLKLA 233

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  499 bits (1286), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/463 (54%), Positives = 305/463 (65%), Gaps = 27/463 (5%)

Query: 583  VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELED 642
            VPTIE++ N YV+LSITGLRNLG TCYI+SMLQCLFAT   RDLF  + YE + N ++ D
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 643  TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLH 702
               LS+SFS+L RKMY+NGGCSVVP SFLK CN LRPD  IPDDQQD QEFLML +DRLH
Sbjct: 669  KINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLH 728

Query: 703  DELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLH 762
            DELS +  VLN +  LLLYDAE   V+ ++YK+WFENS ++   SPID IFQGQ+EN ++
Sbjct: 729  DELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSIN 788

Query: 763  CKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDC 822
            C++CG       +FY+LSLAIPK         + N V LEDCINMFT DEV+S ENAWDC
Sbjct: 789  CQRCGYSSFNYSSFYVLSLAIPK--ISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDC 846

Query: 823  PKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLFPRKRX 882
             +CG         S+  H+K+          + RK+              +  L P+K  
Sbjct: 847  SRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKS--------------RLFLLPKK-- 890

Query: 883  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHLSRFYY 942
                                                  I++ NF+ +P +LVIHLSRF+Y
Sbjct: 891  --------YNPTSRSLSPFGRHSSHKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFY 942

Query: 943  DLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLEN 1001
            D++KKNETV+ YPLILNIVLKN E  KYRLYA+VNH GN + SGHYT+LVNKNR+HDL  
Sbjct: 943  DMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGK 1002

Query: 1002 NRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
            N QQWYYFDDEVVKHE +HGN+ +GVNKVSS  VYVLFYE+ID
Sbjct: 1003 NEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKID 1045

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  445 bits (1144), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/431 (51%), Positives = 275/431 (63%), Gaps = 30/431 (6%)

Query: 613  MLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLK 672
            M+QCLF T + RDLF  S YE++ +  ++ +  LS+SFS+L +KMY+NGGCSVVPTSFLK
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFLK 60

Query: 673  ICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEE 732
             CN LRPD  IPDDQQD QEFLML +DRLHDELSNQ  V   +P+L+LYD    +V  +E
Sbjct: 61   TCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNKE 120

Query: 733  YKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXX 792
            Y +WF+ ++     SPID IFQGQ+EN L C++CG       TFY+LSLAIPKP      
Sbjct: 121  YSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTFS 180

Query: 793  XXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQRHNKQXXXXXXXXX 852
              K   V LEDCINMFT+DEV+S ENAWDC  CG         S+  HN +         
Sbjct: 181  RSKR--VKLEDCINMFTNDEVLSGENAWDCSNCG---------SSSVHNVEQRKDKTTGN 229

Query: 853  PEPRKAKKKDEEGSSLKSKTKFLLFPRKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 912
             E +K  +          K++  L P                                  
Sbjct: 230  GEEKKRSR----------KSRLFLLPN---------INGRSSRSISPFRKSASPRPPHEK 270

Query: 913  XXXXXXXXIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRL 972
                    I++ NF++LPP LVIHLSRFYYDL+KKNET++TYPLILNIVL NNET KYRL
Sbjct: 271  LKHKKLVTIKSMNFISLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRL 330

Query: 973  YAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            Y +VNH GNLISGHYT+LVNK ++H+L+ ++Q+WYYFDDEVVK E +HGN+ +GV KVSS
Sbjct: 331  YGIVNHTGNLISGHYTTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSS 390

Query: 1033 KDVYVLFYERI 1043
              VYVLFYER+
Sbjct: 391  SQVYVLFYERV 401

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  404 bits (1037), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 209/468 (44%), Positives = 278/468 (59%), Gaps = 39/468 (8%)

Query: 579  RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638
            + +++P IE SN+    LSITGL+N   TCYINS++QCLF T +FRDLF    Y  F N 
Sbjct: 278  KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337

Query: 639  -ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLT 697
             +     +LS+S  VL +KMY+NGG +++P  FLK+C  LRPD NIPDDQQD QEFL++ 
Sbjct: 338  NKYPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIV 397

Query: 698  IDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQL 757
            + R+H+ELSN+  V+  +P+L+ YDA   +V   +Y++W+E ++I    SPID I++GQL
Sbjct: 398  LARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQL 456

Query: 758  ENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRE 817
            EN L C++CG       TFY+LSLAIPK         K   + LEDCIN+FT DE +S +
Sbjct: 457  ENILKCQRCGNSSYSYSTFYVLSLAIPK-LSLYSFTSKSRKIKLEDCINLFTGDEELSGD 515

Query: 818  NAWDCPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLF 877
            NAWDCP C +T  K K                           K+E  S  K  T F   
Sbjct: 516  NAWDCPNCRITDSKSK---------------------------KEEITSQKKKSTIFGFH 548

Query: 878  PRKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHL 937
             R R                                       I++ +F+ LPP+LVIHL
Sbjct: 549  SRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTT--------IKSLDFIVLPPILVIHL 600

Query: 938  SRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDH 997
            SRFYYDLTKKN TVITYPLILNI+LKN + ++Y+LY  VNH+GNLI+GHYTS+VNK + H
Sbjct: 601  SRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSH 660

Query: 998  DLENNRQQWYYFDDEVV-KHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
            ++  NRQ W  FDD+ + +H     N   G  ++SS +VYVLFYER+D
Sbjct: 661  EIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMD 708

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 93/147 (63%), Gaps = 4/147 (2%)

Query: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIGC 74
           ++L LV  +YE DIK  Y+ L+L++L  L+DH  +L+  +  +++   + +ALTA+IIGC
Sbjct: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66

Query: 75  YFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFRK--- 131
           Y+LYLIIPQS QFQ RN  +  +  LK  Y+++  M  VL +V+DE   ++DR   +   
Sbjct: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNG 126

Query: 132 -LKDVERKRAFSSPDNGLDSEISRLTL 157
             + ++RKRA+S P   L   ++ L++
Sbjct: 127 ICRTIKRKRAYSLPLRPLPVHMASLSI 153

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  402 bits (1032), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/465 (46%), Positives = 273/465 (58%), Gaps = 32/465 (6%)

Query: 579  RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638
            + F +P IE S+N    LSITGLRN   TCYINSM+QCLF+T +FRDLF    Y+ F   
Sbjct: 276  KTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLEN 335

Query: 639  ELEDTG-KLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLT 697
            E    G +LS S  VL +KMY+NGG +++P  FLK+C  LRPD NIPDDQQD QEFLM+ 
Sbjct: 336  EKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMII 395

Query: 698  IDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQL 757
            + R+H+ELSN   V   + +L+L DA   +V   +Y++W E ++++   SPID IFQGQ+
Sbjct: 396  LARIHEELSNNN-VTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQM 454

Query: 758  ENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRE 817
            EN L C++CG       TFY+LSLAIPK         K   + LEDCIN FTSDE +S +
Sbjct: 455  ENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTS-KSKKIKLEDCINFFTSDEELSDD 513

Query: 818  NAWDCPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLF 877
            NAWDCPKC     K                            KKDE  S  K    F L 
Sbjct: 514  NAWDCPKCRTAEYK---------------------------LKKDENLSQKKRSILFNLH 546

Query: 878  PRKRXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIH 936
             R R                                        I++ +F+ LPP+LVIH
Sbjct: 547  SRPRSKSPRHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIH 606

Query: 937  LSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRD 996
            LSRFYYDLTKKN TVITYPLILNI+LKNN+ ++Y+LYA VNH+GNLI+GHYTS+VNK + 
Sbjct: 607  LSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKS 666

Query: 997  HDLENNRQQWYYFDDEVVK-HETSHGNLSQGVNKVSSKDVYVLFY 1040
            H++  NRQ W  FDD+V+K H     +   G  ++SS +VYVLFY
Sbjct: 667  HEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 95/148 (64%), Gaps = 4/148 (2%)

Query: 14  SELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIG 73
           +++L LV ++Y+ DIK  Y+ L+L+ L  L++H  YL++ +  ++KN  K++ALTA+I+G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 74  CYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDE----VDSVLDRDF 129
            ++LYL+IP S QFQ RN  +  +  LK  Y+++  M+ VL +VKDE    VD  L    
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 130 RKLKDVERKRAFSSPDNGLDSEISRLTL 157
           R  + ++RKRA+S P   L   ++ L++
Sbjct: 126 RISRSMKRKRAYSLPLRPLPVHMASLSI 153

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  398 bits (1023), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 209/464 (45%), Positives = 275/464 (59%), Gaps = 40/464 (8%)

Query: 583  VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE-LE 641
            +PTIE S +    LSITGL+N   TCYINS++QCLF T +FRDLF    Y  F   +   
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 642  DTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
               +LS+S  VL +KMY+NGG ++ P  FLK+C  LRPD NIPDDQQD QEFL++ + RL
Sbjct: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406

Query: 702  HDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761
            H+ELSN T V   +P+L+ YDA   +V   +Y++W+E S++    SPID IF+GQ+EN L
Sbjct: 407  HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465

Query: 762  HCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWD 821
             C++CG       TFY+LSLAIPK         K   + LEDCIN+FTSDE +S +N+WD
Sbjct: 466  KCQRCGNSSHSYSTFYVLSLAIPK-ISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524

Query: 822  CPKCGVTVQKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLF-PRK 880
            CP CG T                              K K  E +S K K+ F  F  R 
Sbjct: 525  CPNCGTT----------------------------DLKTKINESTSQKKKSTFFSFHSRS 556

Query: 881  RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHLSRF 940
            R                                       +++++F+ LPP+LVIHLSRF
Sbjct: 557  RSKSPHHHHHHHHHSHDNTEKHSKKWNSRKLTT-------VKSSDFIVLPPILVIHLSRF 609

Query: 941  YYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLE 1000
            YYDLT+KN TVITYPLILN++LKNN+ ++Y+LY  VNH GNL++GHYTS VNK ++H++ 
Sbjct: 610  YYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIG 669

Query: 1001 NNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
             NRQ W  FDD+ +K    H +   G  +VSS +VYVLFYER+D
Sbjct: 670  LNRQVWITFDDDYIKQH-HHDDFEAGKTEVSSSEVYVLFYERMD 712

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 94/147 (63%), Gaps = 4/147 (2%)

Query: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIGC 74
           +++ LV ++YE DIK  Y+ L+L++L  L+DH  +L+E +  + +   + +ALTA+IIG 
Sbjct: 7   QVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGG 66

Query: 75  YFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDF----R 130
           Y+LYL+IPQS QFQ RN  +  +  LK  Y+++  M+ VL +VK+E + ++DR      R
Sbjct: 67  YYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSNR 126

Query: 131 KLKDVERKRAFSSPDNGLDSEISRLTL 157
             + + RKRA+S P   L   ++ L++
Sbjct: 127 ISRTITRKRAYSLPLRPLPVHMASLSI 153

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  358 bits (919), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/564 (38%), Positives = 303/564 (53%), Gaps = 57/564 (10%)

Query: 320 MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379
           + RL + S I   +L  IL +  + +R+L IDLR   RY+ N+I+A +++ IDP +LWD 
Sbjct: 441 LTRLYETSSIKCSDLMIILESDIQ-DRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499

Query: 380 NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEV 439
               P+T ++  + RL N +F  RG F ++V YTD  T M MDF +   F+ LV   +  
Sbjct: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKP- 558

Query: 440 SLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPW 499
             R L   L GGY++W+  LK        ++ D+++R   +N  G++ S +  +  P   
Sbjct: 559 --RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWR---ANFLGRDTSVSDHN--PFRA 611

Query: 500 KPPALPERMRNLXXXXXXATLPITKEMPPPVP------PKIQL----------------- 536
            PP    R            +      P PVP      P + L                 
Sbjct: 612 TPPVPTARPPVPPLPTAPPPVAPYISSPRPVPFIPLQQPSLSLLHTSANIVKPGKAELRN 671

Query: 537 -------------EQQEDKNHTRPRSRTVSSPAEV--PKNVVAPEQLSQLDSYPMRQRQF 581
                          Q +K    P SR    P E   PK+    E+     S    +  F
Sbjct: 672 ELSRITGQIDHTQYNQPEKYRYLPDSRESPYPIEYEDPKHT---ERSRGWLSAGSSEAHF 728

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELE 641
           SVPTIE++ N+Y+ALSITGLRN+  TCYINSMLQCLF+T  FR+LF  + Y R+      
Sbjct: 729 SVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNM 788

Query: 642 DTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
           D   +S+SF +L +KMYMNGGCSVVP+ FLK+C++L+PD  IP  QQD QEFL+  +DRL
Sbjct: 789 DN--MSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRL 846

Query: 702 HDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761
            DELS    V+N +P+LLL+++   KV  +EY  WF+ +      SPID IFQGQ+E+ L
Sbjct: 847 RDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906

Query: 762 HCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWD 821
            C++C        TFY+LSLA+P P        K   + LEDCIN FT DEV++ +N WD
Sbjct: 907 SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKK--LRLEDCINFFTCDEVLTGQNPWD 964

Query: 822 CPKCGVTVQKEK---SESNQRHNK 842
           CPKCGV    ++   SE ++R NK
Sbjct: 965 CPKCGVNSSGDRQMNSEKSKRKNK 988

 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (82%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I++ NF+TLP +L+IHLSRF YDLTKKN TV+TYPLILNIVLKNNE  KYRLY+ +NH G
Sbjct: 1046 IKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFG 1105

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             LISGHYTSLVNK+  H++   +Q+WYYFDDE+VK + +HGN  +G+  VSS DVY+LFY
Sbjct: 1106 TLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFY 1165

Query: 1041 ERI 1043
            ERI
Sbjct: 1166 ERI 1168

 Score =  127 bits (318), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 114/212 (53%), Gaps = 32/212 (15%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           + PEYSSEL   V++ YE  ++  Y  L+ E L DL++    L+ES+ D ++    ++ L
Sbjct: 5   YIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGL 64

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
            AY+IG ++LYLIIPQS +F  RN ++ ++  L+K YE + NMTNV+ MV ++VD+VL R
Sbjct: 65  MAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLR 124

Query: 128 DF-----RKLKDVERKRAFSSPDNGL---DSEISRLTLAGN--------GSTLPKMHKKW 171
                  R    + RKRA+S P+ G+      +  LT+ G         G  +P++  + 
Sbjct: 125 QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEVAVQA 184

Query: 172 DFIRSDSNFHSHDTGNVPLWKAPNLEPNDQLK 203
           D                 LW AP LE ND L+
Sbjct: 185 D----------------TLWSAPKLEENDLLR 200

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  339 bits (870), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 206/519 (39%), Positives = 304/519 (58%), Gaps = 55/519 (10%)

Query: 5   TTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQ 64
           ++ FTPEYS+EL   V+DIY++DIKP    L+L  L DL++HT YL E+F   + +    
Sbjct: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67

Query: 65  DALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSV 124
           DAL+AYI+GCY+LYLIIPQSTQFQ +NK++ ++N  K LY+N+ NMTNV  MV++EVDS+
Sbjct: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127

Query: 125 LDRDFRK----LKDVERKRAFSSPD------NGLDSEISRLTLAGNGSTLPKMHKKWDFI 174
           LD+ +++     + + R RAFS  D      N ++  I     +     L  M K +D +
Sbjct: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPL-SMAKPYDSL 186

Query: 175 RSDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYP 234
             + +       + PLW AP+L PNDQLKLAL               E PEL+L      
Sbjct: 187 PMELD------DSTPLWTAPSLNPNDQLKLAL---------------EQPELTLD----- 220

Query: 235 KHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLG---KDDDEQHFWDAK------VDRAV 285
                 E   ++ +H   D ++++      HQ+    K  D  H  D K      VDR+ 
Sbjct: 221 ------EQLSDKTQHNLIDDKYNNFTIPLPHQIPLPVKVTDFNH--DKKIQKIYPVDRSE 272

Query: 286 AHRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERN 345
            HRKDSYHSVYMD+ D+  G  +      + +Q ++RLQKQ++IT PELFSILS+   ++
Sbjct: 273 THRKDSYHSVYMDN-DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKD 331

Query: 346 RLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGS 405
            +LLI L L  R K NYI+A N + IDP +LWD     P+++ + L++ L + +FN R S
Sbjct: 332 DILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKS 391

Query: 406 FDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQ 465
           F ++VYYTD+KTYM+++FDY F  + L+ +S+   L++ P+ LLGG EKWK V++ Y  +
Sbjct: 392 FAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHE 451

Query: 466 FGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPAL 504
            GI   +YL++ +  N + KE   +   +E   W  P +
Sbjct: 452 NGINALNYLHKFHVHNIDQKEGDRSNIGVEHYFWNAPEI 490

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  341 bits (874), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/509 (38%), Positives = 285/509 (55%), Gaps = 50/509 (9%)

Query: 320 MKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDV 379
           +K L ++  IT  ELFSILSN  +R ++L+IDLRL   +    I +PN++  DP  LW+ 
Sbjct: 206 LKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNN 265

Query: 380 NTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYMEMD-FDYLFVFYNLVVASQE 438
             +TPV   + L     N +F K   F +I+ Y+D +T    + F+Y F F+ L+++S  
Sbjct: 266 RDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSS-- 320

Query: 439 VSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVP 498
            S++  P++LLGG+EKW+ ++  Y  Q+GI   +Y++   ++NK   E  +      P  
Sbjct: 321 -SMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF---TNNKRFTEPPSWNPPPVPHE 376

Query: 499 WKPPALPERMRNLXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEV 558
            +    P    NL                   P +    +       + + +        
Sbjct: 377 IRKRPPPPPPPNL-------------------PSRTYSTRHTQGYREQQQQQQQHHHNHR 417

Query: 559 PKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLF 618
           PK +V             R  ++ +P +  S+N YV LSI+GLRNLG TCYINSMLQCLF
Sbjct: 418 PKRIVT------------RYTKYGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLF 465

Query: 619 ATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLR 678
           AT  FR+LF  + Y+ +   +++    LS SF +L RKMY+NGGC+V+P  FLK CNFLR
Sbjct: 466 ATTAFRNLFLSNRYKEYIGTKVD--PHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLR 523

Query: 679 PDFNIPDDQQDAQEFLMLTIDRLHDEL-SNQTEVLNAHPELLLYDAETSKVQK-EEYKQW 736
           PD  IPD QQD QEFL+L +D+LH+EL SNQ  +++ HP+L+ YD ++  V+   EYK+W
Sbjct: 524 PDLRIPDVQQDTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKW 583

Query: 737 FENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKG 796
           F  SL N   S I +IFQGQLEN L C++C         F  LSL+IP            
Sbjct: 584 FAESLENEGLSLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKFRK---- 639

Query: 797 NWVNLEDCINMFTSDEVMSRENAWDCPKC 825
             V+LEDCI++F  +E+++ ENAW+CPKC
Sbjct: 640 -LVDLEDCISLFIENEMLTGENAWNCPKC 667

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 1/123 (0%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-LTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            ++T+F+ LP +L+IHLSRF    L  KN T I YP IL I LKN E  +++LY VVNH G
Sbjct: 722  KSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFKLYGVVNHFG 781

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            NL +GHYTSL+NK   HDL   RQ+W+YFDDE VK + ++ +L + VN++SS DVYVLFY
Sbjct: 782  NLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRISSSDVYVLFY 841

Query: 1041 ERI 1043
            E+I
Sbjct: 842  EKI 844

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 93/198 (46%), Gaps = 50/198 (25%)

Query: 13  SSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYII 72
           S EL +LV  IY   IKP Y  L      DL+++T  L+E F      +   D+L ++II
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL-----KGNTDSLDSFII 67

Query: 73  GCYFLYLIIPQSTQF--QARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFR 130
           G +++ L+IP S      + N    ++  LKK YE+Q N++++L +++ E +++L + F 
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL-QSF- 125

Query: 131 KLKDVERKRAFSS--PDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSHDTGNV 188
              DV+   + S    DN  DS  +                                   
Sbjct: 126 ---DVDAPSSHSQHEEDNTADSSTT----------------------------------- 147

Query: 189 PLWKAPNLEPNDQLKLAL 206
            +W+AP LEPNDQLKLA+
Sbjct: 148 -IWQAPFLEPNDQLKLAI 164

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  283 bits (725), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/247 (53%), Positives = 171/247 (69%), Gaps = 6/247 (2%)

Query: 580  QFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF-NP 638
             FS+PTIE S N+YVALSITGLRN+  TCYINSMLQCLF+T+ FR+LF  + Y  +  +P
Sbjct: 1086 HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP 1145

Query: 639  ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTI 698
            E++    +S+SF +L RKMYMNGGCSVVP+ FLK+CN L+PD  IP  QQD QEFL+  +
Sbjct: 1146 EMD---TMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLL 1202

Query: 699  DRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLE 758
            D+LHDELS+   V N +  LLL+D     V   +Y +WF+ ++     SPID +FQGQ+E
Sbjct: 1203 DKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQME 1262

Query: 759  NGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSREN 818
            N L C++CG       TFY+LSLA+P P        K   + LEDCIN FT DEV+S +N
Sbjct: 1263 NQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKK--LRLEDCINFFTCDEVLSDQN 1320

Query: 819  AWDCPKC 825
            AWDCP+C
Sbjct: 1321 AWDCPRC 1327

 Score =  217 bits (552), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 156/489 (31%), Positives = 262/489 (53%), Gaps = 44/489 (8%)

Query: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67
           + PEYS EL + VE++Y ++++  Y  L+LE L DL++H  YL ES+ + +     +  +
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64

Query: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127
           TAY++G ++LYLIIPQS +F  RN ++ ++  LK+ YE+  NM NV+L+V  +V SV+  
Sbjct: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124

Query: 128 DFRKLKD-------VERKRAFS--SPDNG-LDSEISRLTL---AGNGSTL-PKMHKKWDF 173
                 D         RKRA+S  S D+  L   + +L++   +  G+T+     ++  F
Sbjct: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184

Query: 174 IRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGY 233
            +   +    DT    +W APNLEP+DQLKLA+  +   S+  DT   +  +  L     
Sbjct: 185 GQQQQDDEWEDT----VWSAPNLEPDDQLKLAVSYSHSPSIH-DTSDSKTKDSGL----- 234

Query: 234 PKHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDR--AVAHRKDS 291
            ++ S +E +V ++E   +      G   ++ Q+   D++ +      D   ++    D 
Sbjct: 235 -ENNSAAEFSVLDEEWVSE---RRSGFMSQSLQVDSSDNKNN------DELPSIGDHNDV 284

Query: 292 YHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLID 351
               Y    D  +        P  E  ++  L + S I   +L S L++  ER+ +LLID
Sbjct: 285 LDRFYTHGQDLRYPICNDGVVP-CENSSIMWLYESSSIKCLDLLSKLTS-SERSSMLLID 342

Query: 352 LRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVY 411
           LRL  RY++++ILA N++ IDP +LWD     PV+ +  L+  + N +F  R  F  IV 
Sbjct: 343 LRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVC 402

Query: 412 YTDMKTYMEMDFDYLFVFYNLV-VASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRV 470
           YTD  TYM++DFD++F+ + L+ +   ++ L++L     GGYE+WK+ LK+      I +
Sbjct: 403 YTDNYTYMQIDFDFVFLLFRLLYLGRPQLVLKTLS----GGYEQWKSFLKELKRTESIIL 458

Query: 471 DDYLY-RPY 478
            D+L+ RP+
Sbjct: 459 SDFLWKRPH 467

 Score =  181 bits (459), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 103/123 (83%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            +++ NF+T+P +LVIHLSRF YDLTKKN  V++YPLILNIVLKN+E  K+RLY++VNH G
Sbjct: 1393 VKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFG 1452

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             LISGHYTSLVNK  +H++ + +Q+WYYFDDE+VK +T+HG+   G+  VSS +VYVLFY
Sbjct: 1453 TLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFY 1512

Query: 1041 ERI 1043
            ERI
Sbjct: 1513 ERI 1515

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  250 bits (638), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 165/264 (62%), Gaps = 3/264 (1%)

Query: 581 FSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF-NPE 639
           F  PTIE S      LSITGL+N   TCYINS++QCLF +  FRDLF    Y  F    E
Sbjct: 274 FEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEE 333

Query: 640 LEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTID 699
                +LS+S   L +KMY NGG ++VP  FLK+C  LRPD NIPDDQQD QEFL++ + 
Sbjct: 334 YPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 393

Query: 700 RLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLEN 759
           R+H+ELSN+  V   + +L+ YD    +V   +Y++W+E +++    SPID IF+GQ+EN
Sbjct: 394 RIHEELSNEN-VTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMEN 452

Query: 760 GLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENA 819
            L C++CG       TFY+LSLAIPK         K   + LEDCIN+FTSDE ++ +NA
Sbjct: 453 ILKCQRCGNSSFSYSTFYVLSLAIPK-NSVHSFTSKSKKIKLEDCINLFTSDEELTGDNA 511

Query: 820 WDCPKCGVTVQKEKSESNQRHNKQ 843
           WDCP+C +   K K+  N    K+
Sbjct: 512 WDCPECRIDDSKLKTGENSSQKKR 535

 Score =  167 bits (423), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 1/125 (0%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I++ +F+ LPP+LVIHLSRFYYDLTKKN  VITYPLILNI+LKNN+ ++Y+LY  VNH+G
Sbjct: 579  IKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSG 638

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDE-VVKHETSHGNLSQGVNKVSSKDVYVLF 1039
            NLI+GHYTS+VNK R H++  N+Q W  FDD+ +++H         G  K+SS +VYVLF
Sbjct: 639  NLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLF 698

Query: 1040 YERID 1044
            YER+D
Sbjct: 699  YERMD 703

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 97/156 (62%), Gaps = 4/156 (2%)

Query: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIGC 74
           ++L LV D+YE DIK  Y+ L+L++L  L+DHT +L++ +  +++   + +ALTA+IIG 
Sbjct: 7   QILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIGG 66

Query: 75  YFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDF----R 130
           Y+LYLIIPQS QFQ R+  +  +  LK  Y+++  M+ VL +V+DE  S++D+      R
Sbjct: 67  YYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSNR 126

Query: 131 KLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPK 166
               + RKRA+S P   L   ++ L++       P+
Sbjct: 127 ITVTITRKRAYSLPLRPLPVHMASLSIHNQSDDPPR 162

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  233 bits (593), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 176/289 (60%), Gaps = 15/289 (5%)

Query: 550 RTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCY 609
           RT+S+P     + +  E LS + + P   ++ +VP I+ ++N    LS+ GLRN G TCY
Sbjct: 191 RTLSTPKR--SSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGLRNQGNTCY 248

Query: 610 INSMLQCLFATNMFRDLF-EPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPT 668
           INSM+QCLF T + RDLF     Y+ F   + E   K+S+ F+ L+  MY NGG SV+P 
Sbjct: 249 INSMVQCLFGTKVLRDLFISEXXYKDFIKKDAE--TKISEPFARLLLTMYENGGTSVIPK 306

Query: 669 SFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKV 728
           +FL+  + LRPD NIP DQQD QEFL++ +D LHDEL    ++++ +     Y ++   +
Sbjct: 307 NFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNN-----YVSDDINL 361

Query: 729 QKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXX 788
            K EY  W +N+L     SPID IFQGQ+EN L C++CG        FY+LSLAIPK   
Sbjct: 362 GK-EYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPK--- 417

Query: 789 XXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESN 837
                   N V LEDCIN FTSDE+++ ENAW+CPKC  T  +   E++
Sbjct: 418 -IAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEAD 465

 Score =  150 bits (378), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 96/131 (73%), Gaps = 7/131 (5%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNN-ETLKYRLYAVVNHN 979
            ++  NF+ LPP+LVIHLSRFYY+ TKKN  VITYPLILNI++KNN + +KY+LY ++NH 
Sbjct: 526  LKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQ 585

Query: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG------VNKVSSK 1033
            G L  GHYTS+VNK+ +H L+ N QQWY FDDEV+K   S+  +++        ++  S 
Sbjct: 586  GGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSS 645

Query: 1034 DVYVLFYERID 1044
             VYVLFYERI+
Sbjct: 646  KVYVLFYERIE 656

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 95/155 (61%), Gaps = 6/155 (3%)

Query: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFS--DEMKNRNKQDALTAYII 72
           +L  LV+ I++ DIK +Y  L+LE L+DL+DHT YL + F      K+R +Q  L A++ 
Sbjct: 29  DLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATL-AFVN 87

Query: 73  GCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDFRKL 132
           G ++L+LIIP   QFQ +NK F  +  LK  YE Q++M N+L  VK++  S+L++D   +
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147

Query: 133 -KDVERKRAFSSPD--NGLDSEISRLTLAGNGSTL 164
            + + +KRA++ P   +GL  + S  ++     TL
Sbjct: 148 NRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTL 182

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  207 bits (528), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 143/247 (57%), Gaps = 2/247 (0%)

Query: 579 RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638
           +Q+++P I  +  +   LS+ G+RN+G TCY+NSMLQCLF +  FRDLF    +E F   
Sbjct: 193 KQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAE 252

Query: 639 ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTI 698
              ++  ++   S+L +KMY NGGC+++P SF++ C  LRPDF IP  QQD QEFLM  +
Sbjct: 253 TNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVL 312

Query: 699 DRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLE 758
           +RL  EL+N +  +     +          + + Y +W+   +     SPID +F+G +E
Sbjct: 313 ERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDVE 372

Query: 759 NGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSREN 818
           + L CK C        +FYILSL IPK         K   + LEDCIN+FT  E+++ EN
Sbjct: 373 SKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKT--IRLEDCINLFTRKEILTGEN 430

Query: 819 AWDCPKC 825
           +W CP C
Sbjct: 431 SWACPSC 437

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 84/123 (68%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG 980
            I + +FV+LPP+LVIHLSRF YD++KKN + I+YP+ L +   +N ++ YRLY  +NH G
Sbjct: 509  ILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINHIG 568

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            +   GHYT+LVNK ++H  +   Q+W  FDD++V + T        +N +++ D YVLFY
Sbjct: 569  SPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVLFY 628

Query: 1041 ERI 1043
            ERI
Sbjct: 629  ERI 631

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 14  SELLR-LVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYII 72
           +E+L+ LV  ++E  IK  Y VL L  +  L+       +      + +  + +   Y  
Sbjct: 10  TEILKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAA 69

Query: 73  GCYFLYLIIPQSTQFQARNKTFQVHNALKKLY 104
           GC+++YL++P + QFQ  +  +  +  LK  Y
Sbjct: 70  GCFYIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 132/528 (25%), Positives = 216/528 (40%), Gaps = 68/528 (12%)

Query: 347 LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKN-SIFNKRGS 405
           LLLID+R +S +   +I   N++ IDP    D  T   +  +S++     + + F+ R  
Sbjct: 163 LLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNRDK 222

Query: 406 FDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPS----YLLGGYEKWKAVLKK 461
           F FI+ YTD  T +  +F          + SQ   ++ L       L  G+  W  +   
Sbjct: 223 FKFIILYTD--TQLHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLGGA 280

Query: 462 YLTQFGIRVDDYLYRPYSSNKEGKEKSA----NAKHIEPVPWKP-PALPERMRNLXXXXX 516
           Y  Q  +    +L    S+   G  +      N K + P   K  P +    + L     
Sbjct: 281 Y--QSSVSETAHLTSSSSTPAFGSPQVPTGLFNQKSLSPNKDKSMPMVSMNTQPLLTTVQ 338

Query: 517 XATLPITKE----MPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLS--- 569
              LP+       +P P P +     Q+   H       +++P+ +       E++S   
Sbjct: 339 RPQLPLYYSDLPIIPQPSPNRNSPTVQKFSPHPPTTLSKLNTPSTIQNKANTVERISPDI 398

Query: 570 ---QLDSY-PMRQRQFS-----VPTIERSNNKYVALS---------ITGLRNLGATCYIN 611
              Q  +Y P     FS     +P    S+++   L+         I GL N+G  CY+N
Sbjct: 399 RAAQAHAYLPPASNVFSPRIPPLPQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYMN 458

Query: 612 SMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRKMYMNGGCS----- 664
            +LQCL  T+    +F  + Y  F  F+      G L+K+F++L+  M+ +G  +     
Sbjct: 459 CILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVR 518

Query: 665 ---VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLY 721
              V    F KIC  + P ++    QQD QEF    +D LH++L+        H + L  
Sbjct: 519 TIPVQTIQFKKICGHINPMYS-DSMQQDCQEFCQFLLDGLHEDLNQNGS--KKHLKQLSD 575

Query: 722 DAETSK----VQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFY 777
           + E  +    ++K    +W     + T FS I  +FQGQ  + L C+ C        TF 
Sbjct: 576 EEERMREKMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFS 633

Query: 778 ILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           +LS+ +P+              N+ DC   FT  E +  +  W CPKC
Sbjct: 634 VLSVPVPRVKT----------CNILDCFREFTKCERLGVDEQWSCPKC 671

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (45%), Gaps = 34/134 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLK-----NNETL--------------K 969
            LP  L+I+L RF   +  KN   + YP  L++        N+E +              +
Sbjct: 686  LPKKLIINLKRFDNQM-NKNNVFVQYPYSLDLTPYWARDFNHEAIVNEDIPTRGQVPPFR 744

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            YRLY V  H+G+L  GHYTS V K         ++ WY+FDD + +  T          +
Sbjct: 745  YRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSLYRPITFS-------TE 790

Query: 1030 VSSKDVYVLFYERI 1043
              +   YVLFYERI
Sbjct: 791  FITPSAYVLFYERI 804

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  120 bits (300), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 131/536 (24%), Positives = 216/536 (40%), Gaps = 82/536 (15%)

Query: 347 LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDE-RLKNSIFNKRGS 405
           +L+ID+R +S +   +I   N++ I+P    D  T   V  IS+    + +  +F+ R +
Sbjct: 179 ILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDLFSNRDT 238

Query: 406 FDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPS----YLLGGYEKWKAVLKK 461
           F +IV YTD + Y +       +   ++   Q   L+ L       L  G+  W  +   
Sbjct: 239 FKYIVLYTDTQLYGDFHQRQTRILTKILC--QHSVLKPLGGTKVLILANGFSNWVKLGGA 296

Query: 462 Y--LTQFGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXAT 519
           Y   T    ++      P   N     +  N +   P   K P+L      +        
Sbjct: 297 YQSFTPDPAQLTSSSSTPSFGNPRVSAELFNQRSHSPPKCKSPSL------IVMNTQSQP 350

Query: 520 LPITKEMPP-----PVPPKIQLEQQEDKNHTRPRSRT---------VSSPAEVPKNVVAP 565
           L +T + P      P  P I  + + DKN +  +S +         V+S +  P  V   
Sbjct: 351 LQVTAQTPQLPLYYPEVPTIS-KSRPDKNSSAFQSLSSHPLIALPKVNSSSLFPTKVDGI 409

Query: 566 EQLS------QLDSY-------------PMRQRQFSVP--TIERSNNKYVALSITGLRNL 604
           E+LS      Q+D Y             P+ Q+  S P   I  ++  +    I GL N+
Sbjct: 410 EKLSANVRNQQIDPYLPSASNVIPPRIPPLPQQNLSPPKHAIFNNSQAFDLDFIVGLENM 469

Query: 605 GATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRKMYMNGG 662
           G  CY+N +LQCL  T+    +F  + Y  F  F       G L+K+++ L+  M+ +G 
Sbjct: 470 GNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVHNMHRHGA 529

Query: 663 --------CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN-----QT 709
                     V    F K+C  +   ++    QQD QEF    +D LH++L+        
Sbjct: 530 FKPPHSRTTPVQTLQFKKVCGHINSIYS-DSMQQDCQEFCQFLLDGLHEDLNQNGGKKHL 588

Query: 710 EVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXX 769
           + L+   E +    E+  ++K    +W     + T FS I  +FQGQ  + L C+ C   
Sbjct: 589 KQLSEQEERM---RESMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQACEHT 643

Query: 770 XXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                TF +LS+ +P+              N+ DC   FT  E +  +  W C KC
Sbjct: 644 STTYQTFSVLSVPVPRIRT----------CNILDCFREFTKCEKLGVDEQWSCSKC 689

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 34/134 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLK-----NNETL--------------K 969
            LP  L+I+L RF   + K N   + YP  L++        N+E++              +
Sbjct: 704  LPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVNEDIPTRGQIPPFR 762

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            YRLY V  H+G+L  GHYTS V K         ++ WY+FDD V      +       ++
Sbjct: 763  YRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDDSVYCPIRFN-------DE 808

Query: 1030 VSSKDVYVLFYERI 1043
              + + YVLFYERI
Sbjct: 809  FITPNAYVLFYERI 822

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  120 bits (300), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 126/263 (47%), Gaps = 38/263 (14%)

Query: 585 TIERSNNKYVA-LSI---TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNP 638
           TI +S+N Y   L +    GL N+G +CY+N ++QCL   +    +F  ++YE+    N 
Sbjct: 717 TISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININS 776

Query: 639 ELEDTGKLSKSFSVLIRKMYMNGGCS-----------VVPTSFLKICNFLRPDFNIPDDQ 687
           +L   G L+KSF+ L+  MY NG  S           V P +F   C  +   F    +Q
Sbjct: 777 KLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GSNQ 835

Query: 688 QDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----I 742
           QD QEF    +D LH++L NQ     A+P L     E  ++ +E+      +S+     +
Sbjct: 836 QDCQEFCQFLLDGLHEDL-NQ---CGANPPLKELSTEAERM-REKLSLRIASSIEWERFL 890

Query: 743 NTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLE 802
            T FS I  ++QGQ  + L C+ CG       TF +LS+ +P          K   ++L 
Sbjct: 891 TTDFSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVP----------KNKSIHLL 940

Query: 803 DCINMFTSDEVMSRENAWDCPKC 825
           DC N FT  E + ++  W C +C
Sbjct: 941 DCFNEFTKTEFLGKDELWSCTEC 963

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 48/108 (44%), Gaps = 29/108 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------- 967
            LP  L+IHL RF  ++  KN   + YPLIL++           L    T           
Sbjct: 978  LPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPGVTEELPARGQIPP 1036

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVK 1015
             KY L  V  H G+L  GHYT+ VNK         +  WYYFDD V +
Sbjct: 1037 FKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDDTVYR 1077

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 327 SIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVT 386
           S ITS  L +IL  + + +  LLID+R +  ++ N+I + +++ I+P     ++ K   +
Sbjct: 178 SHITSSVLATIL--QTDPDSTLLIDVRTRHDFELNHIKSNSIICIEP-----ISFKNNYS 230

Query: 387 DISVLDERLKNS------IFNKRGSFDFIVYYTD 414
           D+ +  + L  S      IF  R ++ FI+ YTD
Sbjct: 231 DVDIERKSLITSPNSEIEIFKNRENYKFIILYTD 264

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  117 bits (293), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 92/298 (30%), Positives = 131/298 (43%), Gaps = 39/298 (13%)

Query: 547 PRSRTVSSPAEVP---KNVVAP--EQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGL 601
           PR  T  + A VP    ++  P  + +  L  +P R+   S P +  S NKY      GL
Sbjct: 410 PRVFTADNEAIVPVKMNDLSKPPSQAIPPLPKFPSRE---SSPALG-SANKYDLDFAVGL 465

Query: 602 RNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF--NPELEDTGKLSKSFSVLIRKMYM 659
            N+G +CYIN ++QCL  T+   ++F   +YER    N  L   G L+K F+ L   MY 
Sbjct: 466 ENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNSRLGSKGVLAKYFAKLTHSMYQ 525

Query: 660 NG-------GCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVL 712
           N        G  V P  F   C  +   F     QQD QEF    +D LH++L NQ    
Sbjct: 526 NASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQDCQEFCQFLLDGLHEDL-NQC--- 580

Query: 713 NAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKCG 767
             +P L     E  K+ +E+      +S+     + T FS I  +FQGQ  + L C+ CG
Sbjct: 581 GGNPPLKELSDEAEKM-REKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASQLRCQVCG 639

Query: 768 XXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                   F +LS+ +P               N+ DC   FT  E +  +  W CP+C
Sbjct: 640 LTSTTYQPFSVLSVPVP----------HAKSCNIIDCFKEFTKVEKLETDEQWSCPRC 687

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 57/136 (41%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV---------------------LKNNET 967
            LP  L+IHL RF  ++  KN   + YP  L++                         +  
Sbjct: 702  LPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPP 760

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              Y+LY + +H G+L  GHYTS V+K         ++ W YFDD   +         +  
Sbjct: 761  FNYKLYGIASHVGSLYGGHYTSYVDKGP-------KRGWCYFDDTSFRP-------VRNA 806

Query: 1028 NKVSSKDVYVLFYERI 1043
             +  + + YVLFY R+
Sbjct: 807  TECITPNAYVLFYHRV 822

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 301 DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF 360
           D   G+ K      S+      L   S I+S  L  ++ +  +    LLIDLR +  +  
Sbjct: 134 DEKIGQIKAFLKENSKPDVEMVLNTGSTISSSHLQQLIDSHNDST--LLIDLRQRGEFSK 191

Query: 361 NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNS------IFNKRGSFDFIVYYT 413
            +I A N++ I+P     ++ K   TD+ +  + L  S      +F  R +F FIV YT
Sbjct: 192 LHINAKNVICIEP-----ISFKAQYTDLEIEKKSLITSPKEEIGLFRARDTFKFIVLYT 245

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 114/241 (47%), Gaps = 31/241 (12%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFN--PELEDTGKLSKSFSVLIRKM 657
           GL N+G +CY+N ++QCL +++ F  +F  ++YE+  N   +L   G L+++F+ LI  M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 658 YMNGG--------CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
           Y  G           V P  F   C  +   F   D QQD+QEF    +D LH++L NQ 
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDL-NQC 726

Query: 710 EVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCK 764
               A+P L        K+ +E+      +S+     + T FS I   FQGQ  + L CK
Sbjct: 727 ---GANPPLKELSPNAEKM-REKLSLRIASSIEWERYLTTDFSVIVDQFQGQYASQLRCK 782

Query: 765 KCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPK 824
            CG        F +LS+ +P          +G   N+ DC N FT  E +  +  W CP 
Sbjct: 783 VCGGTSTTYQAFSVLSVPVP----------RGKSCNIIDCFNEFTKVENLETDELWACPH 832

Query: 825 C 825
           C
Sbjct: 833 C 833

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 59/136 (43%), Gaps = 37/136 (27%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------- 967
            LP  L+IHL RF  ++  KN   + YP +L++           L    T           
Sbjct: 848  LPRNLIIHLKRFD-NMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEELPTRGQIPP 906

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              Y+L AV  H G+L  GHYTS V+K         +  W YFDD  ++       L    
Sbjct: 907  FNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKIRP------LKNSY 952

Query: 1028 NKVSSKDVYVLFYERI 1043
              ++S + YVLFY R+
Sbjct: 953  ECITS-NAYVLFYHRV 967

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 128/552 (23%), Positives = 217/552 (39%), Gaps = 102/552 (18%)

Query: 329 ITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDI 388
           ++  +L S++ +  + + +LL+D+R +  +   +I   N++ I+P     ++ K   TD 
Sbjct: 156 VSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEP-----ISFKESYTDS 210

Query: 389 SVLDERLKNS------IFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVV-ASQEVSL 441
            +L + L  +      +F  R  F  IV YTD   + +  +  L V  +++   S +  L
Sbjct: 211 DILRKSLITASDREVDLFKNRDKFRLIVLYTDTDEHTKYYWQQLEVLQDILCNRSFDKPL 270

Query: 442 RSLPSYLL-GGYEKWK--------AVLKKYLTQFGIRVDDYLYRPYS-SNKEGKEKSANA 491
                 +L  G   WK         +++  ++    +  ++ + P + SN    EK+ + 
Sbjct: 271 HHTKVIVLQNGVNAWKEKYPMELKKIMESAISDIRTKPVEHNFHPMALSNNNNIEKANSP 330

Query: 492 KHIEPVPWKPPALPERMRNLXXXXXXATLP---------ITKEM---------PPPVPPK 533
            H +   +        + N         +P         +TK +         P  + P 
Sbjct: 331 SHSQTTSFTHYPDAPFLTNGASIKTAGLVPNQLLPSTSNLTKALQQNDEGNSEPYKLQPN 390

Query: 534 -IQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNK 592
            I+  +QE  NH    +  VSS      N VA         +P     F++         
Sbjct: 391 GIKNHRQESNNHANGTNCIVSSNGN---NSVAKS------GHPSINLDFAI--------- 432

Query: 593 YVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSF 650
                  GL NLG +CY+N ++QCL   +    +F  ++Y +    N  L   G L+  F
Sbjct: 433 -------GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYF 485

Query: 651 SVLIRKMYMNG-----------GCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTID 699
           S L++KMY  G             +V PT F   C  +   F     QQD QEF    +D
Sbjct: 486 SQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQDCQEFCQFLLD 544

Query: 700 RLHDELSNQTEVLNAHPELLLYDAETSKVQK------EEYKQWFENSLINTKFSPIDKIF 753
            LH++L NQ      +P L     E  K+++          +W     + T FS I  +F
Sbjct: 545 GLHEDL-NQC---GTNPPLKELSPEAEKMRETMPMRIASAIEW--ERYLTTDFSVIVDLF 598

Query: 754 QGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEV 813
           QGQ  + L CK C         F +LS+ +P+               + DC   FT  E 
Sbjct: 599 QGQYASQLRCKICAHTSTTYQAFSVLSVPVPRARS----------CTIYDCFKEFTKLET 648

Query: 814 MSRENAWDCPKC 825
           + ++  W CP C
Sbjct: 649 LEKDELWYCPYC 660

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 60/143 (41%), Gaps = 49/143 (34%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNI-----------VLKNNET---------- 967
            LP  L+IHL RF  ++  KN   + YP  L++           + K+N            
Sbjct: 675  LPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLPLRGQKPP 733

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              YRL+AV +H+G L  GHYTS V+K         R  W  FDD   +            
Sbjct: 734  FNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWR------------ 773

Query: 1028 NKVSSKD------VYVLFYERID 1044
             K+  KD       YVLFY R++
Sbjct: 774  -KIRRKDEYITPNAYVLFYRRVN 795

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 123/512 (24%), Positives = 198/512 (38%), Gaps = 55/512 (10%)

Query: 347 LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVL-DERLKNSIFNKRGS 405
            LL+D+R +  +   +I   +++ IDP    D  T T V  +S+    +L+  +F+KR +
Sbjct: 165 FLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIELFSKRNT 224

Query: 406 FDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQ 465
           F  IV YTD +   +       +  N++       +    S L  G+  W  +   + T 
Sbjct: 225 FKNIVLYTDTQLQGDFQQRQTRILANILTRHSVAKV----SILENGFSNWVKLGGAFSTG 280

Query: 466 FGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKE 525
              ++        S        S N++   P   K P L                P    
Sbjct: 281 -QPQLASLSSSVSSPRTSAGLFSQNSR--SPPKGKSPTLVSMKAQSQPLQATLQTPQVPL 337

Query: 526 MPPPVPPKIQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPE-----------QLSQLDSY 574
             P VP      +     HT      ++ P E P   V  +           QL Q +  
Sbjct: 338 YYPEVPTLSHFNKDSSALHTLSPHPLIAVPKEKPSTFVHGKVNSIEALSPGPQLPQANVI 397

Query: 575 PMR-----QRQFSV--PTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLF 627
           P R     Q+   V  P I+ S   +    I GL N+G  CY+N +LQCL  T+    +F
Sbjct: 398 PPRIPPLPQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMF 457

Query: 628 EPSNYERFFNPE--LEDTGKLSKSFSVLIRKMYMNGG--------CSVVPTSFLKICNFL 677
             + Y  F N +      G L+K+F+ L+  M+ +G           V    F K C  +
Sbjct: 458 LDNTYLNFINFDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHI 517

Query: 678 RPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSK----VQKEEY 733
              ++    QQD QEF    +D LH++L+        H + L  + E ++    ++K   
Sbjct: 518 NSIYS-DSMQQDCQEFCQFLLDGLHEDLNQNGG--KKHLKQLSEEEERTRENMSIRKASA 574

Query: 734 KQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXX 793
            +W     + T FS +  +FQGQ  + L C+ C        TF +LS+ +P+        
Sbjct: 575 LEW--ERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRIMT----- 627

Query: 794 XKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                 N+ DC   FT  E +     W C +C
Sbjct: 628 -----CNVLDCFREFTKCEKLGIGEQWSCSRC 654

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 64/134 (47%), Gaps = 34/134 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLK-----NNETL--------------K 969
            LP  L+I+L RF   +  KN   + YP  L++        N+E +              +
Sbjct: 669  LPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIIDEDIPTRGQIPPFR 727

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            YRLY V  H+G+L  GHYTS V K         ++ WY+FDD + +       L +  N+
Sbjct: 728  YRLYGVACHSGSLYGGHYTSYVYK-------GPQKGWYFFDDTIYR-------LIRFNNE 773

Query: 1030 VSSKDVYVLFYERI 1043
              + + YVLFYERI
Sbjct: 774  FITPNAYVLFYERI 787

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 114/244 (46%), Gaps = 35/244 (14%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL N+G +CY+N ++QCL +T+    +F  ++YE+    N +L   G L+K F+ L+  
Sbjct: 519 VGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHT 578

Query: 657 MYMNGGCS--------VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQ 708
           MY  G           + P  F   C  +   F   + QQD+QEF    +D LH++L NQ
Sbjct: 579 MYREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-DNTQQDSQEFCQFLLDGLHEDL-NQ 636

Query: 709 TEVLNAHPEL--LLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGL 761
                A+P L  L  DAE     +E+      +S+     + T FS I  +FQGQ  + L
Sbjct: 637 C---GANPPLKELSEDAEK---MREKLSMRIASSIEWERFLTTDFSVIVDLFQGQYASQL 690

Query: 762 HCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWD 821
            CK CG       TF +LS+ +P               ++ DC N FT  E +  +  W 
Sbjct: 691 KCKVCGCTSTTYQTFSVLSVPVPHVSS----------CHILDCFNEFTKVEKLGTDELWS 740

Query: 822 CPKC 825
           CP C
Sbjct: 741 CPTC 744

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 63/139 (45%), Gaps = 42/139 (30%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------- 967
            LP  L+IHL RF  ++  KN   + YP +L++           L    T           
Sbjct: 759  LPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGVTDELPTRGQVPP 817

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEV---VKHETSHGNLS 1024
             +Y+L AV +H G+L  GHYT+ VNK  +         W+YFDD     +K+ET      
Sbjct: 818  FRYKLNAVASHVGSLYGGHYTAYVNKGINRG-------WHYFDDTSYRPIKNET------ 864

Query: 1025 QGVNKVSSKDVYVLFYERI 1043
                +  + + YVLFY R+
Sbjct: 865  ----ECITPNAYVLFYHRV 879

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 11/73 (15%)

Query: 347 LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNS------IF 400
           LLLID+R ++ +   +I A +++ ++P     V+ K   TD+ V  + L  S      +F
Sbjct: 186 LLLIDVRPRAEFDSKHIKAKSVICVEP-----VSFKNSFTDLEVEKKSLITSPQKEIALF 240

Query: 401 NKRGSFDFIVYYT 413
             R  +++IV YT
Sbjct: 241 QARDKYNYIVIYT 253

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 124/284 (43%), Gaps = 41/284 (14%)

Query: 564 APEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMF 623
           +P + + L S P++    +   ++R  N  V     GL NLG +CY+N ++QCL  T   
Sbjct: 26  SPLKETTLSSGPLQNHSMNSSLVKRGLNINV-----GLVNLGNSCYMNCIIQCLLGTREL 80

Query: 624 RDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRKMYM-------------NGGCSVVPT 668
             +F   +Y+     N  L   G L+K FS LI  M               N   +V P 
Sbjct: 81  VQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNMQQQAISASGRKSTSGNERNAVQPL 140

Query: 669 SFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKV 728
            F   C  +   F     QQD QEF    +D LH++L NQ     A  EL    +E ++ 
Sbjct: 141 HFKVACGSINSLFKT-TSQQDCQEFCQFLLDGLHEDL-NQCGGNPALKEL----SEEAEA 194

Query: 729 QKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAI 783
            +E+      +S+     + T FS I  +FQGQ  + L CK CG        F +LS+ +
Sbjct: 195 IREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLMCKVCGRTSTTYQPFSVLSVPV 254

Query: 784 PKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827
           P          +G   NL DC   FT  E + ++  W CP+C V
Sbjct: 255 P----------RGARCNLLDCFEEFTKIETLEKDEQWSCPRCKV 288

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 54/134 (40%), Gaps = 35/134 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------------LKNNETL 968
            LP  L+IHL RF  +L  KN   ++YP  L++                            
Sbjct: 301  LPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGVAELPTRGQTPPF 359

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
             Y LYAV  H G L  GHYT+ VNK        ++  W YFDD   +   S        +
Sbjct: 360  HYNLYAVACHFGTLYGGHYTAYVNK-------EDKNGWCYFDDTCWRKAKSE-------D 405

Query: 1029 KVSSKDVYVLFYER 1042
            +  +   YVLFY R
Sbjct: 406  ECITTSAYVLFYHR 419

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 111/243 (45%), Gaps = 29/243 (11%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIR 655
           + GL N+G +CY+N ++QCL   N    +F  +++E++   N +L   G L++ FS LI 
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 656 KMYMN------GG--CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707
            MY N      GG    V P  F   C  +   F     QQD QEF    +D LH++L N
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDL-N 736

Query: 708 QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLH 762
           Q        EL     E ++  +E+      +S+     + T FS I  +FQGQ  + L 
Sbjct: 737 QCGGNKRLAEL----TEEAENLREKLSLRIASSIEWERFLTTDFSVIGDLFQGQYASRLQ 792

Query: 763 CKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDC 822
           CK CG        F +LS+ +P               ++ DC + FT  E +  +  W C
Sbjct: 793 CKTCGKTSTTYQPFSVLSIPVPSKHISK--------CSIIDCFDEFTKVENLEVDEQWSC 844

Query: 823 PKC 825
           P+C
Sbjct: 845 PRC 847

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 58/135 (42%), Gaps = 35/135 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVL--------------------KNNETL 968
            LP  L+IHL RF   L  KN  ++ YP  L++                            
Sbjct: 862  LPRNLIIHLKRFDNRL-NKNNILVQYPFTLDLTTFWANDFDGKLPLNVSELPTRGQKPPF 920

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
             Y+LY V  H G+L  GHYT+ V+K         +  WYYFDD      TS   +   + 
Sbjct: 921  NYKLYGVACHFGSLYGGHYTAYVDKGI-------KNGWYYFDD------TSCRPIKNSME 967

Query: 1029 KVSSKDVYVLFYERI 1043
             ++S   YVLFY+RI
Sbjct: 968  PITS-SAYVLFYKRI 981

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  110 bits (276), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 146/567 (25%), Positives = 222/567 (39%), Gaps = 73/567 (12%)

Query: 306 ENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILA 365
           ENK   FP+S+          S I   +L  +LS+ K RN LLLID+R +  +   +I A
Sbjct: 149 ENK---FPKSKTIHQVTNLSDSFILPEKLHDLLSSHK-RN-LLLIDVRTRKEFDTLHIDA 203

Query: 366 PNMVFIDPRMLWDVNTKTPVTDISVLDERLKN-SIFNKRGSFDFIVYYTDMKTYMEMDFD 424
           P ++ I P       T   +   S+L    +  + F KR  F +IV YT         + 
Sbjct: 204 PIILPIGPLSFKSTFTDLQIEQTSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYT 263

Query: 425 YLFVFYNL--VVASQEVSLRSLPSYLL--GGYEKW---KAVLKKYLTQFGIRVDDYLYRP 477
            +   +N+  + AS+    +  PS  +  GG   W       K  LT  G   + Y    
Sbjct: 264 QVISLFNILTIAASKRNIDQICPSIFILKGGITSWVQHSYECKTNLT--GKTANQYNQNL 321

Query: 478 YSSNKEGKEKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKE--MPPPVPPK-- 533
           +  +K+    S+  KH+        AL +   N         +P + +  +P  +PP   
Sbjct: 322 FKRSKD----SSIYKHV--------ALSDNSLNEGSKTCNPIVPASVQTVIPNFIPPSHS 369

Query: 534 ---IQLEQQEDKN------------HTRPRSRTVSSPAEVPKNVVAP-EQLSQLDSY-PM 576
              I L + E               H  P     ++   VP     P  Q+ ++  Y P 
Sbjct: 370 KSTICLMKNEQPQALYNHQVIPNLIHRAPLDTESNNTQNVPMGFKNPIPQMYEIPKYNPS 429

Query: 577 RQRQFSVPTIERSNNKYVALS------ITGLRNLGATCYINSMLQCLFATNMFRDLFEPS 630
                 +P +  + N    +        TGL N+  +CY+N ++QCL +T+    L+  +
Sbjct: 430 VNSGPKLPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTN 489

Query: 631 NYERFFNPE--LEDTGKLSKSFSVLIRKMYMNGGCS---------VVPTSFLKICNFLRP 679
            +    N E  L   G LSK+F+ LI+ MY               V P  F   C  +  
Sbjct: 490 AFLTQINVENKLGSKGFLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMNS 549

Query: 680 DFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFE- 738
            +     +QD QEF    +D LH++L NQ        EL   +AE  +          E 
Sbjct: 550 IY-AESTEQDCQEFCEFLLDGLHEDL-NQCSGNPRPKELSANEAELRESLSMRIASEIEW 607

Query: 739 NSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNW 798
            S + T FSPI  +FQGQ  + L C  C         F +LS+ +P           G  
Sbjct: 608 ESFLTTNFSPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPS-----MVFSNGQT 662

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
            N+ DC   FT  E +  +  W CPKC
Sbjct: 663 CNILDCFKEFTKCERLDNDEKWFCPKC 689

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 58/136 (42%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV---------------------LKNNET 967
            LP  L+IH  RF  +   KN   + YP  L++                            
Sbjct: 704  LPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPNFNEPPPSRGQTPP 762

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
             KY+L AV  H+GNL SGHYT+ V+K          + W+ FDD       S+  +  G 
Sbjct: 763  FKYKLNAVSCHSGNLGSGHYTAYVDKGL-------YRGWFRFDD------ASYRPVKFGT 809

Query: 1028 NKVSSKDVYVLFYERI 1043
             +  + D Y+LFY+RI
Sbjct: 810  -EFLTPDAYLLFYQRI 824

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 127/287 (44%), Gaps = 39/287 (13%)

Query: 567 QLSQLDSYPMRQRQFSVPTIERSNNKYVALS---------ITGLRNLGATCYINSMLQCL 617
           +L  L + P+     + P   +SNN   A           I GL N+G +CY+N ++QC+
Sbjct: 564 RLPALPTKPVISSNLASPPHSKSNNGRSAQVYTDALKLDFIVGLENMGNSCYMNCIIQCI 623

Query: 618 FATNMFRDLFEPSNYERFFN--PELEDTGKLSKSFSVLIRKMYMNGGCSVV--------- 666
             T+    +F  ++YE+  N    L   G L+K+F+ LI  MYM+   S +         
Sbjct: 624 LGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIHTMYMHAVPSTINKHTEKKIV 683

Query: 667 ---PTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDA 723
              P  F   C  +   F     QQD+QEF    +D LH++L NQ      +P L     
Sbjct: 684 PVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGLHEDL-NQC---GGNPPLKELSL 738

Query: 724 ETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYI 778
           E  ++ +E       +S+     + T FS I  +FQGQ  + L CK C        +F +
Sbjct: 739 EAERL-RENLSLRIASSIEWERYLTTDFSVIVDLFQGQYASRLECKVCHHTSTTYQSFSV 797

Query: 779 LSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           LS+ +PK         +   ++L DC N FT  E +  +  W CP C
Sbjct: 798 LSVPLPK-----KFDPQTRKIDLIDCFNEFTKIENLEVDEQWSCPTC 839

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 61/136 (44%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------LKNN-------ET 967
            LP  L+IHL RF  ++  KN + I YP  L++               + N        + 
Sbjct: 854  LPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPGVSNELPARGQIKP 912

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              YRLY V  H G+L  GHYT+ V+K   +        WYYFDD      T++  L    
Sbjct: 913  FNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDD------TTYRPLKNDK 959

Query: 1028 NKVSSKDVYVLFYERI 1043
              +SS   YVLFY R+
Sbjct: 960  EPISS-SAYVLFYTRV 974

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 327 SIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVT 386
           S I++ +L  ++ N  +   LL+ID+R +S +  ++I + N++ I+P    D  +   + 
Sbjct: 184 SFISTIQLNELMRNFNDS--LLIIDIRSRSEFIKSHIKSKNIICIEPISFKDSYSDYELE 241

Query: 387 DISVLDERLKNSI--FNKRGSFDFIVYYTDM 415
             S++     N I  FN R SF FIV YT++
Sbjct: 242 RKSIITSP-NNEIRLFNNRQSFKFIVLYTEI 271

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  108 bits (269), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 111/239 (46%), Gaps = 25/239 (10%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+N ++QC+  T+    +F   +Y +    N +L   G L+K F+ L+  
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 657 MY-----MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
           MY      +   S+ P  F   C  +   F     QQD QEF    +D LH++L NQ   
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQC-- 677

Query: 712 LNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKC 766
             ++P L     E ++ ++E+      +S+     + T FS I  +FQGQ  + L CK C
Sbjct: 678 -GSNPPLKELSQE-AEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKIC 735

Query: 767 GXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           G        F +LS+ IP+           N + +EDC   FT  E +  +  W CP C
Sbjct: 736 GHTSTTYQPFTVLSIPIPR-------KVPQNEITIEDCFKEFTKCENLEVDEQWLCPHC 787

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 63/140 (45%), Gaps = 43/140 (30%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------LKNNET------- 967
            LP  L+IHL RF  +L  KN   + YP +L++               + ++E        
Sbjct: 802  LPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPVRGQIP 860

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD---EVVKHETSHGNL 1023
              KY LY V  H G L  GHYT+ V K         R+ W YFDD   + VK++T     
Sbjct: 861  PFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPVKNKTD---- 909

Query: 1024 SQGVNKVSSKDVYVLFYERI 1043
                  V++ + YVLFY R+
Sbjct: 910  ------VTNSNAYVLFYHRV 923

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  107 bits (268), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 110/239 (46%), Gaps = 25/239 (10%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+N ++QC+  T+    +F   +Y +    N +L   G L+K F+ L+  
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 657 MY-----MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
           MY      +   S+ P  F   C  +   F     QQD QEF    +D LH++L NQ   
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQC-- 680

Query: 712 LNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKC 766
             ++P L     E ++ ++E+      +S+     + T FS I  +FQGQ  + L CK C
Sbjct: 681 -GSNPPLKELSQE-AEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 767 GXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                    F +LS+ IPK           N + +EDC   FT  E +  E  W CP C
Sbjct: 739 NHTSTTYQPFTVLSIPIPK-------KNSQNKITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 61/140 (43%), Gaps = 43/140 (30%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------LKNNET------- 967
            LP  L++HL RF   L K N+  + YP +L++               + ++E        
Sbjct: 805  LPRNLIVHLKRFDNFLNKNND-FVRYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 863

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD---EVVKHETSHGNL 1023
              KY LY V  H G L  GHYT+ V K         ++ W YFDD   + VK++T   N 
Sbjct: 864  PFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPVKNQTDAIN- 915

Query: 1024 SQGVNKVSSKDVYVLFYERI 1043
                      + YVLFY R+
Sbjct: 916  ---------SNAYVLFYHRV 926

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 13/101 (12%)

Query: 327 SIITSPEL----FSILSNKKERNRLLLIDLRLQSRYKFN--YILAPNMVFIDP---RMLW 377
           SIIT   L    FS  ++   +   LLID+R  SR +FN  +I + N++ ++P   +M +
Sbjct: 185 SIITPSHLNSLIFSSTNSTSSQMETLLIDIR--SRLEFNKSHIDSKNIICLEPISFKMSY 242

Query: 378 DVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTY 418
             +     + I+  ++ +K  +F  R  F FIV YTD   Y
Sbjct: 243 SDHDLERKSLITSPNDEIK--LFQSRNLFKFIVLYTDSNEY 281

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 81/262 (30%), Positives = 117/262 (44%), Gaps = 39/262 (14%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPE 639
           S P   R+ N  V     GL NLG +CY+N ++QCL  T+    +F   +Y+     N +
Sbjct: 483 SKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSK 537

Query: 640 LEDTGKLSKSFSVLIRKMY---------MNGG--CSVVPTSFLKICNFLRPDFNIPDDQQ 688
           L   G L+K FS LI  M           N G   +V P  F   C  +   F     QQ
Sbjct: 538 LGSKGVLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-SSSQQ 596

Query: 689 DAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----IN 743
           D QEF    +D LH++L NQ     A  EL    +E ++  +E+      +S+     + 
Sbjct: 597 DCQEFCQFLLDGLHEDL-NQCGGNPALKEL----SEEAEGIREKLCMRIASSIEWERYLT 651

Query: 744 TKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLED 803
           T FS I  +FQGQ  + L CK CG        F +LS+ +P           G+  ++ D
Sbjct: 652 TDFSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVP----------SGSKCDIID 701

Query: 804 CINMFTSDEVMSRENAWDCPKC 825
           C   FT  E + ++  W CP+C
Sbjct: 702 CFKEFTKVETLEKDEQWSCPRC 723

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 54/134 (40%), Gaps = 35/134 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------------LKNNETL 968
            LP  LVIHL RF  +L  KN   ++YP  L++                            
Sbjct: 738  LPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAELPTRGQVPPF 796

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
             Y LYAV  H G L  GHYTS V+K        ++  W YFDD   +   S G       
Sbjct: 797  NYNLYAVACHFGTLYGGHYTSYVDK-------GDKAGWCYFDDTSWRKAKSQG------- 842

Query: 1029 KVSSKDVYVLFYER 1042
            +  +   YVLFY R
Sbjct: 843  ECITLSAYVLFYHR 856

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 11/132 (8%)

Query: 329 ITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDI 388
           I+  EL S+L  +      LLIDLR + ++  ++I    ++ I+P    D  + T +T  
Sbjct: 164 ISPSELQSLLGAQNA----LLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRR 219

Query: 389 SVL---DERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVV-ASQEVSL-RS 443
           S++   +E ++  +F +R  FD+IV YTD     +          +L+V  S E  L R+
Sbjct: 220 SLITSPNEEVQ--LFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRT 277

Query: 444 LPSYLLGGYEKW 455
           +   L GG+E W
Sbjct: 278 IILTLQGGFENW 289

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 105/240 (43%), Gaps = 25/240 (10%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIR 655
           I GL N G  CY+N +LQCL  T+    +F  + Y  F  F+      G L+K+F+ L+R
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 656 KMYMNGG--------CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707
            M+ N            V    F KIC  +   ++    QQD QEF    +D LH++L+ 
Sbjct: 505 NMHRNSAFMPVNSRTTPVQTIQFKKICGHINSIYS-DSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 708 QT--EVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
               E L    E      E   ++K    +W     + T FS I  +FQGQ  + L C+ 
Sbjct: 564 NGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASRLQCQA 621

Query: 766 CGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           C        TF +LS+ +P+              N+ DC   FT  E +  +  W CP+C
Sbjct: 622 CDRTSTTYQTFSVLSVPVPRITT----------CNILDCFREFTKCEKLGIDELWSCPRC 671

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 34/134 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLK-----NNETL--------------K 969
            LP  L+I+L RF   +  KN   + YP  L++        N+E +              +
Sbjct: 686  LPKKLIINLKRFDNQM-NKNNVFVQYPYFLDLTPYWARDFNHEAIVNEDIPTRGQIPPFR 744

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            YRLY V  H+G+L  GHYTS V K         ++ WY+FDD + +    +       ++
Sbjct: 745  YRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSIYRPIRFN-------DE 790

Query: 1030 VSSKDVYVLFYERI 1043
              + + YVLFYERI
Sbjct: 791  FITPNAYVLFYERI 804

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 347 LLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKN-SIFNKRGS 405
           LLLID+R +S +   +I   N++ I+P    D  T   + ++S++     +  +F+ R  
Sbjct: 163 LLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQSDIDLFSNRNM 222

Query: 406 FDFIVYYTDMKTY 418
           F +IV YTD + +
Sbjct: 223 FKYIVLYTDAQLH 235

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 112/239 (46%), Gaps = 25/239 (10%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+N ++QC+  T+    +F   +Y +    N +L   G L+K F+ L+  
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 657 MY---MNGG--CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
           MY   ++G    S+ P  F   C  +   F     QQD QEF    +D LH++L NQ   
Sbjct: 622 MYKEQVDGSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQC-- 677

Query: 712 LNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCKKC 766
             ++P L     E ++ ++E+      +S+     + T FS I  +FQGQ  + L CK C
Sbjct: 678 -GSNPPLKELSQE-AEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVC 735

Query: 767 GXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                    F +LS+ IPK           N + +EDC   FT  E +  +  W CP C
Sbjct: 736 SHTSTTYQPFTVLSIPIPKKNSR-------NNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 37/137 (27%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------LKNNET------- 967
            LP  L++HL RF   L K N+ VI YP +L++               + ++E        
Sbjct: 802  LPRNLIVHLKRFDNLLNKNNDFVI-YPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 860

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG 1026
              KY LY V  H G L  GHYT+ V K         ++ W YFDD      T +  +   
Sbjct: 861  PFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDD------TKYKPVKNK 907

Query: 1027 VNKVSSKDVYVLFYERI 1043
             + ++S + YVLFY R+
Sbjct: 908  ADAINS-NAYVLFYHRV 923

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 110/240 (45%), Gaps = 27/240 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+N ++QC+  T+    +F   +Y +    N +L   G L+K F+ L+  
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 657 MY-----MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
           MY      +   S+ P  F   C  +   F     QQD QEF    +D LH++L NQ   
Sbjct: 623 MYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDL-NQC-- 678

Query: 712 LNAHPEL--LLYDAETSK----VQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
             ++P L  L  +AET +    ++     +W     + T FS I  +FQGQ  + L CK 
Sbjct: 679 -GSNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKT 735

Query: 766 CGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           C         F +LS+ IPK           N + +EDC   FT  E +  +  W CP C
Sbjct: 736 CNHTSTTYQPFTVLSIPIPKKNSQ-------NKITIEDCFKEFTKCENLEIDEQWLCPHC 788

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 60/137 (43%), Gaps = 37/137 (27%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--------------LKNNET------- 967
            LP  L+IHL RF  +L  KN   + YP +L++               + ++E        
Sbjct: 803  LPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 861

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG 1026
              KY LY V  H G L  GHYTS V K          + W YFDD   K+  +  N +  
Sbjct: 862  PFKYELYGVACHFGTLYGGHYTSYVKKGLS-------RGWLYFDD--TKYRPA-KNQTDA 911

Query: 1027 VNKVSSKDVYVLFYERI 1043
            +N     + YVLFY R+
Sbjct: 912  IN----SNAYVLFYHRV 924

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 24/130 (18%)

Query: 308 KGATFPESEVQAMKR---------LQKQSIITSPELFSIL----SNKKERNRLLLIDLRL 354
           K   F +S +Q MK          +Q  S IT  +L S++    ++   +   LLID+R 
Sbjct: 157 KIKNFIKSSIQQMKLHHEQEECHLMQTGSHITPDQLNSLIVSSTNSSSSQMETLLIDIRS 216

Query: 355 QSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNS------IFNKRGSFDF 408
           +  +K ++I   N++ ++P     ++ KT  +D  +  + L  S      +F  R  F F
Sbjct: 217 RLEFKKSHIDFKNIICLEP-----ISFKTSYSDRDLEKKSLITSPNDEIKLFQSRNLFKF 271

Query: 409 IVYYTDMKTY 418
           I+ YTD   Y
Sbjct: 272 IILYTDSNDY 281

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 105/244 (43%), Gaps = 35/244 (14%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRKM 657
           GL N G +CY++ ++QCL  T     +F  ++Y+     N  L   G L++ FS LI +M
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQM 548

Query: 658 YMNGG----------CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707
           Y  G            +V+PT F   C  +   F   + QQD QEF    +D LH++L N
Sbjct: 549 YQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL-N 606

Query: 708 QTEVLNAHPELLLYDAETSKVQK------EEYKQWFENSLINTKFSPIDKIFQGQLENGL 761
           Q      +P L     E  K+++          +W     + T FS I  +FQGQ  + L
Sbjct: 607 QC---GNNPPLKELSEEAEKMREMMPMRLASAIEW--ERYLTTDFSVIVDLFQGQYASQL 661

Query: 762 HCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWD 821
            CK C         F +LS+ +P                L DC   FT  E + +E  W 
Sbjct: 662 QCKVCQRTSTTYQPFSVLSVPVPSTRT----------CTLTDCFTEFTKIETLEQEEQWS 711

Query: 822 CPKC 825
           CP C
Sbjct: 712 CPSC 715

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 48/103 (46%), Gaps = 28/103 (27%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNI-----------VLKNNETL--------- 968
            LP  L+IHL RF  ++  KN   ++YP +L++           V  NN  L         
Sbjct: 730  LPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPSRGQVPPF 788

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD 1011
             Y+LY +  H+G L +GHYT+ VNK            W Y+DD
Sbjct: 789  NYQLYGIACHDGTLRAGHYTAYVNKGAVLG-------WCYYDD 824

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  104 bits (260), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 119/276 (43%), Gaps = 41/276 (14%)

Query: 575 PMRQRQFSVPTIE--RSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNY 632
           P+ Q   S   I+  R++ +Y      GL NLG +CY+N ++QCL  T+    +F   +Y
Sbjct: 497 PLSQHSQSQTLIQSPRASAQYDLDFSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSY 556

Query: 633 ERF--FNPELEDTGKLSKSFSVLIRKMYMNGG----------------CSVVPTSFLKIC 674
           +    FN +L   G L+K FS L+  MY                     +V P +F   C
Sbjct: 557 KNHINFNSKLGSKGVLAKYFSQLVHNMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIAC 616

Query: 675 NFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYK 734
             +   F     QQD QEF    +D LH++L NQ      +P L     E  K+ +E+  
Sbjct: 617 GTINSLFR-DCSQQDCQEFCQFLLDGLHEDL-NQC---GGNPRLKELSEEAEKI-REKLS 670

Query: 735 QWFENSL-----INTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXX 789
               +S+     + T FS I  +FQGQ  + L C+ CG        F +LS+ +P     
Sbjct: 671 MRIASSIEWERYLTTDFSVIVDLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPSLKS- 729

Query: 790 XXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                     N+ DC   FT  E + ++  W CP C
Sbjct: 730 ---------CNILDCFQEFTKVETLEKDEQWSCPDC 756

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 35/135 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------L 968
            LP  L+IHL RF  ++  KN   ++YP  L++           L    T           
Sbjct: 771  LPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTELPTRGQVPPF 829

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
             Y+LYAV +H G L  GHYT+ V+K        +++ W YFDD       ++   S+  N
Sbjct: 830  SYKLYAVASHTGTLYGGHYTAYVHK-------GSQRGWCYFDD-------TNWRRSRSDN 875

Query: 1029 KVSSKDVYVLFYERI 1043
            +  + + YVLFY R+
Sbjct: 876  ECITSNAYVLFYHRV 890

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 338 LSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDE-RLK 396
           L N    + +LLIDLR +  +  ++I +P+++ I+P    D  +   +   S++     +
Sbjct: 167 LQNLMAASSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNCE 226

Query: 397 NSIFNKRGSFDFIVYYT 413
             +F+KR +F FIV YT
Sbjct: 227 IELFSKRDTFQFIVLYT 243

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 107/241 (44%), Gaps = 30/241 (12%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRK 656
            GL N+G +CYIN ++QCL  T+   ++F  ++YER    N +L   G L+K F+ LI +
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 657 MYMNGGC-------SVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
           M+ +          +V P  F   C  +   F     QQD+QEF    +D LH++L NQ 
Sbjct: 575 MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL-NQC 632

Query: 710 EVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLHCK 764
                +P L     E  K+ +E       +S+     +   FS I  +FQGQ  + L CK
Sbjct: 633 ---GGNPPLKELSEEAEKM-RERLSMRIASSIEWERYLTRDFSVIVDLFQGQYASQLRCK 688

Query: 765 KCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPK 824
            C         F IL+  +P                L DC   FT  E + ++  W CP 
Sbjct: 689 VCNHTSTTYQPFSILAAPVPHAKS----------CYLLDCFKEFTKLEQLEKDEEWLCPY 738

Query: 825 C 825
           C
Sbjct: 739 C 739

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (47%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------- 967
            LP  L+IHL RF  +L  KN  ++ YP  L++           L    T           
Sbjct: 754  LPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELPSRGQVAP 812

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
             KY+LYAV +H+G+L  GHYT+ V+K  +       + WYYFDD      T +  +    
Sbjct: 813  FKYKLYAVASHSGSLYGGHYTAYVDKGLN-------KGWYYFDD------TGYRPMRTPT 859

Query: 1028 NKVSSKDVYVLFYERI 1043
              ++S + YVLFY R+
Sbjct: 860  ECITS-NAYVLFYHRV 874

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 57/105 (54%), Gaps = 13/105 (12%)

Query: 316 EVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRM 375
           E+ + K L+    I++ EL  +L  K +   +LL+D+R +S ++  +I A N++ I+P  
Sbjct: 141 EISSDKELKTGGFISAKELEFLL--KSDDRNILLVDVRQRSEFEETHIKASNVICIEP-- 196

Query: 376 LWDVNTKTPVTDISVLDERLKNS------IFNKRGSFDFIVYYTD 414
              ++ K+  TD+ +  + +  S      IF +R  F F++ YTD
Sbjct: 197 ---ISFKSSYTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTD 238

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 110/256 (42%), Gaps = 51/256 (19%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIR 655
           I GL+N+G +CY+N ++QCL  T+    +F   ++ER+   N +L   G L+K+ S LI 
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 656 KMY--------------MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
            MY               +G   + P  F   C  +   F     QQD QEF    +D L
Sbjct: 806 LMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSINNLFK-NCSQQDCQEFCQFLLDAL 864

Query: 702 HD------------ELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPI 749
           H+            ELS + E +     L +     S ++ E Y        + T FS I
Sbjct: 865 HEDLNQCGSNPPLKELSTKAESMREKLSLRI----ASSIEWERY--------LTTDFSVI 912

Query: 750 DKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFT 809
             +FQGQ  + L CK C         F +LS+ IPK         K N +NL DC   FT
Sbjct: 913 VDLFQGQYASRLQCKTCIHTSTTYQPFSVLSVPIPK---------KKN-LNLLDCFKDFT 962

Query: 810 SDEVMSRENAWDCPKC 825
             E +  +  W CP C
Sbjct: 963 KIENLEVDEQWFCPNC 978

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 61/136 (44%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV----------LKNNET----------- 967
            LP  L+IHL RF  +   KN  +I YP IL++           L    T           
Sbjct: 993  LPRNLIIHLKRFD-NNLNKNNNLIDYPFILDLTQFWADDFDGELPPGVTDELPKRGQIPP 1051

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
             KYRLY    H G+L  GHYT+ VNK         R  WYYFDD      T++  +    
Sbjct: 1052 FKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFDD------TNYRPIKNER 1098

Query: 1028 NKVSSKDVYVLFYERI 1043
              +SS + YVLFY RI
Sbjct: 1099 EPISS-NAYVLFYHRI 1113

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  102 bits (254), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 113/260 (43%), Gaps = 27/260 (10%)

Query: 579 RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--F 636
           R+F+   +  +   Y      GL N+G +CY+N +LQC+  TN    +F  ++YE+    
Sbjct: 563 RKFNHSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHINI 622

Query: 637 NPELEDTGKLSKSFSVLIRKMYMNG------GCSVVPTSFLKICNFLRPDFNIPDDQQDA 690
           N +L   G L++ F+ L   M+            V PT F      +   F    +QQD 
Sbjct: 623 NSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDC 681

Query: 691 QEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTK 745
           QEF    +D LH++L NQ      +P L     E  K ++E       +S+     + T 
Sbjct: 682 QEFCQFLLDGLHEDL-NQC---GNNPPLKELSEEAEK-KRELLSLRIASSIEWERFLTTN 736

Query: 746 FSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCI 805
           FS I  +FQGQ  + L C  C         F +LS+ +P              VNL DC 
Sbjct: 737 FSVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPTGTKSS--------VNLMDCF 788

Query: 806 NMFTSDEVMSRENAWDCPKC 825
           N FT  E +  +  W+CP C
Sbjct: 789 NEFTKCEKLEHDEYWNCPTC 808

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (46%), Gaps = 37/137 (27%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--LKNNET------------------- 967
            LP  L+IHL RF   + K N  +I YP  L++     N++                    
Sbjct: 823  LPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPARGQIP 881

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG 1026
              KY LYAV NH G+L  GHYTS VNK          + WYYFDD+  +       L + 
Sbjct: 882  PFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQNYR-------LVKK 927

Query: 1027 VNKVSSKDVYVLFYERI 1043
             ++V + + YVLFY R+
Sbjct: 928  TSEVVNSNAYVLFYRRV 944

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 117/250 (46%), Gaps = 26/250 (10%)

Query: 589 SNNKYVALS-ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGK 645
           +N+K + L  I GL+N+G +CY+N ++QCL  T+    +F  + YER    N +L   G 
Sbjct: 548 TNDKMLDLDFIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGV 607

Query: 646 LSKSFSVLIRKMYMNGGCS-----VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDR 700
           L+K F+ LI  M+ +         V P  F      +   F     QQD QEF    +D 
Sbjct: 608 LAKYFARLIHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQFLLDG 666

Query: 701 LHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQG 755
           LH++L NQ     ++P L    +   K  +E+      +S+     + T FS I  +FQG
Sbjct: 667 LHEDL-NQC---GSNPPLKELSSAAEK-NREKLSLRIASSIEWERFLTTDFSVIVDLFQG 721

Query: 756 QLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMS 815
           Q  + L C+ C         F +LS+ IP+         KG  VN+ DC   FT  E++ 
Sbjct: 722 QYASRLQCEVCKHTSTTYQPFSVLSVPIPR-------VPKGVKVNILDCFKDFTKLELLD 774

Query: 816 RENAWDCPKC 825
            +  W CP C
Sbjct: 775 TDEQWLCPTC 784

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 62/136 (45%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVL-------------------KNNET-- 967
            LP  L+IHL RF  +   KN   I YP IL++                     K  +   
Sbjct: 799  LPRNLIIHLKRFD-NNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDELPKRGQIPP 857

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
             KY+LY V +H G+L  GHYT+ V+K   H        WYYFDD      T++ ++    
Sbjct: 858  FKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDD------TNYRSIKNKN 904

Query: 1028 NKVSSKDVYVLFYERI 1043
              ++S   Y+LFY RI
Sbjct: 905  EPITS-SAYLLFYHRI 919

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (53%), Gaps = 5/102 (4%)

Query: 318 QAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLW 377
           Q +  ++  S+I+S +L  +L  K +   +LLID+R +  +  ++I    ++ ++P    
Sbjct: 154 QELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFK 213

Query: 378 DVNTKTPVTDISVL---DERLKNSIFNKRGSFDFIVYYTDMK 416
           D  +   V   S++   +E +   +FNKR  F+FI+ YT+ K
Sbjct: 214 DSYSDEEVAKKSLITSPNEEI--DLFNKRNEFEFIILYTNDK 253

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 104/243 (42%), Gaps = 33/243 (13%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF--FNPELEDTGKLSKSFSVLIRKM 657
           GL N G +CY++ ++QCL  T     +F  ++Y+     N  L   G L++ FS LI +M
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQM 546

Query: 658 YMNGG----------CSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707
           Y  G            +V+P  F   C  +   F     QQD QEF    +D LH++L N
Sbjct: 547 YQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDL-N 604

Query: 708 QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSL-----INTKFSPIDKIFQGQLENGLH 762
           Q        EL    +E ++  +E       +S+     + T FS I  +FQGQ  + L 
Sbjct: 605 QCGNNPPLKEL----SEKAEKMREMMPMRIASSIEWERYLTTDFSVIVDLFQGQYASQLR 660

Query: 763 CKKCGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDC 822
           CK CG        F +LS+ +P                + DC   FT  E +  +  W C
Sbjct: 661 CKVCGRTSTTYQPFSVLSVPVPSSRQ----------CTIIDCFTEFTKVETLDLDEQWSC 710

Query: 823 PKC 825
           P C
Sbjct: 711 PDC 713

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 59/136 (43%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNI-----------VLKNNET---------- 967
            LP  L+IHL RF  ++  KN   ++Y  +LN+           V+ NN            
Sbjct: 728  LPRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPSRGQVPP 786

Query: 968  LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              Y+LY V  H G L  GHYT+ VNK            W Y+DD   +   S        
Sbjct: 787  FNYQLYGVACHTGTLYGGHYTAYVNKGATLG-------WCYYDDTNWRQIRSS------- 832

Query: 1028 NKVSSKDVYVLFYERI 1043
            N+  S++ YVLFY RI
Sbjct: 833  NEYISQNAYVLFYHRI 848

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 115/272 (42%), Gaps = 32/272 (11%)

Query: 570 QLDSYPMRQRQFSVPTIERSNNKYVALSIT-GLRNLGATCYINSMLQCLFATNMFRDLFE 628
           QL   P    + + P    S N+ +  S T GL N+G +CYIN ++QC+FAT     +F 
Sbjct: 495 QLPPIPSTLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFL 554

Query: 629 PSNYERFFNPE--LEDTGKLSKSFSVLIRKMYMNGGC--------SVVPTSFLKICNFLR 678
              Y +  N +  L   G LS +F+ L++ MY             +V    F   C  + 
Sbjct: 555 NGTYAKHINKQSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVN 614

Query: 679 PDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFE 738
             F     QQD  EF    +D LH++L NQ     A+P L     E  K+ +E       
Sbjct: 615 SLFK-DASQQDCLEFCQFLLDGLHEDL-NQC---GANPPLKELSPEAEKM-RENLSLRVA 668

Query: 739 NSL-----INTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIPKPXXXXXXX 793
           +S+     + T FS I  +FQGQ  + L CK C         F +LS+ +P         
Sbjct: 669 SSIEWERYLTTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVP--------- 719

Query: 794 XKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
             G    L DC   FT  E +  +  W CP C
Sbjct: 720 -SGKSCGLLDCFIEFTKTENLEVDEQWFCPSC 750

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 58/136 (42%), Gaps = 36/136 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIV--LKNNETLK----------------- 969
            LP  L+IHL RF  ++  KN   + YP IL++     N+   K                 
Sbjct: 765  LPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGITDEIPARGQVPP 823

Query: 970  --YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGV 1027
              YRLY    H G L  GHYTS V+K  +       + W YFDD V +         +  
Sbjct: 824  FNYRLYGAACHFGTLYGGHYTSYVDKGPE-------KGWIYFDDTVYRP-------VRFQ 869

Query: 1028 NKVSSKDVYVLFYERI 1043
            N+  S   YVLFY RI
Sbjct: 870  NEFISPSAYVLFYHRI 885

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 327 SIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVT 386
           S I+  EL S++  K + + LLLID+R +  Y  ++I   N++ I+P    +  +   + 
Sbjct: 188 SGISCSELLSLM--KMKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIE 245

Query: 387 DISVL-DERLKNSIFNKRGSFDFIVYYTDMK 416
             S++   + +  +F +R  F +I+ YTD++
Sbjct: 246 KTSMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 123/538 (22%), Positives = 211/538 (39%), Gaps = 55/538 (10%)

Query: 316 EVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRM 375
           +V+    L     +T P+L +ILS++K    +LLID+R +  ++F++I +  ++ +DP  
Sbjct: 147 KVEGGHNLPSGPFLTVPQLQTILSDQKIS--VLLIDVRKRYEFEFSHINSVAVLPLDPIS 204

Query: 376 LWDVNTKTPVTDISVLDERLKN-SIFNKRGSFDFIVYYT---DMKTYMEMDFDYLFVFYN 431
                T   +  IS ++  +    +F KR  +D IV YT   D+  Y       L     
Sbjct: 205 FKPTYTIDQLEKISFINSPMHELQLFQKRNEYDVIVLYTKDNDITAYYYKQMMSLLAILL 264

Query: 432 LVVASQEVSLRSLPS------YLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSSNKEGK 485
             +                  +L GG+ +W + + K        +   L   Y +N    
Sbjct: 265 NHLHHHHHHHHHHNIKYPKILFLKGGFSEWVSHVSKS------EIVSNLSDGYKNNNNNS 318

Query: 486 EKSANAKHIEPVPWKPPALPERMRNLXXXXXXATLPITKEMPPPVPPKIQLEQQEDKNHT 545
                 K   PV   P  +P  M  +        +P  + + P  P  I + +    N  
Sbjct: 319 NNIPCIK--RPVTTSPHQIPISM--VGSAPQPPQIPPPRNIYPSPPQTIPIIKN---NAN 371

Query: 546 RPRSRTVSSPAEVPKNVVAPEQL----SQLDSYPMRQRQFSVPTIERSNNKYVALSITGL 601
              ++ + +P  +  N   P+ +          P+ +    V     S  KY    I GL
Sbjct: 372 VTNAKNLITPQGIMTNRSIPDAIVTAIPTPSPPPLPRIPMKVGGTNESIWKYNPTIIIGL 431

Query: 602 RNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKMY- 658
            N+  +CY+N ++QCL +      +   +++ +  N E  L   G + K F+ LI+ M+ 
Sbjct: 432 ENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQDMHS 491

Query: 659 --MNGGCS-----VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
             +  G S     V    F   C  +   ++    QQD QEF    +D LH++L+   + 
Sbjct: 492 QQVKTGRSLFSYPVKTIDFKNACASVSSIYS-GSQQQDCQEFCEFLLDGLHEDLN---QC 547

Query: 712 LNAHPELLLYDAE----TSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCG 767
               P   L D E         +      +EN L N  FS I  +F GQ  + L C  C 
Sbjct: 548 GGNPPARELTDQEERLREGLCMRVASSMAWENFLHN-NFSLIIDLFAGQYGSQLRCCVCQ 606

Query: 768 XXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                   F +LS+ +P          + +  ++ DC   FT  E + ++  W CP+C
Sbjct: 607 YTSTTYQPFTLLSVPVP-------LSSRVSRCSIIDCFQEFTKCERLDKDEEWFCPQC 657

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 60/140 (42%), Gaps = 43/140 (30%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNI--------------------VLKNNET- 967
            LP  L+IH  RF  ++  KN   I YP  L++                    + K  +  
Sbjct: 672  LPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGMTNSLLTKGGQVG 730

Query: 968  -LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDE---VVKHETSHGNL 1023
              KY+L AV  H G L SGHYT+ VNK  D         WYYFDD    +VK  T + N 
Sbjct: 731  PFKYQLNAVACHMGTLGSGHYTAYVNKGPDVG-------WYYFDDSSHRIVKIATEYMN- 782

Query: 1024 SQGVNKVSSKDVYVLFYERI 1043
                      D Y+LFY R+
Sbjct: 783  ---------PDAYLLFYHRV 793

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 92/193 (47%), Gaps = 11/193 (5%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKM 657
           GL NLG TCY+NS LQCL     F+D F  + YE+  N E  L   G ++ +F+ +++ +
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 658 Y---MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNA 714
           +    +   S  P +F      L   F+    QQD+QEFL   +D LH++L+   E    
Sbjct: 407 FGKRHSAATSYSPRNFKNTIGHLNSMFS-GYQQQDSQEFLAFLLDGLHEDLNRIIEKPYV 465

Query: 715 H-PELLLYD--AETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXX 771
             PEL   D  AE   ++K     W ++ L N   S I  +F G  ++ L C  C     
Sbjct: 466 EKPELTSTDDTAEFKVIKKLADDTWGKHKLRND--SVITDLFVGLYKSTLICPVCKKTSV 523

Query: 772 XXXTFYILSLAIP 784
               +  L+L +P
Sbjct: 524 TFDPYNDLTLPLP 536

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 54/121 (44%), Gaps = 24/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYP-----LILNIVLKNNETLK-YRLYAVVNHNGN 981
            P +L+IHL RF      + K    + +P     +   +V KN +    Y L AV NH G 
Sbjct: 1004 PDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGG 1063

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V KN D        +WYYFDD  V       ++        +   Y+LFY 
Sbjct: 1064 LGGGHYTAYV-KNID-------GKWYYFDDSRVSETLPERSI--------AGSAYLLFYR 1107

Query: 1042 R 1042
            R
Sbjct: 1108 R 1108

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L DC+ +F++ EV+   ++W CP C
Sbjct: 962 ITLHDCLTLFSTPEVLGATDSWFCPNC 988

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 75.5 bits (184), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 94/195 (48%), Gaps = 15/195 (7%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKM 657
           GL NLG TCY+NS LQCL      RD F    +E+  N +  L   G +++SF++LI+ +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNL 402

Query: 658 YMNG---GCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT----- 709
           + +      S  PT+F          F+    QQD+QEF+   +D LH++L+  T     
Sbjct: 403 FKDELLPSLSYSPTTFKSTVGHFNSMFS-GYLQQDSQEFIAFLLDGLHEDLNRITNKPVV 461

Query: 710 EVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXX 769
           E  +  PE  + + E   ++K     W  NS +    S I  IF G  ++ LHC +C   
Sbjct: 462 EKPSLKPEDDVSNQEV--IKKLADDTW--NSHLLRNDSIITDIFVGLYKSTLHCPECDNL 517

Query: 770 XXXXXTFYILSLAIP 784
                 +  L+L +P
Sbjct: 518 SVTFDPYNDLTLPLP 532

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 23/123 (18%)

Query: 928  TLPPVLVIHLSRF--YYDLTKKNETVITYPLI---LNIVLKNNETLK---YRLYAVVNHN 979
            + P +L+IHL RF      + K +  + +P+    L+  + NN+  K   Y L +V NH 
Sbjct: 949  STPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLVSVDNHY 1008

Query: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039
            G L  GHYT+ V    D       ++WYYFDD  V       +++           Y+LF
Sbjct: 1009 GGLGGGHYTAYVKNFVD-------KKWYYFDDSRVTETVPERSIAGS--------AYLLF 1053

Query: 1040 YER 1042
            Y R
Sbjct: 1054 YMR 1056

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L+DC+N+F   EV+   ++W CP C
Sbjct: 909 ITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 94/198 (47%), Gaps = 11/198 (5%)

Query: 595 ALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSV 652
           +L ITGL NLG TCY+NS LQC+    +FR+ F  S YE+  N +  L   G ++++FS 
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEAFSE 376

Query: 653 LIRKMY---MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
           LIR ++   +    +  P  F          F+    QQD+QEFL   +D LH++L+   
Sbjct: 377 LIRCLFGDKLVQFSAYAPNHFKATIGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDLNRID 435

Query: 710 EVLNAHPELLLYDAETSK---VQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKC 766
           +        L   A+ +    V+K     W  + L N   S I  +F G  ++ L C +C
Sbjct: 436 KKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND--SVITDLFVGLYKSTLECPEC 493

Query: 767 GXXXXXXXTFYILSLAIP 784
                    +  L+L +P
Sbjct: 494 QNISITFDPYNDLTLPLP 511

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 56/121 (46%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLI-----LNIVLKNNETLK-YRLYAVVNHNGN 981
            P VL+IHL RF      + K + V+ +P+       ++V K++     Y L AV NH G 
Sbjct: 938  PDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLIAVDNHYGG 997

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+    + D        +WYYFDD  V    +  +++           Y+LFY 
Sbjct: 998  LGGGHYTAYAKNSTD-------GKWYYFDDSRVTETVAENSITGA--------AYLLFYL 1042

Query: 1042 R 1042
            R
Sbjct: 1043 R 1043

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 795 KGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           K   + L DC+N+F+  E++S  ++W CP C
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 93/200 (46%), Gaps = 12/200 (6%)

Query: 595 ALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSV 652
           A   TGL NLG TCY+NS LQCL      RD F  + YE+  N E  L   G ++++FS 
Sbjct: 357 ASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSD 416

Query: 653 LIRKMYMNG------GCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           LI+K++ N         +  PT F          F+    QQD+QEFL   +D LH++L+
Sbjct: 417 LIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDLN 475

Query: 707 NQTEVLNAHPELLLYDAETS--KVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCK 764
              +        L  D + +   V K+     +E  L   + S I  +F G  ++ L+C 
Sbjct: 476 RIIKKAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-SVITDLFVGMYKSTLYCP 534

Query: 765 KCGXXXXXXXTFYILSLAIP 784
           +C         +  ++L +P
Sbjct: 535 ECKDVSTTFDPYNDVTLPLP 554

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 56/122 (45%), Gaps = 25/122 (20%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLILNIVLKNNETLK-------YRLYAVVNHNG 980
            P +L+IHL RF      + K +  + +P I ++ L  +   K       Y LYAV NH G
Sbjct: 1003 PDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDLYAVDNHYG 1061

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             L  GHYT+ V    D+       +WYYFDD  V  ET   N   G         Y+LFY
Sbjct: 1062 GLGGGHYTAYVKNFMDN-------KWYYFDDSRVT-ETVPENSVAG-------SAYLLFY 1106

Query: 1041 ER 1042
             R
Sbjct: 1107 IR 1108

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L DC+ +F+  E++   ++W CP C
Sbjct: 961 ITLNDCLQLFSKPEILGLNDSWYCPTC 987

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 91/203 (44%), Gaps = 23/203 (11%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLI 654
            ITGL NLG TCY+NS LQCL      RD F    +    N +  L   G ++K+FS+L+
Sbjct: 300 GITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLV 359

Query: 655 RKMYMNGGCSVVPTSF--------LKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           + ++     S    +F        +  CN +   +     QQD+QEFL   +D LH++L+
Sbjct: 360 KSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDGLHEDLN 415

Query: 707 N-----QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761
                   E  +  P   + D +T K   E+   W  + L N   S +  +F    E+ L
Sbjct: 416 RVHDKPYIEKPSLSPNSDVTDRDTIKKLAED--TWKMHLLRND--SIVTDLFVALYESTL 471

Query: 762 HCKKCGXXXXXXXTFYILSLAIP 784
            C +C         +  L+L +P
Sbjct: 472 ECPECRNVSITFDPYNDLTLPLP 494

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 24/122 (19%)

Query: 928  TLPPVLVIHLSRF--YYDLTKKNETVITYP-----LILNIVLKNNETLKYRLYAVVNHNG 980
            + P VL+IHL RF      + K +  + +P     +  ++V ++     Y L AV NH G
Sbjct: 910  STPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIAVDNHFG 969

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             L  GHYT+ V  N          +W+YFDD  V       +++           Y+LFY
Sbjct: 970  GLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPESSIAGS--------AYLLFY 1012

Query: 1041 ER 1042
             R
Sbjct: 1013 LR 1014

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           ++L DC+ +F+  EV+S  ++W CP C
Sbjct: 870 ISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 88/193 (45%), Gaps = 11/193 (5%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKM 657
           GL NLG TCY+NS LQCL     F+D F  + YE+  N +  L   G ++ +F  LI+ +
Sbjct: 350 GLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQSL 409

Query: 658 YM---NGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNA 714
           +    N   S  P  F      L   F     QQD+QEFL   +D LH++L+   +    
Sbjct: 410 FGKRNNLISSYSPRHFKTTIGHLNSMF-AGYQQQDSQEFLAFLLDGLHEDLNRIVDKPYV 468

Query: 715 H-PELLLYD--AETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXX 771
             PEL   D   E   ++K     W ++ L N   S I  +F G  ++ L C  C     
Sbjct: 469 EKPELNPTDDVTEFETIKKLADDTWLKHKLRND--SVILDLFVGLYKSTLICPTCKKVST 526

Query: 772 XXXTFYILSLAIP 784
               +  L+L +P
Sbjct: 527 TFDPYNDLTLPLP 539

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLI-LN----IVLKNNE-TLKYRLYAVVNHNGN 981
            P +L+IHL RF      + K   ++ +P+  L+    +V K+++    Y L AV NH G 
Sbjct: 979  PDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLIAVDNHYGG 1038

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V    D+       +WYYFDD  V       +++           Y+LFY 
Sbjct: 1039 LGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERSIAGS--------AYLLFYR 1083

Query: 1042 R 1042
            R
Sbjct: 1084 R 1084

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L DC+ +F++ EV+   ++W CP C
Sbjct: 937 ITLHDCLTLFSTPEVLGATDSWYCPSC 963

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 92/212 (43%), Gaps = 27/212 (12%)

Query: 590 NNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLS 647
           NN      I GL NLG TCY+NS LQCL      RD F    YE+  N +  L   G ++
Sbjct: 280 NNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVA 339

Query: 648 KSFSVLIRKMY-----MNGGCSVVPTSF---LKICNFLRPDFNIPDDQQDAQEFLMLTID 699
            +F  LI+ +Y          S  P  F   L   N +   +     QQD+QEFL   +D
Sbjct: 340 TAFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYM----QQDSQEFLAFLLD 395

Query: 700 RLHDELSN-------QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKI 752
            LH++L+        +   L    EL    A+ + V++   K W  ++ +    S I+ +
Sbjct: 396 SLHEDLNRIHDKPYIEKPTLETSEEL----ADENAVKQLAKKTW--DAHLARNDSVINDL 449

Query: 753 FQGQLENGLHCKKCGXXXXXXXTFYILSLAIP 784
           F G  ++ L C  C         +  L+L +P
Sbjct: 450 FVGMYKSTLKCPTCKNISITFDPYNDLTLPLP 481

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (47%), Gaps = 27/121 (22%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPL--------ILNIVLKNNETLKYRLYAVVNHN 979
            P +L+IHL RF      + K + V+ +P+        +++ V+++     Y L+AV NH 
Sbjct: 887  PEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDG--CIYDLFAVDNHY 944

Query: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039
            G L  GHYTS V  N D+       +WYYFDD  V         S    K  +   Y+LF
Sbjct: 945  GGLGGGHYTSYVKNNIDN-------RWYYFDDSRVS--------STDPKKSVAGSAYLLF 989

Query: 1040 Y 1040
            Y
Sbjct: 990  Y 990

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 797 NWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           N + L+ C+ +F+  EV+   ++W CPKC
Sbjct: 843 NIITLDSCLKLFSKPEVLGINDSWYCPKC 871

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 90/200 (45%), Gaps = 12/200 (6%)

Query: 595 ALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSV 652
           A   TGL NLG TCY+NS LQCL      RD F    YE   N E  L   G ++++FS 
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSD 419

Query: 653 LIRKMY------MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           LI+K++      M    +  P+ F          F+    QQD+QEFL   +D LH++L+
Sbjct: 420 LIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDLN 478

Query: 707 N--QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCK 764
              + E +         D +   V K+     +E  L     S I  +F G  ++ L+C 
Sbjct: 479 RIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHL-KRNCSVITDLFVGMYKSTLYCP 537

Query: 765 KCGXXXXXXXTFYILSLAIP 784
           +C         +  ++L +P
Sbjct: 538 ECKNVSITFDPYNDVTLPLP 557

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 57/121 (47%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYP-----LILNIVLKNNETLK-YRLYAVVNHNGN 981
            P +L+IHL RF      + K +  + +P     L  N+V K++     Y LYAV NH G 
Sbjct: 1000 PDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGG 1059

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V      +  NN+  WYYFDD  V       +++           Y+LFY 
Sbjct: 1060 LGGGHYTAYV-----KNFANNK--WYYFDDSRVTETVPENSIAGS--------AYLLFYI 1104

Query: 1042 R 1042
            R
Sbjct: 1105 R 1105

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L+DC+ +F+  E++   ++W CP C
Sbjct: 958 ITLDDCLQLFSKPEILGLSDSWYCPTC 984

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 90/196 (45%), Gaps = 16/196 (8%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKM 657
           GL NLG TCY+NS LQCL      RD F  + +E+  N    L   G +++SF  LI+ +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHGLIQSL 381

Query: 658 YMNGGCS----VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN-----Q 708
           + +        V PT F          F+    QQD+QEFL   +D LH++L+       
Sbjct: 382 FGDSIAPFPSYVSPTHFKSTLVHFNSMFS-GFQQQDSQEFLAFLLDSLHEDLNRIVEKPY 440

Query: 709 TEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGX 768
            E  +  P   + D +T  ++K   + W  + + N   S I  IF G  ++ L C +C  
Sbjct: 441 VEKPSLKPGDDINDFDT--IKKLANETWKSHLMRND--SIITDIFVGMYKSTLECPECSN 496

Query: 769 XXXXXXTFYILSLAIP 784
                  +  L+L +P
Sbjct: 497 VSITFDPYNDLTLPLP 512

 Score = 38.9 bits (89), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 53/124 (42%), Gaps = 29/124 (23%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLILNIVLKNNETLKYR---------LYAVVNH 978
            P V +IHL RF      + K +  I +P+     L  +E L Y+         L AV NH
Sbjct: 935  PDVFLIHLKRFENTRSFSDKIDATILFPIE---DLDMSEYLVYKDDPRGSVYDLIAVDNH 991

Query: 979  NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVL 1038
             G +  GHYT+ V    D       Q WYYFDD  V   +   +++           Y+L
Sbjct: 992  YGGMGGGHYTAYVKNLTD-------QNWYYFDDSRVSKTSPEKSIAGS--------AYLL 1036

Query: 1039 FYER 1042
            FY R
Sbjct: 1037 FYLR 1040

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 801 LEDCINMFTSDEVMSRENAWDCPKC 825
           L+DC+N+F+  EV+   ++W CP C
Sbjct: 895 LKDCLNLFSKKEVLGMSDSWYCPNC 919

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 89/197 (45%), Gaps = 14/197 (7%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRK 656
           TGL NLG TCY+NS LQCL      RD F  + YE   N E  L   G ++++FS L++K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 657 MY------MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTE 710
           ++      M    +  P+ F          F+    QQD+QEFL   +D LH++L+   +
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDLNRIIK 482

Query: 711 VLNAHPELLLYDAETSK---VQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCG 767
                   L  D + +    V+K     W     +    S I  +F G  ++ L+C +C 
Sbjct: 483 KAYIEKPSLSPDDDVNDWNVVKKLADDTW--EMHLKRNCSVITDLFVGLYKSTLYCPECK 540

Query: 768 XXXXXXXTFYILSLAIP 784
                   +  ++L +P
Sbjct: 541 NVSITFDPYNDVTLPLP 557

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLIL-----NIVLKNNETLK-YRLYAVVNHNGN 981
            P +L++HL RF      + K +  + +P+       ++V K++     Y LYAV NH G 
Sbjct: 1006 PDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLYAVDNHYGG 1065

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V    D        +WYYFDD  V       ++S           Y+LFY 
Sbjct: 1066 LGGGHYTAYVKNFAD-------SKWYYFDDSRVTETVPENSISGS--------AYLLFYI 1110

Query: 1042 R 1042
            R
Sbjct: 1111 R 1111

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L+DC+ +F+  E++   ++W CP C
Sbjct: 964 ITLDDCLQLFSKPEILGLNDSWYCPTC 990

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 90/203 (44%), Gaps = 18/203 (8%)

Query: 595 ALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSV 652
           A   TGL NLG TCY+NS LQCL      RD F    YE   N E  L   G ++++FS 
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSD 419

Query: 653 LIRKMY------MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           L++K++      M    +  P+ F          F+    QQD+QEFL   +D LH++L+
Sbjct: 420 LVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDLN 478

Query: 707 -----NQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761
                  TE  +  P   + D     V+K     W     +    S I  +F G  ++ L
Sbjct: 479 RIIKKEYTEKPSLSPGDDVNDWNV--VKKLADDTW--EMHLKRNCSVITDLFVGMYKSTL 534

Query: 762 HCKKCGXXXXXXXTFYILSLAIP 784
           +C +C         +  ++L +P
Sbjct: 535 YCPECQNVSITFDPYNDVTLPLP 557

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 58/121 (47%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYP-----LILNIVLKNN-ETLKYRLYAVVNHNGN 981
            P +L+IHL RF      + K +  + +P     L   +V K++   L Y LYAV NH G 
Sbjct: 1004 PDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLYAVDNHYGG 1063

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V    D+       +WYYFDD  V  ET+  N   G         Y+LFY 
Sbjct: 1064 LGGGHYTAYVKNFADN-------KWYYFDDSRVT-ETAPENSIAG-------SAYLLFYI 1108

Query: 1042 R 1042
            R
Sbjct: 1109 R 1109

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L+DC+ +F+  E++   ++W CP C
Sbjct: 962 ITLDDCLQLFSKPEILGLTDSWYCPTC 988

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
            Anc_8.188 YDR069C
          Length = 671

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 62/124 (50%), Gaps = 20/124 (16%)

Query: 923  ATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLK----YRLYAVVNH 978
             T    +P VL+IH +RF  +L  K E  + YP +L++   N    K    Y+L AV  H
Sbjct: 562  GTTITNVPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACH 620

Query: 979  NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVL 1038
             G L SGHYT+   KN ++        WY+FDD   K   S+G       +  S+  Y+L
Sbjct: 621  TGTLFSGHYTAYCFKNSENG-------WYHFDDTQCK-PVSNG-------ECISQSAYLL 665

Query: 1039 FYER 1042
            FY++
Sbjct: 666  FYQK 669

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 101/234 (43%), Gaps = 29/234 (12%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF--NPELEDTGKLSKSFSVLIR 655
           I G++N G  CY+N ++QCL     F + F  + Y      N  L   G + K+++ +I+
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVVKNWAKIIQ 402

Query: 656 KMYMNGGCSVVP----TSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
             +     ++ P    T F +    L P++     Q D  EF +  ++ +H++ SN    
Sbjct: 403 AFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHED-SNWGRP 460

Query: 712 LNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXX 771
            N+           + +Q ++Y++ + N       S I   F+GQ+++ L C+ C     
Sbjct: 461 QNS----------DAAMQVDDYREAW-NLYRKGNSSYIVDTFKGQIKSQLTCQVCQTQSN 509

Query: 772 XXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
               F IL+L IP            +  ++ DC+       V++ ++ W C  C
Sbjct: 510 NYEPFSILNLPIPLV----------SMCHIYDCMKELFKVHVLTGDDRWYCSTC 553

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 91/199 (45%), Gaps = 17/199 (8%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLI 654
            I GL NLG +CY+NS LQCL      RD F    +E+  N    L   G+++++F+ L+
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 655 RKMYMNGGCSV---VPTSFLKIC---NFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN- 707
           + ++ +   ++    P +F  I    N +   F     QQD+QE L   +D LH++L+  
Sbjct: 356 KSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFL----QQDSQELLAFLLDGLHEDLNRI 411

Query: 708 QTEVLNAHPELLLYD--AETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
             +     PEL   D   +   ++      W ++ L N   S I  +F G  ++ L C  
Sbjct: 412 MKKPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNE--SVIVDLFVGLYKSTLTCPA 469

Query: 766 CGXXXXXXXTFYILSLAIP 784
           C         F  L+L +P
Sbjct: 470 CDRVSVTFDPFSDLTLPLP 488

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLIL-----NIVLKN-NETLKYRLYAVVNHNGN 981
            P +L IHL RF   +  + K   V+ +P+       ++V  + N+   Y L AV NH G 
Sbjct: 914  PDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYDLIAVDNHYGG 973

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V    D        +WYYFDD  V    +   +S           Y+LFY 
Sbjct: 974  LGGGHYTAYVKNFMD-------GKWYYFDDSRVSETEAERAISGA--------AYLLFYR 1018

Query: 1042 R 1042
            R
Sbjct: 1019 R 1019

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 781 LAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           +A+ +         KG+ ++L DC+ +F+  EV+   ++W CP C
Sbjct: 855 MALEEAQKHRSEQEKGH-ISLTDCLELFSKSEVLGAADSWYCPNC 898

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 93/209 (44%), Gaps = 20/209 (9%)

Query: 590 NNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLS 647
           N+ + A    GL NLG TCY+NS LQCL      RD F  S YE   N +  +   G ++
Sbjct: 314 NDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVA 373

Query: 648 KSFSVLIRKMY------MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
           K+FS L++ ++           S  P  F          F+    QQD+QEFL   +D L
Sbjct: 374 KAFSSLVQNLFGDTITKQGTNSSFGPNHFKSTVGHFNSMFS-GYLQQDSQEFLAFLLDSL 432

Query: 702 HDELSNQTEVLN----AHPELLLYD--AETSKVQKEEYKQWFENSLINTKFSPIDKIFQG 755
           H++L+    ++N      P L   D   + + ++    + W  + L N   S I  +F G
Sbjct: 433 HEDLN---RIINKPSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRND--SVITDLFVG 487

Query: 756 QLENGLHCKKCGXXXXXXXTFYILSLAIP 784
             ++ L C +C         +  L+L +P
Sbjct: 488 MYKSTLECPECTNVSITFDPYSDLTLPLP 516

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 58/122 (47%), Gaps = 25/122 (20%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLILNI------VLKNN-ETLKYRLYAVVNHNG 980
            P VL+IHL RF      + K +  + +P I N+      V K++     Y LYAV NH G
Sbjct: 914  PDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDLYAVDNHYG 972

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             L  GHYT+ V    D+       +WYYFDD  V +ET          K  S   Y+LFY
Sbjct: 973  GLGGGHYTAYVKNFIDN-------KWYYFDDSRV-YETDP-------EKSVSGSAYLLFY 1017

Query: 1041 ER 1042
             R
Sbjct: 1018 LR 1019

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 5/41 (12%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEKSESNQR 839
           + L DC+N+F+  EV+   ++W CP C     KE  ++++R
Sbjct: 872 ITLNDCLNLFSKREVLGLNDSWYCPHC-----KEHRQASKR 907

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 89/197 (45%), Gaps = 17/197 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRK 656
           TGL NLG +CY+NS LQCL      +D F    YE   N +  L   G ++++F+ LI+ 
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 657 MY---MNGGCSVVPTSFLKIC---NFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTE 710
           ++    +   +  P  F  I    N +   F     QQD+QEFL   +D LH++L+   E
Sbjct: 394 LFDERSSSAFAFSPREFKSIIGQQNSMFAGFL----QQDSQEFLAFLLDGLHEDLNRIIE 449

Query: 711 VLNAHPELLLYDAETSK---VQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCG 767
                   L  D + +    + +   K W ++ L N   S I  +F G  ++ L C  C 
Sbjct: 450 KPFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRND--SVILDLFVGLYKSTLTCPVCD 507

Query: 768 XXXXXXXTFYILSLAIP 784
                   +  L+L +P
Sbjct: 508 KTSVTFDPYSDLTLPLP 524

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLI-LN----IVLKNNETLK-YRLYAVVNHNGN 981
            P +L IHL RF   +  + K   V+ +P+  LN    +V ++ E    Y L AV NH G 
Sbjct: 945  PDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGG 1004

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+      D        +WYYFDD  V       ++S           Y+LFY 
Sbjct: 1005 LGGGHYTAFAKNPVD-------GKWYYFDDSRVSETDPETSVSGA--------AYLLFYR 1049

Query: 1042 R 1042
            R
Sbjct: 1050 R 1050

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           ++L DC+ +F+  EV+S  ++W CP C
Sbjct: 903 ISLFDCLKLFSKPEVLSAADSWYCPTC 929

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 88/206 (42%), Gaps = 26/206 (12%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLI 654
            ITGL NLG TCY+NS LQCL      RD F  + +E   N    L   G ++++FS L+
Sbjct: 291 GITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSGLV 350

Query: 655 RKMYMNGGCSVV-----------PTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHD 703
           + ++   GC  +           PT F          F+    QQD+QEF+   +D LH+
Sbjct: 351 QNLF---GCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFS-GYMQQDSQEFITFLLDGLHE 406

Query: 704 ELSN-----QTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLE 758
           +L+        E  +  PE    D    K   E+  +      +    S I  +F G  E
Sbjct: 407 DLNRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLH----LQRNDSVITDLFVGLYE 462

Query: 759 NGLHCKKCGXXXXXXXTFYILSLAIP 784
           + L C +C         +  L+L +P
Sbjct: 463 STLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYPLI---LNIVLKNNETLK---YRLYAVVNHNGN 981
            P VL+IHL RF      + K + V+ +P+    ++  L N    +   Y L AV NH G 
Sbjct: 922  PDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLVAVDNHYGG 981

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+   KN D        +WYYFDD  V   T    ++           Y+LFY 
Sbjct: 982  LGGGHYTAYA-KNVDD------SKWYYFDDSRVTETTPERGIASS--------AYLLFYV 1026

Query: 1042 R 1042
            R
Sbjct: 1027 R 1027

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L DC+ +F+  EV+   ++W CP C
Sbjct: 880 ITLHDCLKLFSKREVLGMNDSWYCPSC 906

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRK 656
            GL NLG TCY+NS LQCL      RD F+   Y+   N +  L   G ++ +FS L++ 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPLGFQGNIANAFSALVQN 457

Query: 657 MYMNG---GCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           +Y N      S  P+ F          F+    QQD+QEFL   +D LH++L+
Sbjct: 458 LYKNQFIPSASYAPSQFKLTIGHYNQMFS-GYFQQDSQEFLAFLLDGLHEDLN 509

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 56/123 (45%), Gaps = 23/123 (18%)

Query: 928  TLPPVLVIHLSRFYY--DLTKKNETVITYP-----LILNIVLKNNETLK-YRLYAVVNHN 979
            + P +L IHL RF      + K + V+ +P     L  +I+ K+   L  Y L AV NH 
Sbjct: 1002 STPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLIAVDNHY 1061

Query: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039
            G L  GHYT+ +    D+       +WYYFDD  V       +++           Y+LF
Sbjct: 1062 GGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVPERSVAGS--------AYLLF 1106

Query: 1040 YER 1042
            Y R
Sbjct: 1107 YMR 1109

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + LED +N+F   EV+   ++W CPKC
Sbjct: 962 ITLEDSLNLFERAEVLGINDSWYCPKC 988

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 6/122 (4%)

Query: 590 NNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP--ELEDTGKLS 647
           NN   +    GL NLG TCY+NS LQC+    +FRD F    +++  N    L   G ++
Sbjct: 321 NNLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMA 380

Query: 648 KSFSVLIRKMYMNGGCSVV---PTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDE 704
           ++FS LI+ ++ +   S     P+ F          F+    QQD+QEFL   +D LH++
Sbjct: 381 RAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFNSMFS-GYLQQDSQEFLAFLLDSLHED 439

Query: 705 LS 706
           L+
Sbjct: 440 LN 441

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRFYYDLTKKNETVIT--YPLI-----LNIVLKNNETLK-YRLYAVVNHNGN 981
            P +L+IHL RF    +  ++ V T  +P+       ++V K +     Y L AV NH G 
Sbjct: 981  PDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLIAVDNHYGG 1040

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+      D+       +WYYFDD  V       +++           Y+LFY 
Sbjct: 1041 LGGGHYTAYAKNANDN-------KWYYFDDSRVSVTAPEKSIAGS--------AYLLFYV 1085

Query: 1042 R 1042
            R
Sbjct: 1086 R 1086

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
           + L+DC+ +F+  E++S  ++W CP C
Sbjct: 939 ITLDDCLKLFSKPEILSSNDSWYCPHC 965

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 58.9 bits (141), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 19/183 (10%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP--ELEDTGKLSKSFSVLIRKM 657
           GL NLG+TC+INS+LQCL      RD F  + +    N    L   G+++ +F+ +++ +
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQAL 411

Query: 658 YMNGGC---SVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL--------- 705
           + +      +   ++F     + RP    P  QQD+ E +   +  LH++L         
Sbjct: 412 FGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRAPEGPRV 470

Query: 706 --SNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHC 763
             + ++  + A            + ++     W    L N   S I  +F G L++ L C
Sbjct: 471 GQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVITDLFAGMLKSTLTC 528

Query: 764 KKC 766
             C
Sbjct: 529 LTC 531

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 57/141 (40%), Gaps = 34/141 (24%)

Query: 922  RATNFVTLPPVLVIHLSRF--YYDLTKKNETVITYPLI----------------LNIVLK 963
            R     + P +L++HL RF  +Y  T K    + +PL                  +    
Sbjct: 967  RQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDG 1026

Query: 964  NNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNL 1023
              E + Y L AV NH G L SGHYT+ V    D        +WY FDD  V+   +    
Sbjct: 1027 GRENV-YDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVDA---- 1074

Query: 1024 SQGVNKVSSKDVYVLFYERID 1044
                  V+S   Y+LFY R D
Sbjct: 1075 ----ESVASSFGYLLFYRRRD 1091

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKC 825
             LEDC+++FT+ EV++  ++W CP C
Sbjct: 933 TTLEDCLDLFTAPEVLNTADSWYCPAC 959

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 21/124 (16%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLIRKM 657
           GL NLG TCY+NS LQCL     F + F  + Y++  N +  +   G ++ +F  LI K+
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 658 YMN------------GGCSVVPTSF---LKICNFLRPDFNIPDDQQDAQEFLMLTIDRLH 702
           +                 S  PT+F   +  CN +   +     QQD+QEFL   +D LH
Sbjct: 475 FEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL----QQDSQEFLAFILDGLH 530

Query: 703 DELS 706
           ++L+
Sbjct: 531 EDLN 534

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYP-----LILNIVLKNNETLK-YRLYAVVNHNGN 981
            P +L+IHL RF      + K + V+ +P     L  +IV  + E    Y L AV NH G 
Sbjct: 1112 PDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLIAVDNHYGG 1171

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+ V    D       Q+WYYFDD  V       ++S           Y+LFY 
Sbjct: 1172 LGGGHYTAYVKNFVD-------QKWYYFDDSRVSLADPQRSISGS--------AYLLFYV 1216

Query: 1042 R 1042
            R
Sbjct: 1217 R 1217

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 18/25 (72%)

Query: 801  LEDCINMFTSDEVMSRENAWDCPKC 825
            L+DC+ +F+  E++  +++W CP C
Sbjct: 1072 LDDCLRLFSKPEILGLQDSWYCPTC 1096

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 56/119 (47%), Gaps = 6/119 (5%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE--LEDTGKLSKSFSVLI 654
            I GL NLG TCY+NS LQCL       + F    YER  N    L   G ++ +F  L+
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLL 396

Query: 655 RKMYM-NGGCSV--VPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTE 710
             ++  + G S    P +F          F     QQD+QEFL   +D LH++L+   E
Sbjct: 397 YSLFAPSYGQSTFYAPRNFKNTIGHYNSLF-AGYGQQDSQEFLAFLLDGLHEDLNRVIE 454

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 54/121 (44%), Gaps = 23/121 (19%)

Query: 930  PPVLVIHLSRF--YYDLTKKNETVITYP---LILNIVL---KNNETLKYRLYAVVNHNGN 981
            P +L+IHL RF      + K +  + +P   L ++  L   K  E   Y L AV NH G 
Sbjct: 944  PDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLIAVDNHYGG 1003

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
            L  GHYT+      D        +WYYFDD  V +E S  N   G         Y+LFY 
Sbjct: 1004 LGGGHYTAYCRNFID-------GKWYYFDDSRV-NEVSPENSIAG-------SAYLLFYR 1048

Query: 1042 R 1042
            R
Sbjct: 1049 R 1049

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 799 VNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEK 833
           + L+ C+ +F+  E++   ++W CP C    Q  K
Sbjct: 902 ITLDSCLRLFSQPEILGSADSWYCPNCKQHTQASK 936

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 25/130 (19%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNN-ETLK 969
            +   F + PP+L + L RF YD     L K N      E++   P +    L+ N E+ K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDE----VVKHETSHGNLSQ 1025
            Y L+ V+ H G++ +GHY +++      DL++   QWY FDDE    V K +    N   
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKP----DLQD---QWYRFDDEKVWKVTKKQVFEENF-- 494

Query: 1026 GVNKVSSKDV 1035
            G+NK+  +++
Sbjct: 495  GMNKLPEEEI 504

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 13/109 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+  E   +P        + S  + +++
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIPTENE---SP--------NDSVPLALQR 255

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
            +     S +P   L++      D      Q D QE   + +DRL + +
Sbjct: 256 AFYQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 304

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTK----KNETVITYPLIL--NIVLKNNETLKYRLYAV 975
            RA     LP  L++HL RF Y   +    K  + + YPLIL  N   K  +T+KY L  +
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY +L         +  +  W ++DDE V+  +    L    ++ +   
Sbjct: 571  VIHVGDGPQMGHYVALC--------KTEKYGWLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1035 VYVLFYERI 1043
             YVLFY+++
Sbjct: 623  AYVLFYKKL 631

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 60/131 (45%), Gaps = 17/131 (12%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   ++N  +     + YPL L++    + ++  KY L  
Sbjct: 534  RIVGLKQLPHTLALHLKRFKYS-EEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTG 592

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            VV H  G+   GHY SL         +N++  W  FDDE V+  T    L    +  +  
Sbjct: 593  VVIHMGGSPQHGHYVSLC--------KNDKFGWLLFDDETVESVTEKTVLEFTGDSSNQA 644

Query: 1034 DVYVLFYERID 1044
              YVLFY+ +D
Sbjct: 645  TAYVLFYKELD 655

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+     R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 66/170 (38%), Gaps = 37/170 (21%)

Query: 665 VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAE 724
           V P  F+K+       FN    QQDA EFL   ++ L + L N      +HP     D  
Sbjct: 401 VSPVEFVKVLKKENILFN-SMMQQDAHEFLNFLLNELSEYLQNHI----SHPSNKPTDIP 455

Query: 725 TSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIP 784
                       F+N +I+        +FQG L N + C  C         F    + + 
Sbjct: 456 ------------FKNYVID--------LFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV- 494

Query: 785 KPXXXXXXXXKGNW-VNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEK 833
                     KG+  ++++D +  + + E+++  N + C +C    + E+
Sbjct: 495 ----------KGDENIDIQDVLRCYHTREMLNGSNKFYCSQCCGLQEAER 534

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 56/131 (42%), Gaps = 17/131 (12%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNI--VLKNNETLKYRLYA 974
            R     +LP  L +HL RF Y   +KN  V     I YPLILN      ++ +  YRL  
Sbjct: 557  RLVGLKSLPKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQG 615

Query: 975  VVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            VV H GN    GHY SL +             W  FDDE V+       L    +  S  
Sbjct: 616  VVVHMGNGPHHGHYVSLCH--------TELFGWLLFDDETVESVDESYVLDFVGSHESPT 667

Query: 1034 DVYVLFYERID 1044
              YVLFY  ID
Sbjct: 668  TAYVLFYSEID 678

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 55/129 (42%), Gaps = 15/129 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNIV--LKNNETLKYRLYAV 975
            R+     LP  L +HL RF Y  TK +       + YPL L++     N+   KY L  +
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 976  VNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H  G    GHY SL         +N+   W  FDDE V+  +    L    +  +   
Sbjct: 664  VVHMGGGPQHGHYVSLC--------KNDNFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1035 VYVLFYERI 1043
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNIVLKNNETL--KYRLYAV 975
            R      LP +L +HL RF Y   +         ITYPL L +  K + ++  KY L  V
Sbjct: 541  RVVGLKKLPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGV 600

Query: 976  VNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H  G    GHY S+         + +   W +FDDE V+       L+   +  +S  
Sbjct: 601  VLHMGGGPQHGHYVSVC--------KTDNFGWLFFDDETVETLDEPQVLNFTGDTTTSTT 652

Query: 1035 VYVLFYERID 1044
             YVLFY+  D
Sbjct: 653  AYVLFYKETD 662

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           I G  N G TCY NS+LQCLF    FR+
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRN 140

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 58/133 (43%), Gaps = 23/133 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L  
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAG 606

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD---EVVKHETSHGNLSQGVNKV 1030
            +V H  G    GHY SL         ++ +  W  FDD   E VK ET      +  N  
Sbjct: 607  IVVHMGGGPQHGHYVSLC--------KHQKFGWLLFDDETVEAVKEETVLEFTGESANMA 658

Query: 1031 SSKDVYVLFYERI 1043
            ++   YVLFY+ +
Sbjct: 659  TA---YVLFYKAV 668

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           + G  N G TCY NS+LQCL+  +  R+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRE 166

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 22/117 (18%)

Query: 650 FSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
           F  +    Y+ G   V P+SF+ +       FN     QDA EF    ++ L + + ++ 
Sbjct: 397 FECITENTYLTG--VVSPSSFVDVLKKENVLFNTTM-HQDAHEFFNFLLNELSEYIEHEN 453

Query: 710 EVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKC 766
           +              TSK++         N  +NT  + I+ +F+G L N + C  C
Sbjct: 454 Q-----------KKATSKIKN--------NGFLNTSTNFINDLFKGTLTNQIKCLTC 491

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNIVLKNNETLK--YRLYAV 975
            R      LP +L +HL RF Y   K         + YPL LN+    + +++  Y L  V
Sbjct: 638  RIVGLKQLPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGV 697

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY SL         +N++  W  FDDE V+  +    L    +  +   
Sbjct: 698  VIHMGSSPQHGHYVSLC--------KNDKFGWLLFDDETVESVSESTVLEFTGDPNNQAT 749

Query: 1035 VYVLFYERI 1043
             YVLFY+ I
Sbjct: 750  AYVLFYKEI 758

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 6/46 (13%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR-DLFE-----PSNYERFFN 637
           + G  N G TCY NS+LQCL+    FR ++ E     P NY    N
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDHLPHNYANIEN 216

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 56/128 (43%), Gaps = 17/128 (13%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETLK--YRLYA 974
            R      LP  L +HL RF Y   ++N  +     ++YPL L +    N ++   Y L  
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYS-EQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSG 617

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            +V H  G    GHY SL         +N +  W  FDDE V+  +    L    +K +  
Sbjct: 618  IVVHMGGGPQHGHYISLC--------KNEKFGWLLFDDETVEAISEQAVLQYTGDKDTMT 669

Query: 1034 DVYVLFYE 1041
              YVLFY+
Sbjct: 670  TAYVLFYQ 677

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           I G  N G TCY NS+LQCL+    FR+
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRN 176

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 37/188 (19%), Positives = 71/188 (37%), Gaps = 36/188 (19%)

Query: 650 FSVLIRKMYMNGGCSVVPTSFLKIC---NFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
           F  +    Y+ G   V P++F+++    N L          QDA EFL+  ++ + D L 
Sbjct: 404 FECITEHSYLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLLNEISDFLD 457

Query: 707 NQTE-VLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
            Q +  LN+     +YD+   +      K +            +  IFQG L N + C  
Sbjct: 458 KQNKNALNSK----IYDSSQGRRNSGTVKNF------------VSDIFQGTLTNRIKCLT 501

Query: 766 CGXXXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
           C         F    + + +             +++++ +  F   E++   N + C +C
Sbjct: 502 CDNTTARDEPFLDFPIEVQENVD----------IDIQEILESFHQKEMLHGPNKFYCDEC 551

Query: 826 GVTVQKEK 833
               + E+
Sbjct: 552 CGLQEAER 559

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 28/131 (21%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDL----TKKNETVITYPLILNIVLKNNET-------LK 969
            I+      LPPVLV+ L RF + +     K NE  I YP  LN+    +++       + 
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEK-IAYPTYLNMAPFCHQSESRPVPDMM 393

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            Y L AV++H G++  GHYTS+              QW+ F+D ++   +    L Q    
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKIPGG--------QWFRFNDSMIVSISEEEALRQ---- 441

Query: 1030 VSSKDVYVLFY 1040
                  Y+LFY
Sbjct: 442  ----QAYLLFY 448

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 70/158 (44%), Gaps = 22/158 (13%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRK 656
            + GL N+G+TC+++S++Q L        L    N   F   +++D+   +  FS  + +
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLVHNPYV--LKTCMNQVHFSRCDIQDS---ASCFSCALDR 188

Query: 657 MYMNGGCSVVPTSF---------LKICNFLRPDFNIPD-DQQDAQEFLMLTIDRLHDELS 706
           +  N        SF         L +C++ + + N+    QQDA EF    +++LH +  
Sbjct: 189 IVSNFYGPAADASFTSQQKGFVDLLLCSW-KINRNLAGYSQQDAHEFWQFFLNQLHADHV 247

Query: 707 NQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINT 744
             T   ++ PE      E + +    ++    +S++ T
Sbjct: 248 RVTGKKSSKPE------ECNCISHSAFQGSLRSSILCT 279

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 58/133 (43%), Gaps = 23/133 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L  
Sbjct: 548  RLVGLKQLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAG 606

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD---EVVKHETSHGNLSQGVNKV 1030
            +V H  G    GHY SL         ++ +  W  FDD   E VK ET      +  N  
Sbjct: 607  IVVHMGGGPQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMA 658

Query: 1031 SSKDVYVLFYERI 1043
            ++   YVLFY+ +
Sbjct: 659  TA---YVLFYKAM 668

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           + G  N G TCY NS+LQCL+  +  R+
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRE 166

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 59/133 (44%), Gaps = 23/133 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY+L  
Sbjct: 551  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAG 609

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDD---EVVKHETSHGNLSQGVNKV 1030
            +V H  G    GHY SL         ++ +  W  FDD   E VK ET      +  N  
Sbjct: 610  IVVHMGGGPQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMA 661

Query: 1031 SSKDVYVLFYERI 1043
            ++   YVLFY+ +
Sbjct: 662  TA---YVLFYKAM 671

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           + G  N G TCY NS+LQCL+  +  R+
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRE 167

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 25/111 (22%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLK------- 963
            +   F + PPVL + L RF YD     + K N      ET+   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 964  NNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N     Y L+ V+ H+G++ +GHY +L+    +        QWY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 13/109 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+ +E   +P        + S  + +++
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHE---SP--------NNSVPLALQR 253

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
            +     S +P   L++      D      Q D QE   + +DRL + +
Sbjct: 254 AFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 64/128 (50%), Gaps = 37/128 (28%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI--VLKNNE------TLKYRLYAVVN 977
            LPPVLV+ L RF + ++  N+ +   I +P IL++   LK+N+      ++ Y L  +++
Sbjct: 349  LPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIIS 408

Query: 978  HNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDV-- 1035
            H G++  GHY +         +EN   +W+ F+D +             V K+  KDV  
Sbjct: 409  HTGSVNEGHYVAFCK------IENG--EWFKFNDSM-------------VTKILEKDVLK 447

Query: 1036 ---YVLFY 1040
               Y+LFY
Sbjct: 448  EQAYLLFY 455

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 26/36 (72%), Gaps = 6/36 (16%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
           +VPT+++ +       + GL N+G+TCY++S++QC+
Sbjct: 126 NVPTVDQID------GMAGLVNMGSTCYMSSIMQCI 155

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 53/128 (41%), Gaps = 17/128 (13%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   K+N  +     I YPL LN+    N  +  KY L  
Sbjct: 550  RLVGLKQLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSG 608

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            +V H  G    GHY SL      H++      W  FDDE V+       L       +  
Sbjct: 609  IVVHMGGGPQHGHYVSLC----KHEIFG----WLLFDDETVEAVKEEAVLEFTGESPNMA 660

Query: 1034 DVYVLFYE 1041
              YVLFY+
Sbjct: 661  TAYVLFYK 668

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           + G  N G TCY NS+LQCL+  +  R+
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRE 167

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 57/130 (43%), Gaps = 26/130 (20%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETV---ITYPLILNIV--LKNNET-----LKY 970
            I+      LPPVLV+ L RF + +   N  +   ITYP  LN+     ++E      + Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 971  RLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKV 1030
             L AV++  G++  GHYT +              QW+ F+D ++   T    L Q     
Sbjct: 394  ELVAVISQEGSVNQGHYTCMCKVPGG--------QWFRFNDTMIVSITEEDVLRQ----- 440

Query: 1031 SSKDVYVLFY 1040
                 Y+LFY
Sbjct: 441  ---QAYLLFY 447

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 78/181 (43%), Gaps = 45/181 (24%)

Query: 597 SITGLRNLGATCYINSMLQCLFAT-NMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIR 655
            + GL N+G+TC+++S++Q L     + +     ++Y R    +++D+   S  FS  + 
Sbjct: 134 GLCGLVNMGSTCFMSSIIQTLVHNPYVLKQCMNQNHYSR---CDIQDS---SSCFSCALD 187

Query: 656 KMYMNGGCSVVPTSF---------LKICNFLRPDFNIPD-DQQDAQEFLMLTIDRLHDEL 705
           ++ MN        +F         L +C++ + + N+    QQDA EFL   +++LH   
Sbjct: 188 QIVMNFYGPTSDATFTSQQRGFVDLLLCSW-KTNKNLAGYSQQDAHEFLQFFLNQLH--- 243

Query: 706 SNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
                            A+  +V +   K    N +++T        FQG L + + C  
Sbjct: 244 -----------------ADHVRVAQTNVKAENCNCILHTA-------FQGSLRSSILCTD 279

Query: 766 C 766
           C
Sbjct: 280 C 280

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 61/131 (46%), Gaps = 17/131 (12%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNI--VLKNNETLKYRLYA 974
            R      LP  LV+HL RF Y   +KN  +     + YP  LNI  V  ++ + KY L +
Sbjct: 533  RLIGIKELPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNS 591

Query: 975  VVNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            +V H G     GHY +L  K++ +        W  +DDE V+  +         N+  S 
Sbjct: 592  IVVHIGESPQLGHYVTLC-KHKSYG-------WLIYDDETVQAVSDELVSRILNNEQRSA 643

Query: 1034 DVYVLFYERID 1044
              Y+LFYE +D
Sbjct: 644  TAYLLFYEEVD 654

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 594 VALSITGLRNLGATCYINSMLQCLFATNMFRD-LFEPSNYERF 635
           V   + G +N G TCY NS+LQ LF    FRD +  P++   F
Sbjct: 101 VGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIGPASIGEF 143

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 86/232 (37%), Gaps = 62/232 (26%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+N E   NP        + S  + +++
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGE---NP--------NDSVPLALQR 252

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHP 716
            +     S  P   L++      D      Q D QE   + +DRL               
Sbjct: 253 AFYQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRL--------------- 297

Query: 717 ELLLYDAETSKVQKEEYKQWFENSLINTKF-SPIDKIFQGQLENGLHCKKCGXXXXXXXT 775
                                EN +  T     +++IF G++++ + CK           
Sbjct: 298 ---------------------ENRMKGTNVEGKLNEIFVGKMKSYIRCKNVDYESSRVED 336

Query: 776 FYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827
           F+ + L +             N+ +L++    +   E+M+ EN +  P  G+
Sbjct: 337 FWDIQLNVK------------NFKSLQESFENYIEVELMNGENQYAAPDFGL 376

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKNE------TVITYPLILNIVLKNNETLK- 969
            +   F + P VL + L RF YD     L K N+       +   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y+L+ V+ H G++ +GHY +++    +        QWY FDDE V
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKV 478

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIV-LKNNETLK 969
            +   F + PP+L + L RF YD     L K N      E+  T P +       NNE   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H G++ +GHY +++      DLE+   QWY FDDE V
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKP----DLED---QWYRFDDEKV 475

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 9/107 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            G RN GATCY+NS+LQ  F T  FR L        +  P   +T   + S  + +++ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YKIPTESETP--NSSVPLALQRAF 251

Query: 659 MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
                S +P   L++      D      Q D QE   + +DRL + +
Sbjct: 252 YQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 298

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI--------VLKNNETLK 969
            IR      LPPVL++ L RF + +   +  +   I++PL LN+         L     + 
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y+L A+++H+G +  GHYT++   N D         W  F+D +V
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRINGD--------IWAKFNDSMV 445

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 51/114 (44%), Gaps = 10/114 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKM- 657
            GL N+G +CY+NS+LQCLF    +    + +  E F    +  +  L      L R M 
Sbjct: 320 CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNNLRCQLIKLYRAMK 379

Query: 658 -----YMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
                Y  G   + P SF K  +    +F     QQDA EFL   ID L  +LS
Sbjct: 380 LEPELYPQG---IKPQSFKKCFSAGHEEF-ASQRQQDAMEFLTYMIDNLDKKLS 429

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 34/136 (25%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNI----VLKNNETLKYRLYA 974
            I+  + +  P  L++HL +F ++ T   K +  ++YP+ L++    V      LKY+L  
Sbjct: 532  IKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDYCVEGKELPLKYQLIT 591

Query: 975  VVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            VV H G +L SGHY     +   H        W  +DDE              +N ++ K
Sbjct: 592  VVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEY-------------INNINEK 630

Query: 1034 DV------YVLFYERI 1043
            DV      Y L Y R+
Sbjct: 631  DVLREPNAYYLVYTRL 646

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 56/131 (42%), Gaps = 17/131 (12%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETLK--YRLYA 974
            R      LP  L++HL RF Y   ++N  +     I YPL+L +   +N  +   Y L  
Sbjct: 513  RIVGLKKLPETLILHLKRFKYS-EEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTG 571

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            +V H  G    GHY S+         +N +  W  FDDEVV   T    L    +  +  
Sbjct: 572  IVLHLGGGPQHGHYVSIC--------KNEKYGWLLFDDEVVVSITEESVLKFVGDPTTLT 623

Query: 1034 DVYVLFYERID 1044
              Y+L Y+  D
Sbjct: 624  TAYLLVYKLKD 634

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 10/78 (12%)

Query: 549 SRTVS-SPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGAT 607
           SR +S SP  VP  +  P +L + DS    Q+   +  +  S+NK     + G  N G T
Sbjct: 70  SRALSESPTPVP--LKDPRELVKNDSD--HQKLLEITKLSDSSNK-----VFGYENFGNT 120

Query: 608 CYINSMLQCLFATNMFRD 625
           CY NS+LQCL+     RD
Sbjct: 121 CYCNSVLQCLYNIPELRD 138

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 54/129 (41%), Gaps = 15/129 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD----LTKKNETVITYPLILNIVLKNNETL--KYRLYAV 975
            R      LP  L +HL RF Y        K    I YPL LN+      ++  KY+L  +
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 976  VNHNGNL-ISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY ++         + ++  W  FDDE          LS   ++ S   
Sbjct: 678  VVHMGSSPQQGHYVAIC--------KTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNT 729

Query: 1035 VYVLFYERI 1043
             YVLFYE +
Sbjct: 730  AYVLFYEEV 738

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           I G  N G TCY NS+LQCL+  + F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 87/195 (44%), Gaps = 32/195 (16%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPS---NYERFFNP 638
           S+PT+ +      A  + GL N+G+TCY++S+LQCL    +F DL       NY +  +P
Sbjct: 126 SIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDP 179

Query: 639 ELEDTGKLSKSFSVLIRKMYMNGGCSVVPT-SFLKICNF-LRPDFNIPD-DQQDAQEFLM 695
                  +S +   +I + Y N      P    + I N   R + N+    QQDA EFL 
Sbjct: 180 ----MKCMSCAIDNIISETYGNK--KTTPNEGLVDILNCSWRVNKNLAGYTQQDAHEFLQ 233

Query: 696 LTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPID----K 751
             ++++H++       LN      ++D    ++   ++K     +         +     
Sbjct: 234 FILNQMHNDYK-----LNE-----IHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHT 283

Query: 752 IFQGQLENGLHCKKC 766
           IFQG L++ + C +C
Sbjct: 284 IFQGFLKSIISCSEC 298

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 30/115 (26%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI------------------ 960
            R  + + L P++VI L RF + +T  +  +   + +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 961  -VLKNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
               K+   + Y L  +V H G +  GHY +   K  D         WY F+D VV
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITYT-KTAD-------GVWYQFNDSVV 459

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLK------- 963
            +   F + PPVL + L RF YD     + K N      ET+   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 964  -NNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             +     Y L+ V+ H+G++ +GHY +L+    +        QWY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 87/235 (37%), Gaps = 68/235 (28%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+ +E   +P        + S  + +++
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHE---SP--------NNSVPLALQR 253

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHP 716
            +     S +P   L++      D      Q D QE   + +DRL +             
Sbjct: 254 AFYQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLEN------------- 300

Query: 717 ELLLYDAETSKVQKEEYKQWFENSLINTKFSPID----KIFQGQLENGLHCKKCGXXXXX 772
                                     N K +P++    +IF G++++ + C         
Sbjct: 301 --------------------------NMKGTPVEGKLNEIFVGKMKSYIKCINVDYESAR 334

Query: 773 XXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827
              F+ L L +             N+ NL++  + +   E+M+ EN +     G+
Sbjct: 335 VEDFWDLQLNVK------------NFKNLQESFDNYIEMELMNGENQYAAQDYGL 377

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 35/137 (25%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLT--KKNETVITYPLILNIVLKNNETL-----KYRLY 973
            +++   +  P  LV+HL +F ++ T   K +  ++YP+ L++    +E++     +Y+L 
Sbjct: 583  LKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLPVRYQLI 642

Query: 974  AVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            +VV H G +L SGHY +   K  D         W  +DDE              +NK+S 
Sbjct: 643  SVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDDEY-------------INKISE 681

Query: 1033 K------DVYVLFYERI 1043
            K      + Y L Y R+
Sbjct: 682  KQLLKEPNAYFLVYTRL 698

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 26/121 (21%)

Query: 930  PPVLVIHLSRFYYDLTKKNETV---ITYPLILNI---VLKNNE----TLKYRLYAVVNHN 979
            P VLVI L RF + L  ++  +   + +PL LN+   + +  +     + Y L  VV+H 
Sbjct: 339  PNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQ 398

Query: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039
            G +  GHYT+ V+K  D        QW+ F+D VV   T          +V  +  Y+LF
Sbjct: 399  GTVDQGHYTT-VSKTED-------GQWFKFNDSVVTSVTE--------EQVLEQQAYLLF 442

Query: 1040 Y 1040
            Y
Sbjct: 443  Y 443

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 95/237 (40%), Gaps = 52/237 (21%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMF-RDLFEPSNYERFFNPELEDTGK-LSKSFSVLI 654
            + GL N+G+TC+++S++Q +     F  DL    +++   N +++   K +S +   + 
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLL---SHKHCNNCDIKSGTKCVSCALDEIA 187

Query: 655 RKMYMNGGCSVVPTSFLK-ICNFLRPDFNI-----PDDQQDAQEFLMLTIDRLHDELSNQ 708
              Y NG  +   +S  K   N L   ++I        QQDA E+    +++LH      
Sbjct: 188 CDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLH------ 241

Query: 709 TEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGX 768
                                  ++ + F +S          +IFQG L+N L C +CG 
Sbjct: 242 ----------------------TDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGF 279

Query: 769 XXXXXXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
                     LSL I             N   LEDC++ F  +E ++ +  ++C  C
Sbjct: 280 SKTTIDPIMDLSLEIK------------NNPKLEDCLDHFQREETLT-DFHYECQSC 323

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 14/105 (13%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLF----EPSNYERFFNPELEDTGKLSKSFSVLIR 655
           GL N+G TCY+NS LQ L+  +  RD+     E +N +       +   +L + F  L +
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 656 KMYMNGGCSVVPTSFLKICNFLRPDFNIPDD------QQDAQEFL 694
           K Y     SV+P  FL +     P F   D+      QQDA+E  
Sbjct: 170 KSYE----SVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELF 210

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 18/104 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNNETLKY 970
            +   F + PPVL + L RF YD     + K N      ET+   P + +   +      Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 971  RLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             L+ V+ H G++ +GHY +L+       LE+   QWY FDDE V
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPG----LED---QWYRFDDERV 476

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+  E   +P        + S  + +++
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTENE---SP--------NNSVPLALQR 251

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
            +     S  P   L++      D      Q D QE   + +DRL + +   +
Sbjct: 252 SFYQLQVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTS 304

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNN----- 965
            +   F + PPVL + L RF YD     + K N      ET+   P +   VLK +     
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 966  ---ETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
                   Y L+ V+ H+G++ +GHY +L+    +        QWY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 87/235 (37%), Gaps = 68/235 (28%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+ +E   +P        + S  + +++
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHE---SP--------NNSVPLALQR 253

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHP 716
            +     S +P   +++      D      Q D QE   + +DRL +             
Sbjct: 254 AFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLEN------------- 300

Query: 717 ELLLYDAETSKVQKEEYKQWFENSLINTKFSPID----KIFQGQLENGLHCKKCGXXXXX 772
                                     N K +P++    +IF G++++ + C         
Sbjct: 301 --------------------------NMKGTPVEGKLSEIFVGKMKSYIKCVNVDYESAR 334

Query: 773 XXTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827
              F+ L L +             N+ NL++  + +   E+M+ EN +     G+
Sbjct: 335 VEDFWDLQLNVK------------NFKNLQESFDNYIEMELMNGENQYAAQDYGL 377

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 68/158 (43%), Gaps = 41/158 (25%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIVLKNN------ETLKYRL 972
            IR T     P +L +HLSR  ++     +N   + YP  L IVL+ +      E + YRL
Sbjct: 319  IRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERITYRL 377

Query: 973  YAVVNHNGNLISGHYTSL-------------VNKNRDHDL--------------ENNRQQ 1005
             +++ H G   SGHY                V  NR   +              ++ R+ 
Sbjct: 378  RSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRW 437

Query: 1006 WYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERI 1043
             Y+F  + V  E++ G + +      SK VY+LFYER+
Sbjct: 438  PYWFISDAVVRESNAGKMLR-----ESKYVYMLFYERV 470

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 58/151 (38%), Gaps = 18/151 (11%)

Query: 562 VVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATN 621
           V AP  LS +         F     E S+NK +     GL N    C+INS LQ L + +
Sbjct: 36  VTAPTVLSLIG--------FGAKFTEDSDNKRMDKYTPGLSNPANECFINSSLQALSSLD 87

Query: 622 MFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY-MNGGCSVVPTSFLKICN--FLR 678
                   +      +PE ED  K   +  +L R +  + G    V  +   + N  F+R
Sbjct: 88  YLTAYLHDALL--LLSPEEEDVEKNEGTGVLLTRSLSDIVGQLQTVTCAPQTLSNKQFVR 145

Query: 679 PDFNI-----PDDQQDAQEFLMLTIDRLHDE 704
               I        Q DA EF  L +D L  E
Sbjct: 146 SLERIFRGRMSRTQNDAHEFTQLLVDTLESE 176

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVL-------- 962
            +   F + PPVL + L RF YD     + K N      ET+   P +   VL        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 963  KNNETLKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            K+     Y L+ V+ H+G++ +GHY +L+    +        QWY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 13/109 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P+ +E   +P        + S  + +++
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHE---SP--------NNSVPLALQR 253

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
            +     S +P   +++      D      Q D QE   + +DRL + +
Sbjct: 254 AFYQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 20/106 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLI--LNIVLKNNETL 968
            +   F + PPVL + L RF YD     L K N      ET+   P I   +  L N E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             Y L+ V+ H G++ +GHY +++             +WY FDD+ V
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGV-------SDEWYRFDDDKV 478

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 46/107 (42%), Gaps = 9/107 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            G +N GATCY+NS+LQ  F T  FR L     YE        D    + S  + +++ +
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV----YEI-----PTDMDSPNNSVPLALQRAF 253

Query: 659 MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
                S  P   L++      D      Q D QE   + +DRL + +
Sbjct: 254 YQLQVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRM 300

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 19/109 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKNE------TVITYPLILNIVLKNNETLK- 969
            +   F + PPVL + L RF YD     L K N+      ++   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            Y+L+ V+ H G++ +GHY +L+         + + +WY FDD+ V   T
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRVWRAT 481

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 49/113 (43%), Gaps = 13/113 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  + T  FR L    P+  E   NP        + S ++ +++
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEGE---NP--------NDSVTLALQR 251

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
            +     S  P   +++      D      Q D QE   + +DRL   +   +
Sbjct: 252 AFYQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRMKGTS 304

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 48/185 (25%)

Query: 547 PRSRTVSSPAEVPKNV--VAP-EQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRN 603
           P +  +S PAE  + V  ++P +Q+ Q +S P+                       GL+N
Sbjct: 77  PDANLLSKPAEKHRFVEDLSPDQQVQQFNSTPL-----------------------GLQN 113

Query: 604 LGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELED------TGKLSKSFSVLIRKM 657
           +G TCY+N+ LQ LF  +  +DL    +  +  N +  D        +L ++F  L ++ 
Sbjct: 114 MGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETLKKRS 173

Query: 658 YMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQE-----FLMLTIDRLHDELS 706
           +     SV+P   L       P F   D       QQDA+E     F  LT+    D+ +
Sbjct: 174 FK----SVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTV-VFGDKFA 228

Query: 707 NQTEV 711
           NQ ++
Sbjct: 229 NQFQI 233

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 959  NIVLKNNETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N+    N +  Y L  V+ H G N  SGHY + +   RD   EN   +WY F+D+ V
Sbjct: 415  NLAAGENPSSVYDLIGVITHQGANSESGHYQAFI---RDESDEN---KWYKFNDDKV 465

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 67/155 (43%), Gaps = 11/155 (7%)

Query: 555 PAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSML 614
           P +V   +  P+  + L + P ++R+F     E +  ++++ +  GL+NLG TCY+NS L
Sbjct: 18  PGQVIMVLGTPD--ANLVTKPQKERRFIEDLDEGAQMQHLSQTPVGLKNLGNTCYMNSTL 75

Query: 615 QCLFATNMFRDLFEPSNYER-FFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKI 673
           Q L+     RD  E  NY+     P  E   +L        +++      SV P   L +
Sbjct: 76  QALYQIKPLRD--EVLNYKVPREKPSEEQHHQLVSELRRCFQQLKDKPQESVTPMLLLAM 133

Query: 674 CNFLRPDFNIPDD------QQDAQEFLMLTIDRLH 702
                P F   D       QQDA+E      + L 
Sbjct: 134 LRKCYPQFAERDQESGFYKQQDAEELFTQIFNSLR 168

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 13/113 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FRDL    P+  E   NP        + S ++ +++
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTADE---NP--------NDSVALALQR 307

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
            +     S  P   L++      D      Q D QE   + +DRL   +   +
Sbjct: 308 AFYQLQVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKGTS 360

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNNETLK- 969
            +   F + P VL + L RF YD     L K N      ET+   P +   VLK  +    
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H G++ +GHY +++    D        +WY FDDE V
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKV 533

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 104/253 (41%), Gaps = 53/253 (20%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMF-RDLFEPSNYERFFNPEL 640
           S P+ +R +       ++GL N+G+TCY++ ++QCL     F +  F  ++Y+     ++
Sbjct: 126 SFPSYDRKD------GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKE---CKI 176

Query: 641 ED-TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDD-----QQDAQEFL 694
            D    LS +   ++ ++Y       V      + + L   + I +D     QQDA EF 
Sbjct: 177 RDPVSCLSCALDSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYSQQDAHEFW 236

Query: 695 MLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQ 754
              ++R+H E                 +  T +V K+ ++      L N  +    K+FQ
Sbjct: 237 QFLMNRIHSEYK--------------LNNNTIEVPKDTHQ------LCNCIYH---KVFQ 273

Query: 755 GQLENGLHCKKCGXXXXXXXTFYI-LSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEV 813
           G LE+ + C  C          Y+ LSL +                 L +C+N F   E 
Sbjct: 274 GFLESTIECANCRKESKTTTEAYMDLSLDLKDKKT------------LYECLNSFHMKEE 321

Query: 814 MSRENAWDCPKCG 826
           + ++  + C  CG
Sbjct: 322 L-KDFTFHCSNCG 333

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI----VLKNNETLK--------YRLY 973
            LPPVL++ L RF + L  ++  +   I YP  L +       +NET+         Y L 
Sbjct: 347  LPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPDDSDIIYELI 406

Query: 974  AVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             V+ H G +  GHY           L NN  QW  F+D ++
Sbjct: 407  GVICHTGTVNEGHYICSCK------LANN--QWVKFNDSMI 439

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 34/141 (24%)

Query: 929  LPPVLVIHLSRFYY--DLTKKN-----------------------ETVITYPLILNIVLK 963
            LP VL+I L RF +  ++ K N                       E ++    + + +LK
Sbjct: 945  LPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILK 1004

Query: 964  NNET-LKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHG 1021
            NNE+  KY+L AVV H+G+    GHYT+ +    + DL    ++W+  DD  +       
Sbjct: 1005 NNESSRKYKLRAVVYHHGSSPDGGHYTADI---YNKDL----KKWFMIDDVNITELEDAD 1057

Query: 1022 NLSQGVNKVSSKDVYVLFYER 1042
             ++ G N + ++  Y+L YE+
Sbjct: 1058 VVNGGDNGLDTRTAYILMYEK 1078

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 55/107 (51%), Gaps = 21/107 (19%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKNE------TVITYPLILNIVLKN-NETLK 969
            +   F + P VL + L RF YD     L K N+      ++   P +   VLKN NET  
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 970  --YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
              Y+L+ V+ H G++ +GHY +++      DL +   QWY FDDE V
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKP----DLGD---QWYRFDDERV 485

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 83/229 (36%), Gaps = 56/229 (24%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            G RN GATCY+NS+LQ  F T  FR L     YE    P   D  K + S  + +++ +
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YEI---P--TDEEKPNDSVPLALQRAF 259

Query: 659 MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPEL 718
                S +P   L++      D      Q D QE   + +DRL   +             
Sbjct: 260 YQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMKG----------- 308

Query: 719 LLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYI 778
                  +KV+                   + ++F G++++ + CK           F+ 
Sbjct: 309 -------TKVE-----------------GKLSELFVGKMKSYIKCKNVDYESSRVEEFWD 344

Query: 779 LSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGV 827
           + L +             +  NL+     +   E+M  EN +  P  G+
Sbjct: 345 IQLNVK------------DLKNLQQSFENYIEVELMDGENQYAAPDFGL 381

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 16/95 (16%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI--VLKNNE---TLKYRLYAVVNHNG 980
            L P LV+ L RF +  + +N  +   + +PL L++       E   ++ YRL  VV+H+G
Sbjct: 347  LAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRLSGVVSHSG 406

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVK 1015
             +  GHYT++        L+ N  +W+ F+D ++ 
Sbjct: 407  TVNEGHYTAV--------LQLNSGEWFKFNDSMIS 433

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 11/136 (8%)

Query: 579 RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP 638
           +Q S+PT  R +  Y      GL NLG+TC+++S+LQ L      +  F  S + R    
Sbjct: 123 KQVSLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFLNSGHAR--RC 174

Query: 639 ELED-TGKLSKSFSVLIRKMYMNGGCSVVPTSFLKI--CNFLRPDFNIPDDQQDAQEFLM 695
            L D +  +S +   +I + Y +         FL +  C++          QQDA EFL 
Sbjct: 175 ALRDPSSCISCALDRIISECYGSLSERNDHAGFLSLLTCSWKINQNFAGYSQQDAHEFLQ 234

Query: 696 LTIDRLHDELSNQTEV 711
             +++LH +   + +V
Sbjct: 235 FLLNQLHCDYKRERQV 250

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 33/135 (24%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIV--LKNNET-LKYRLYAV 975
            ++  + +  P  L++HL +F ++ T   K +  ++YP+ L++    +N +  +KY+L +V
Sbjct: 590  VKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCENKDLPVKYQLLSV 649

Query: 976  VNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G +L SGHY +   K  D         W  +DDE              +NK+S +D
Sbjct: 650  VVHEGRSLSSGHYIAHC-KQPD-------GSWATYDDEY-------------INKISERD 688

Query: 1035 V------YVLFYERI 1043
            V      Y L Y R+
Sbjct: 689  VLKETNAYYLLYTRL 703

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query: 929  LPPVLVIHLSRF-YYDLTKKNETV---ITYPLILNIVLKNNETLK--YRLYAVVNHNG-N 981
            LP  L IHL RF Y D    N  +   I YP+ L +    +E++   Y L  +V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYE 1041
               GHY S V K  D+        W  FDDE V+  +    LS   +  S+   YVLFY+
Sbjct: 587  PQHGHYIS-VCKTSDYG-------WLLFDDETVECISEDTVLSFVGDSNSAGTAYVLFYK 638

Query: 1042 RID 1044
             I+
Sbjct: 639  EIN 641

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRD 625
           + GL N G TCY NS+LQCL+  N FR+
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRE 157

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 64/135 (47%), Gaps = 33/135 (24%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIVLKNNET---LKYRLYAV 975
            ++  + +  P  L++HL +F ++ T   K +  ++YP+ L++    ++    +KY+L +V
Sbjct: 615  VKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQLLSV 674

Query: 976  VNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G +L SGHY +   K  D         W  +DDE              +NK+S +D
Sbjct: 675  VVHEGRSLSSGHYIAHC-KQPD-------GTWATYDDEY-------------INKISERD 713

Query: 1035 V------YVLFYERI 1043
            V      Y L Y R+
Sbjct: 714  VLKEPNAYYLLYTRL 728

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLK-NNETLK 969
            +   F + PPVL + L RF YD     L K N      E++   P +   V K   E++ 
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H G++ +GHY +++    D        +WY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 10/115 (8%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRK 656
              GL+N GATCY+NS+LQ  + T  FR L        +  P   D    S S  + +++
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHIP--TDGETPSNSVPLALQR 247

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
            +     S  P    ++      D      Q D QE   + +DRL +++   TEV
Sbjct: 248 AFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKM-KATEV 301

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 65/135 (48%), Gaps = 33/135 (24%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIVLKNNET---LKYRLYAV 975
            ++  + +  P  L++HL +F ++ T   K +  ++YP+ L++    ++    +KY+L +V
Sbjct: 603  VKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQLLSV 662

Query: 976  VNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G +L SGHY +   K  D +       W  +DDE              +NK+S +D
Sbjct: 663  VVHEGRSLSSGHYIAHC-KQPDGN-------WATYDDEY-------------INKISERD 701

Query: 1035 V------YVLFYERI 1043
            V      Y L Y R+
Sbjct: 702  VLKEPNAYYLLYTRL 716

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 21/106 (19%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNN--ETL 968
            +   F + PPVL + L RF YD     L K N      E++   P  L+  +K+N   T 
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPY-LDPDVKDNYPNTC 437

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             Y L+ V+ H+G++ +GHY +++  N          QW+ FDD+ V
Sbjct: 438  IYNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKV 476

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 14/114 (12%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRKM 657
           G +N GATCY+NS+LQ  F T +FR +    PS+ E   +P    +  L +SF +L +  
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMVYKIPSDNE---SPNDSVSLALQRSFYLLEK-- 257

Query: 658 YMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
                 S  P   L++      D      Q D QE   + +DRL   +   TEV
Sbjct: 258 ------SKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKG-TEV 304

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 18/108 (16%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDL---FEPSNYERFFNPELEDTGK----LSKSFSV 652
           G +N+G TCY+N+ LQ LF  +  R+L   ++P  +    NP+ E   K    L   F  
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTN-LNPQDEMHHKLILELKHCFES 167

Query: 653 LIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
           L +K Y     SV+P   + +   + P F   D       QQDA+E  
Sbjct: 168 LKQKNYQ----SVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELF 211

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 965  NETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N +  Y L  V+ H G N  SGHY + +   RD   EN+   WY F+D+ V
Sbjct: 425  NPSCVYNLVGVITHQGANSDSGHYQAFI---RD---ENDENVWYKFNDDKV 469

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNIVLKNNETL--KYRLYAV 975
            R      LP +L +HL RF Y   +K+       I YPL L++    N ++  KY L  V
Sbjct: 547  RMVGLKQLPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGV 606

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY  +          N +  W  +DDE V+       L    +      
Sbjct: 607  VIHMGSGPQHGHYVCIC--------RNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTT 658

Query: 1035 VYVLFYE 1041
             YVLFY+
Sbjct: 659  AYVLFYK 665

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 18/104 (17%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDL---TKKNETVITYPLILNI-----VLKNNET--LKY 970
            IR      LPPVLV+ L RF + +   + K    I +P  L++       K  ET  + Y
Sbjct: 335  IRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIVY 394

Query: 971  RLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             L  +++H G++  GHYTS+              QW+ F+D +V
Sbjct: 395  ELIGLISHQGSVNQGHYTSICKIPGG--------QWFKFNDSMV 430

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 14/129 (10%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELE 641
           S+P++E+ N       + GL N+G+TC+++S++Q L        L    +       +L+
Sbjct: 125 SIPSVEKRN------GLAGLVNMGSTCFMSSIIQTLIHNPYI--LKHSMDQLHSTTCDLQ 176

Query: 642 DTGK-LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFL----RPDFNIPD-DQQDAQEFLM 695
           ++   +S +   +I   Y         T+     N L    R + N+    QQDA EF  
Sbjct: 177 NSSSCMSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDAHEFWQ 236

Query: 696 LTIDRLHDE 704
             +++LH++
Sbjct: 237 FLLNQLHND 245

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 9/103 (8%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDT--GKLSKSFSVLIRKM 657
           G+ NLG TCY+N+ LQ LF  +  R+     + +R    E  DT   +L +   V  +K+
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIK-EGVDTYHAQLVRELKVTFQKL 161

Query: 658 YMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
               G ++ P   L+I   + P F+  D       QQDA+E  
Sbjct: 162 KDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELF 204

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 965  NETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N +  Y L  V+ H G N  SGHY + +  + D       ++WY FDD+ V
Sbjct: 410  NPSCIYDLIGVITHQGANSESGHYQAFIRDDAD-------EKWYRFDDDKV 453

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 9/104 (8%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDL---FEPSNYERFFNPELEDTGKLSKSFSVLIRK 656
           G +N+G TCY+N+ LQ L+ T+  R +   ++P      +NPE E   K+          
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFEN 171

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
           +      SV+P   L +     P F   D       QQDA+E  
Sbjct: 172 LEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELF 215

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 965  NETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N +  Y L  ++ H G N  SGHY + +   RD   EN+  +WY F+D+ V
Sbjct: 428  NPSCVYNLIGIITHQGANSESGHYQAFM---RD---ENDENKWYKFNDDKV 472

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYP-LILNIVLKNNETLK 969
            +   F + PPVL + L RF YD     L K N      E++   P L   I   N ++  
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H G++ +GHY +++  + +        QWY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 13/109 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G +N GATCY+NS+LQ  F T  FR L    P++ E   +P        + S  + +++
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQIPTDKE---SP--------NNSVPLALQR 254

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
            +     S  P   L++      D      Q D QE   + +DRL +++
Sbjct: 255 AFFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKM 303

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 32/128 (25%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI--VLKNNETLK-----------YRL 972
            LP VLV+ L RF + L   N  +   I +P  LN+       E+ K           Y L
Sbjct: 354  LPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNGKVPDIIYEL 413

Query: 973  YAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
              +V+H G +  GHY +    +          QW+ F+D VV       +++QG  +V  
Sbjct: 414  IGIVSHRGTVNEGHYIAFCKISGG--------QWFKFNDSVVT------SIAQG--EVLK 457

Query: 1033 KDVYVLFY 1040
            +  Y+LFY
Sbjct: 458  EQAYLLFY 465

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%), Gaps = 6/37 (16%)

Query: 582 SVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLF 618
           +VP +ER +       ++GL N+G+TC+++S+LQCL 
Sbjct: 126 TVPIMERRD------GLSGLINMGSTCFMSSILQCLI 156

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 55/131 (41%), Gaps = 35/131 (26%)

Query: 929  LPPVLVIHLSRFYYDL---TKKNETVITYPLILNIVL----KNNET------------LK 969
            L P+LV  L RF + L   T K    I YPL LN+       NN+T            + 
Sbjct: 373  LSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESNSENVPDMI 432

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            Y L ++++H G +  GHY  +V  N          QW+ F+D +V   T    L Q    
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVKVNDG--------QWFKFNDSMVSAITEEEALKQ---- 480

Query: 1030 VSSKDVYVLFY 1040
                  Y+LFY
Sbjct: 481  ----QAYLLFY 487

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 13/113 (11%)

Query: 600 GLRNLGATCYINSMLQCL----FATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIR 655
           GL N+G+TC+++S+LQ L    +  N +       N  +  NP L  T   S +  ++I 
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVN-YSMCQTHYNMCQSKNP-LSCT---SCALDLIIT 192

Query: 656 KMYM--NGGCSVVPTSFLKICN-FLRPDFNIPD-DQQDAQEFLMLTIDRLHDE 704
           + Y   + G +   T F+ + N  L+ + N     QQDA EFL   ++++H++
Sbjct: 193 EFYATESKGNNSSHTGFISLLNSLLQVNENFAGYSQQDAHEFLQFILNQIHND 245

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSK 648
           TG+ N+G TCY+NS+LQ  F+  +FR+  E  NY+   +  L    ++SK
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFREFIE--NYQSIESDLLNSNAEMSK 805

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (48%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNNETLK- 969
            +   F + P VL + L RF YD     L K N      E +   P +   VL+ N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H G++ +GHY +L+       LE+   QWY FDDE V
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPG----LED---QWYRFDDERV 477

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 48/113 (42%), Gaps = 13/113 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLIRK 656
            G RN GATCY+NS+LQ  F T  FR L    P++ E   NP+      L ++F  L   
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQE---NPKDSVVLALQRAFYQLQVS 259

Query: 657 MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQT 709
            Y        P   +++      D      Q D QE   + +DRL   +   T
Sbjct: 260 QY--------PLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGTT 304

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 24/120 (20%)

Query: 929  LPPVLVIHLSRFYYDLTKKN---ETVITYPLILNI-----VLKNNETLKYRLYAVVNHNG 980
            LPPVLV+ L RF +    +N      I +P  LN+       +NN ++ Y L  V++H G
Sbjct: 331  LPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYELNGVISHIG 390

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
             +  GHY +         L+ +   W+ F+D +V         S    +V     Y+LFY
Sbjct: 391  TVNEGHYIA--------TLKLDSNNWFKFNDSMVT--------SISEEEVLKDQAYLLFY 434

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 59/261 (22%), Positives = 99/261 (37%), Gaps = 65/261 (24%)

Query: 579 RQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFAT-NMFRDLFEPSNYE--RF 635
           R  S PT+   +       + G  N+G+TC+++S+LQ L     + ++    S+Y   + 
Sbjct: 107 RNISFPTVTNRD------GLHGFVNMGSTCFMSSILQVLIHNPFIVQNSMSQSHYSSCKI 160

Query: 636 FNPELEDTGKL----SKSFSVLIRKMYMNGG-CSVVPTSFLKICNFLRPDFNIPDD---- 686
            NP    +  L    ++S+   ++  Y NG   +     F+ +   L   + I D+    
Sbjct: 161 RNPNNCISCALDEIIAESYGNFVK--YNNGKPINQYHDGFISM---LNCSWKINDNFAGY 215

Query: 687 -QQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTK 745
            QQDA EFL   ++RLH +                Y   ++     +             
Sbjct: 216 SQQDAHEFLQFILNRLHRD----------------YKLTSTYTNNTDSCSCL-------- 251

Query: 746 FSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYI-LSLAIPKPXXXXXXXXKGNWVNLEDC 804
              I  IFQG+L++ + C +C          YI LSL I                 L  C
Sbjct: 252 ---IHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKDK------------ATLYQC 296

Query: 805 INMFTSDEVMSRENAWDCPKC 825
           ++ F   E +   N + CP C
Sbjct: 297 LDSFHKKETLHDYN-YHCPNC 316

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 27/147 (18%)

Query: 600 GLRNLGATCYINSMLQCLF------------ATNMFRDLFEPSNYERFFNPELEDTGKLS 647
           GL NLG +CY+NS+LQC +             T     +  PSN  +    +L +  K+ 
Sbjct: 327 GLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMKIE 386

Query: 648 KSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSN 707
                    +Y NG   + PT+F K       +F+  + QQDA EFL   ID L +++ N
Sbjct: 387 SD-------LYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFN 435

Query: 708 QTEVLNAHPELLLYDAETSKVQKEEYK 734
                N     ++ D    K+Q ++ K
Sbjct: 436 TANNPNDTMRFIMED----KIQCQKCK 458

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 21/128 (16%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNN-ETLK 969
            +   F + PPVL + L RF YD     L K N      E++   P +   V +++    K
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQ--GV 1027
            Y L+ V+ H G++ +GHY +++       LE+    WY FDD+ V   T      Q  G 
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPG----LED---AWYRFDDDKVWRVTKKQVFEQNFGF 479

Query: 1028 NKVSSKDV 1035
            +K+S  D+
Sbjct: 480  DKLSEYDL 487

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 10/113 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            GL+N GATCY+NS+LQ  + T  FR L        +  P   +T   + S S+ +++ +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YQIPTEGETP--ANSVSLALQRAF 240

Query: 659 MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEV 711
                S  P    ++      D      Q D QE   + +DRL +++   TEV
Sbjct: 241 FQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKG-TEV 292

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 19/132 (14%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETVIT------YPLILNIVLKNNETL--KYRLY 973
            R      LP +L +HL RF Y  ++K+++ I       YPL L +  K++  +   Y L 
Sbjct: 583  RTVGLKQLPKILSLHLKRFKY--SEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELN 640

Query: 974  AVVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
             +V H  G    GHY ++      HD+      W  +DDE V+            ++   
Sbjct: 641  GIVIHMGGGPQHGHYVAICK----HDMFG----WLLYDDETVESIDEETVFKFVGDEKDM 692

Query: 1033 KDVYVLFYERID 1044
               YVLF++ +D
Sbjct: 693  TTAYVLFFKEVD 704

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + GL N G TCY NS+LQCLF  +  R
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELR 158

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 23/131 (17%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIVLKNNET-----LKYRLY 973
            I+    +  P  L++HL +F ++ T   K +  ++YPL +++     E      +KY+L 
Sbjct: 582  IKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQLI 641

Query: 974  AVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            +VV H G +L SGHY +   +            W  +DDE +   T   N+ + VN    
Sbjct: 642  SVVVHEGRSLSSGHYIAHCKQPDG--------TWATYDDEYINKITER-NVLKEVN---- 688

Query: 1033 KDVYVLFYERI 1043
               Y L Y R+
Sbjct: 689  --AYYLVYTRL 697

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 37/139 (26%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIV-LKNNET------LKYR 971
            ++    +  P  L++HL +F ++ T   K +  ++YP+ L++    +NE       +KY+
Sbjct: 615  VKRNTILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDNEGNKKILPVKYQ 674

Query: 972  LYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKV 1030
            L +VV H G +L SGHY +   K  D         W  +DDE              +NK+
Sbjct: 675  LISVVVHEGRSLSSGHYVAHC-KQPDG-------LWATYDDEY-------------INKI 713

Query: 1031 SSKDV------YVLFYERI 1043
            S K+V      Y L Y R+
Sbjct: 714  SDKEVLRETNAYYLVYSRL 732

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 35/128 (27%)

Query: 930  PPVLVIHLSRFYYDLTK--KNETVITYPLILNIV--LKNNET---LKYRLYAVVNHNG-N 981
            P  L++HL +F ++ T   K +  ++YP+ L++    +N+ T   +KY+L +VV H G +
Sbjct: 348  PETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLISVVVHEGRS 407

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDV------ 1035
            L SGHY +   K  D         W  +DDE              +NK+S K +      
Sbjct: 408  LSSGHYIAHC-KQPDGS-------WSTYDDEY-------------INKISEKQMLKEPGA 446

Query: 1036 YVLFYERI 1043
            Y L Y R+
Sbjct: 447  YYLVYTRL 454

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 45/105 (42%), Gaps = 14/105 (13%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGK----LSKSFSVLIR 655
           GL+NLG TCY+N+ LQCLF     R++          +P  E   K    L   F  L +
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCFDSLDK 169

Query: 656 KMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
           K +     +V+P   L +     P F   D       QQDA+E  
Sbjct: 170 KKFQ----AVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEELF 210

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 19/127 (14%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD--LTKKNETVITYPLILNI--VLKNNETLKYRLYAVVN 977
            +   F  LP  L +HL RF  D  +  K    I YPL L +     N+    Y L  VV 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 978  HNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVK---HETSHGNLSQGVNKVSSK 1033
            H G +   GHY S+         ++ +  W  +DDE ++    E    ++ +  N +++ 
Sbjct: 591  HVGASPTHGHYVSIC--------KHEKYGWLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 1034 DVYVLFY 1040
              YVLFY
Sbjct: 642  --YVLFY 646

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 9/75 (12%)

Query: 556 AEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSN-NKYVALS-----ITGLRNLGATCY 609
           A   +N VA  Q   L  Y   +    +PTI  +N  K +        + G  N G TCY
Sbjct: 75  ANEARNYVAIPQEQLLHRY---EHDSQIPTIVDTNVTKLMPFGDGSNKVFGYENFGHTCY 131

Query: 610 INSMLQCLFATNMFR 624
            NS+LQC++    FR
Sbjct: 132 CNSVLQCIYNLPEFR 146

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 21/132 (15%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILN--IVLKNNETLKYRLYA 974
            R      LP  L +HL RF Y   ++N  +     I YPL L+      ++ + KY L  
Sbjct: 561  RKVGLKQLPHTLALHLKRFKYS-EEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTG 619

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVK--HETSHGNLSQGVNKVS 1031
            +V H  G    GHY SL         +N+   W  FDDE V+  HE++        + ++
Sbjct: 620  IVVHMGGGPQHGHYVSLC--------KNDNFGWLLFDDETVEAVHESTVSKFIGDRDSLT 671

Query: 1032 SKDVYVLFYERI 1043
            +   YVLFY+ I
Sbjct: 672  T--AYVLFYKEI 681

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLF 627
           + G  N G TCY NS+LQCL+    FR L 
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLL 152

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 89/232 (38%), Gaps = 58/232 (25%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMF---RDLFEPSNYERFFNPELEDTGKLSKSFSVLIR 655
            GL NLG +CY+NS LQCLF   +     D+   S       P      +L+K  + L  
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKE 390

Query: 656 K--MYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLN 713
           +  +Y  G   + P SF K       +F+    QQDA EF    +D L            
Sbjct: 391 EPTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDELD----------- 435

Query: 714 AHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXX 773
                               K+ F+NS     ++P D + +  +E+ L C++C       
Sbjct: 436 --------------------KKLFKNS----DYNPND-LMKFMMEDRLQCQECHGVKYST 470

Query: 774 XTFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825
            T  ++ L + +              +LE+ IN + S EV+     + CP C
Sbjct: 471 ETSNVIQLPLQESNDAQ---------DLEERINAYFSGEVIE----FKCPNC 509

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 53/127 (41%), Gaps = 15/127 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNI--VLKNNETLKYRLYAV 975
            R      LP +L +HL RF Y   +K+       I YPL L++      + + KY L  V
Sbjct: 545  RIVGLKQLPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGV 604

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY  +         +N +  W  +DDE V+       L    +      
Sbjct: 605  VIHMGSGPQHGHYVCIC--------KNEKFGWLLYDDETVESIREETVLQFTGHPGDQTT 656

Query: 1035 VYVLFYE 1041
             YVLFY+
Sbjct: 657  AYVLFYK 663

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 68/174 (39%), Gaps = 56/174 (32%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNE-----------TVITYPLILNIVLKNNETLK 969
            I+    V LP +L++HLSR  ++    +            T+  Y L  +  +  N  +K
Sbjct: 331  IKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVK 390

Query: 970  YRLYAVVNHNGNLISGHYTSL-------------------------VNKNRDHDLENN-- 1002
            Y L +VV H G+  SGHY                            VNKNR+ ++ +N  
Sbjct: 391  YNLKSVVKHTGSHSSGHYMCYRRKTEIRFGKEDESSFRRAPVVNNEVNKNREQNVAHNDY 450

Query: 1003 ------------RQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
                        R  ++   D  +K  T+   L++       K  Y+L+YER++
Sbjct: 451  KKSRYKKVKNALRYPYWQISDTAIKESTASTVLNE------QKYAYMLYYERVN 498

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 19/108 (17%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFN---PELEDTGK----LSKSFSV 652
           G +N+G TCY+NS LQ LF  ++ +D+    NY+   N   PE E   K    L K F  
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMI--LNYKTEGNNISPEDELHHKIVIELKKCFET 167

Query: 653 LIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDD------QQDAQEFL 694
           L  K +     +V+P   L +     P F   D       QQDA+E  
Sbjct: 168 LDGKKFK----AVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELF 211

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 965  NETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNL 1023
            N +  Y L  ++ H G N  SGHY S +   RD   EN+  +WY F+D+ V  E     +
Sbjct: 431  NPSCVYDLIGIITHQGANSESGHYQSFI---RD---ENDEDKWYKFNDDKV-SEYEKDKI 483

Query: 1024 SQGVNKVSSKDVYVLFYE 1041
             Q      S    +L Y+
Sbjct: 484  EQLAGGGESDSALILIYK 501

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 20/106 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKNE------TVITYPLILNIVLKNNET--L 968
            +   F + PPVL + L RF YD     L K N+      ++     I  +  ++ E    
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             Y+L+ V+ H G++ +GHY +++  + +        QWY FDDE V
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKV 468

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 9/107 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            G +N GATCY+NS+LQ  F T  FR L        +  P   D+   + S  + +++ +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YQIPTENDSP--NNSVPLALQRAF 243

Query: 659 MNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
                S  P   L++      D      Q D QE   + +DRL +++
Sbjct: 244 YQLQVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKM 290

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 62/149 (41%), Gaps = 15/149 (10%)

Query: 555 PAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSML 614
           P +V   +  P+  + L S P ++ +F     E +  ++++    GL+NLG TCY+NS L
Sbjct: 64  PGQVVMVLGTPD--ANLVSKPQKEHRFIEDLDESAQMQHLSQLPVGLKNLGNTCYMNSTL 121

Query: 615 QCLFATNMFRDL---FEPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFL 671
           Q L+     R+    F+P    R     ++   +L + F  L  +       S  P   L
Sbjct: 122 QALYQIRPLREEILNFQPPKENRSGEQHIQLVAELKRCFQQLRDRPQE----STTPILLL 177

Query: 672 KICNFLRPDFNIPDD------QQDAQEFL 694
                  P F   D       QQDA+E  
Sbjct: 178 ATLRKCYPQFAERDQESGFYKQQDAEELF 206

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 35/137 (25%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNI---VLKNNETL--KYRLY 973
            I+  + +  P  L+IHL +F ++ T   K +  ++YP+ L++        +TL  KY+L 
Sbjct: 571  IKRNSILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEYCEDQQKTLPVKYQLI 630

Query: 974  AVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            +VV H G +L SGHY +   +            W  +DDE              +NK++ 
Sbjct: 631  SVVVHEGRSLSSGHYIAHCKQPDG--------SWATYDDEY-------------INKITE 669

Query: 1033 KDV------YVLFYERI 1043
            K +      Y L Y R+
Sbjct: 670  KQMLKEPGAYYLIYTRL 686

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 21/108 (19%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDL---FEPSNYERFFNPELEDTGK----LSKSFSV 652
           GL+N+G TCY+N+ LQ LF  +  RDL   ++P+      +P+ E   K    + + F  
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKA----SPQDEMHHKIVLEMKRCFEN 163

Query: 653 LIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
           L  K Y     SV+P   L +     P F   D       QQDA+E  
Sbjct: 164 LENKSYK----SVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELF 207

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 55/126 (43%), Gaps = 14/126 (11%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFE--PSNYERFFNPELEDTGKLSKSFSVLI 654
              GL+N GATCY+NS+LQ  F T +FR +    PS  E   +P       L +SF +L 
Sbjct: 200 GFIGLKNQGATCYLNSLLQSYFFTKLFRKIVYKIPSENE---SPNDSVLLALQRSFYLLQ 256

Query: 655 RKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNA 714
           +        S      L++      D      Q D QE   + +DRL   +   TEV  A
Sbjct: 257 K--------SNETLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKG-TEVEGA 307

Query: 715 HPELLL 720
             EL +
Sbjct: 308 LNELFV 313

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 922  RATNFVTLPPVLVIHLSRFYYD-----LTKKN------ETVITYPLILNIVLKNNET-LK 969
            +   F + P VL + L RF YD     L K N      ET+   P +   VLK N     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L+ V+ H+G +  GHY +++  +          QW+ FDD+ V
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDVG-------DQWFRFDDDKV 476

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 59/131 (45%), Gaps = 17/131 (12%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y L +KN        I YPLIL++    N+++  KY L +
Sbjct: 497  RIVGLKKLPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELIS 555

Query: 975  -VVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
             VV+  G    GHY S+         ++++  W  FDDE V+       L    +     
Sbjct: 556  IVVHLGGGPHHGHYVSIC--------KSDKFGWLLFDDETVESINEETVLKFVGDPEDQT 607

Query: 1034 DVYVLFYERID 1044
              YVLFY  ID
Sbjct: 608  TAYVLFYREID 618

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR-DLFEPSNYERFFNPELEDTGKLSKSFSV 652
           I G  N G TCY NS+LQCLF  + FR D+ +    E     +L+ +G   + F++
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGRKLKYSGNTPRIFTL 176

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 65/135 (48%), Gaps = 33/135 (24%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIV--LKNNET-LKYRLYAV 975
            ++ ++ +  P  L++HL +F ++ T   K +  ++YP+ L++    ++ E  +KY+L +V
Sbjct: 620  VKHSSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCESKELPVKYQLLSV 679

Query: 976  VNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G +L SGHY +   K  D         W  +DDE              +N +S +D
Sbjct: 680  VVHEGRSLSSGHYIAHC-KQPD-------GSWATYDDEY-------------INIISERD 718

Query: 1035 V------YVLFYERI 1043
            V      Y L Y R+
Sbjct: 719  VLKEPNAYYLLYTRL 733

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 77/206 (37%), Gaps = 56/206 (27%)

Query: 591 NKYVALSITGLRNLGATCYINSMLQCL--------FATNMFRDLFEPSNYERFFNPELED 642
           +K+  L   GL N G TCY N+ +Q +        +  ++    ++ +  +   +  L +
Sbjct: 354 DKFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGKYDSTISKNSVSYTLAE 413

Query: 643 TGK-----LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLT 697
           T K     +SK+    +   Y+N    +   S L   N +  ++     Q+D+ E+ M  
Sbjct: 414 TSKKMWLPVSKNPRKNVSASYINPKHLI---SRLDDINCMMSEW----QQEDSHEYFMSL 466

Query: 698 IDRLHDELSNQTEVLNAHP--ELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQG 755
           + RL ++      V   H   E ++YD                             IF G
Sbjct: 467 MSRLQED-----SVPKGHKLIESIIYD-----------------------------IFGG 492

Query: 756 QLENGLHCKKCGXXXXXXXTFYILSL 781
            L+  + CK CG        FY LSL
Sbjct: 493 LLKQIVTCKSCGSISKTEQPFYDLSL 518

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 93/210 (44%), Gaps = 39/210 (18%)

Query: 558 VPKNVVAPEQLSQLDSYPMRQRQFSVPTIERSNNKYVALSIT--GLRNLGATCYINSMLQ 615
           VP +V +PE L  +       + F+  T++ +  K +   +   G+ N G+ C+I+S+LQ
Sbjct: 294 VPPSVKSPEPLGSVALRVCFDKNFTNHTLQSTKAKKLITELVPRGIYNKGSICFISSVLQ 353

Query: 616 CLFATNMF-------------------------RDLFEPSNYERFFNPELEDTGKLSKSF 650
            L     F                          D+F+  + E   N EL +T + SK+ 
Sbjct: 354 LLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRETIVN-ELNETRENSKTK 412

Query: 651 SVLIRKMYMNGGC-SVVPTSFLKICNFLRPDFN--IPDDQQDAQEFLMLTIDRLHDELSN 707
           S   +   +N    S+ P  F K  + L P F       Q+DA+EFL   +D+LH+E   
Sbjct: 413 S---KSSNLNENIISIDPEPFYKSISTL-PKFKDLTWGRQEDAEEFLTHMLDQLHEEFIG 468

Query: 708 QTEVLNAHPELLLYDAETSKVQKEEYKQWF 737
               LN++  L ++ +    +Q+++ K +F
Sbjct: 469 SINTLNSNDILNIFQS----LQEDDQKVFF 494

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 11/88 (12%)

Query: 959  NIVLKNN--ETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDD-EVV 1014
            N+V  +N  E+ KY L  V+ H+G +   GHYT  V    D DL+    +WY  DD  V 
Sbjct: 692  NLVSTSNSEESFKYYLSGVIYHHGVSPSGGHYTCDV---YDKDLD----KWYRIDDVNVD 744

Query: 1015 KHETSHGNLSQGVNKVSSKDVYVLFYER 1042
            + +     L  G +   S+  Y+L YE+
Sbjct: 745  EIKNKEDILRSGDSASDSRTAYILLYEK 772

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 37/139 (26%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYD--LTKKNETVITYPLILNIVL-----KNNETL--KYR 971
            I+  + +  P  L++HL +F ++   + K +  + YP+ L++       +  E L  KY+
Sbjct: 549  IKCNSILRAPETLLVHLKKFRFNGQSSSKMKQAVAYPMFLDLTEYCEDPEKGEKLPVKYQ 608

Query: 972  LYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKV 1030
            L +VV H G +L SGHY +     R  D       W  +DDE              +NK+
Sbjct: 609  LISVVVHEGRSLSSGHYIAHC---RQPD-----GSWAIYDDEY-------------INKI 647

Query: 1031 SSKDV------YVLFYERI 1043
            S ++V      Y L Y R+
Sbjct: 648  SERNVLKEPNAYYLIYTRL 666

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 23/131 (17%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYD--LTKKNETVITYPLILNIV-----LKNNETLKYRLY 973
            I+ +  +  P  LV+HL +F ++   + K +  ++YP+ L+I       K     KY+L 
Sbjct: 705  IKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQLL 764

Query: 974  AVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            +VV H G +L SGHY +     R  D       W  +DDE++       N    +  ++ 
Sbjct: 765  SVVVHEGRSLSSGHYIAHC---RQPD-----GTWATYDDELI-------NKISELKLLTE 809

Query: 1033 KDVYVLFYERI 1043
             + Y L Y R+
Sbjct: 810  PNAYYLVYTRL 820

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 17/130 (13%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNI--VLKNNETLKYRLYA 974
            R      +P +L +HL RF Y   ++N  +     I YPL L++      + + +Y L  
Sbjct: 550  RIVGLKQVPYILSLHLKRFKYS-EEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSG 608

Query: 975  VVNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            VV H G+    GHY  +         +N +  W  +DDE V+  +    L    +     
Sbjct: 609  VVIHMGSGPQHGHYVCIC--------KNEKFGWLLYDDETVESVSEETVLKFTGHSGDQT 660

Query: 1034 DVYVLFYERI 1043
              YVLFY+ I
Sbjct: 661  TAYVLFYKEI 670

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 40/133 (30%)

Query: 930  PPVLVIHLSRFYYDLTK--KNETVITYPLILNIVL--------KNNETL--KYRLYAVVN 977
            P  L++HL +F ++ T   K +  ++YP+ L++          K  + L  KY+L +VV 
Sbjct: 593  PETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTKYCDKEATPKGQDVLPVKYQLISVVV 652

Query: 978  HNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDV- 1035
            H G +L SGHY +   K  D         W  +DDE              +NK++ +DV 
Sbjct: 653  HEGRSLSSGHYIAHC-KQPDG-------SWSTYDDEY-------------INKITERDVL 691

Query: 1036 -----YVLFYERI 1043
                 Y L Y R+
Sbjct: 692  RESNAYYLVYTRL 704

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 36/138 (26%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETV---ITYPLILNIVLKNNETLK-------- 969
            I+      LP VLV+ L RF + L   N  +   I +P  LN  +KN  + K        
Sbjct: 346  IKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEKDKHSEN 403

Query: 970  -------YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGN 1022
                   Y L  +V+H G +  GHY +    +          QW+ F+D +V       +
Sbjct: 404  GKVPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVS------S 449

Query: 1023 LSQGVNKVSSKDVYVLFY 1040
            +SQ   +V  +  Y+LFY
Sbjct: 450  ISQ--EEVLKEQAYLLFY 465

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 26/35 (74%), Gaps = 6/35 (17%)

Query: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
           VP++ER +       ++GL N+G+TC+++S+LQCL
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCL 155

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
            Anc_3.270 YBR058C
          Length = 795

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 14/84 (16%)

Query: 960  IVLKNNETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            I+  N +   YRL AVV H GN   SGHY + + K  D +L     +W  ++DE +    
Sbjct: 724  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIV--- 775

Query: 1019 SHGNLSQGVNKVSSKDVYVLFYER 1042
                +S  ++++  KD Y+ FY R
Sbjct: 776  ----VSDNIDEI-KKDGYIYFYSR 794

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 599 TGLRNLGATCYINSMLQCLF 618
            G  NLG +CY+NS+LQCLF
Sbjct: 333 CGFINLGNSCYLNSVLQCLF 352

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 18/96 (18%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNIV-----LKNNET--LKYRLYAVVNH 978
            LPP+LV+ L RF + +   N  +   + YPL LN+        N ET  + Y L  +++H
Sbjct: 355  LPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIYELTGILSH 414

Query: 979  NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             G++  GHY  +        L+ N  +W+ F+D ++
Sbjct: 415  IGSINEGHYVVV--------LKINDGRWFKFNDSMI 442

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 23/119 (19%)

Query: 929  LPPVLVIHLSRFYYDL---TKKNETVITYPLILNI--VLKNNET--LKYRLYAVVNHNGN 981
            LP VLV+ L RF + L   + K   ++ +PL LN+      ++   + + L  ++ H G 
Sbjct: 357  LPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFELIGIIAHRGT 416

Query: 982  LISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
            +  GHY +       H        W+ F+D +V   T          ++  +  Y+LFY
Sbjct: 417  VNEGHYIAFTKVTTGH--------WFKFNDSMVSSITE--------EELLQEQAYLLFY 459

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 6/35 (17%)

Query: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCL 617
           +P +ER +       + GL N+G+TC+++S++QCL
Sbjct: 127 IPKLERRD------GLQGLLNMGSTCFMSSIVQCL 155

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 18/140 (12%)

Query: 569 SQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDL-- 626
           + L S P ++  F          +  A S  G +N+G TCY+N+ LQ L+  +  RD+  
Sbjct: 79  ANLISKPAKKNNFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMIL 138

Query: 627 -FEPSNYERFFNPELEDTGK-----LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPD 680
            + PS      + + E+T K     + + F  L  K +     SV+P   L       P 
Sbjct: 139 NYNPSEGVSSSSAQDEETHKQIVIEMKRCFENLHNKSFK----SVLPIVLLNTLRKCYPQ 194

Query: 681 FNIPDD------QQDAQEFL 694
           F   D       QQDA+E  
Sbjct: 195 FAERDQQGGFYKQQDAEELF 214

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 6/54 (11%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNP--ELEDT--GKLSK 648
           TGL N+G TCY+NS+LQ  F+ +  RD     NY++  N   ++ED   G++SK
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYV--LNYQKMLNCFRDIEDATGGEISK 752

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 54/127 (42%), Gaps = 15/127 (11%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNI--VLKNNETLKYRLYAV 975
            R      LP +L +HL RF Y   +++       I YPL L++     ++ + KY L  V
Sbjct: 539  RIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGV 598

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKD 1034
            V H G+    GHY  +         +N +  W  +DDE V+       L    +      
Sbjct: 599  VIHMGSGPQHGHYVCIC--------KNEKFGWLLYDDETVESIREETVLKFTGHPGDQTT 650

Query: 1035 VYVLFYE 1041
             YVLFY+
Sbjct: 651  AYVLFYK 657

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+  + FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 55/142 (38%), Gaps = 35/142 (24%)

Query: 929  LPPVLVIHLSRFYY-------------------------DLTKKNETVITYPLILNIVLK 963
            LP VL+IHL RF +                          ++  +E VI    I N    
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 964  NNETLKYRLYAVVNHNG-NLISGHYTS-LVNKNRDHDLENNRQQWYYFDDEVVKHETSHG 1021
              E   Y L  VV H+G +   GHYT+ + +K  D        +WY  DD  V       
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTADIYHKEVD--------KWYRIDDVTVTELEKDD 997

Query: 1022 NLSQGVNKVSSKDVYVLFYERI 1043
             L  G N   S+  Y+L Y+++
Sbjct: 998  VLKGGENSTDSRTAYILMYQKL 1019

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 54/141 (38%), Gaps = 33/141 (23%)

Query: 929  LPPVLVIHLSRF-----------------YYDLTKKNETVITYPLILNI--------VLK 963
            LP +L+I L RF                 Y    +K    I+Y   L I         L+
Sbjct: 681  LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR 740

Query: 964  NNETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGN 1022
            NN +  Y L  V+ H+G +   GHYT+ V            + WY  DD  +        
Sbjct: 741  NNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDDVNITKLEDDDV 793

Query: 1023 LSQGVNKVSSKDVYVLFYERI 1043
            L  G + + S+  Y+L Y+ +
Sbjct: 794  LKGGEDNMDSRTAYILMYQNV 814

 Score = 32.3 bits (72), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 53/142 (37%), Gaps = 28/142 (19%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKM-- 657
           G+ N    C+++S+LQ L     F D+    +           + KL  +   + +K   
Sbjct: 375 GIINNANICFMSSVLQVLLYCAPFVDILNVVSTRNMNAKSGSSSAKLLDACLTIYKKFDK 434

Query: 658 -------------YMNGGCSVVPTSFLKICNFLRPD------FNIP-------DDQQDAQ 691
                           G     P ++  I   + PD        IP         Q+DA+
Sbjct: 435 ANYEKEKEKESEKEKPGSKKSSPPAYASITEAVNPDEFYRSLSTIPKFKDLRWGHQEDAE 494

Query: 692 EFLMLTIDRLHDELSNQTEVLN 713
           EFL   +D+LH+EL +  + L+
Sbjct: 495 EFLTHLLDQLHEELISAIDSLS 516

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 32/136 (23%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETV---ITYPLILNI----VLKNNET------ 967
            I+      LP VLV+ L RF + L   N  +   I +P  LN+     ++ +E       
Sbjct: 346  IKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNKK 405

Query: 968  ---LKYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLS 1024
               + Y L  +V+H G +  GHY +    +          QW+ F+D +V       ++S
Sbjct: 406  VPDIIYELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVS------SIS 451

Query: 1025 QGVNKVSSKDVYVLFY 1040
            Q   +V  +  Y+LFY
Sbjct: 452  Q--EEVLKEQAYLLFY 465

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (42%), Gaps = 46/198 (23%)

Query: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELED 642
           VP +ER +       ++GL N+G+TC+++S+LQCL     F    + S  +  FN     
Sbjct: 127 VPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF---IKHSMSQSHFNKCKVR 177

Query: 643 T--GKLSKSFSVLIRKMYMNGGCSVVPTS-----------FLKICNFLRPDFNIPD-DQQ 688
           +     S +   ++ ++Y        P+S           +L  C + + + N+    QQ
Sbjct: 178 SPDNCFSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYLLTCAW-KINQNLAGYSQQ 236

Query: 689 DAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSP 748
           DA EF    I+++H     Q  VL+           T +  KE  K    + +++T    
Sbjct: 237 DAHEFWQFIINQIH-----QNYVLSL--------PSTKESDKENIKHC--DCIVHT---- 277

Query: 749 IDKIFQGQLENGLHCKKC 766
              +F+G LE+ + C  C
Sbjct: 278 ---VFEGSLESSIVCPSC 292

>TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {ON}
            Anc_3.270 YBR058C
          Length = 780

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 39/75 (52%), Gaps = 14/75 (18%)

Query: 970  YRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
            Y+L AVV H GN + SGHY + + KN D     N+  W  F+DE +        L+Q  +
Sbjct: 718  YQLTAVVCHKGNSVHSGHYVAFIKKNID-----NKSNWVLFNDEKIV-------LAQDTD 765

Query: 1029 KVSSKDVYVLFYERI 1043
            ++  K+ Y+  Y R 
Sbjct: 766  EL-KKNGYIYVYTRC 779

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 57/140 (40%), Gaps = 18/140 (12%)

Query: 569 SQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDL-- 626
           + L S P ++  F          +  A +  G +N+G TCY+N+ LQ L+  +  RD+  
Sbjct: 79  ANLISKPAKRNNFIEDLAPEQQVQQFAETPVGFKNMGNTCYLNATLQALYRVDDLRDMIL 138

Query: 627 -FEPSNYERFFNPELEDTGK-----LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPD 680
            + PS        + E+T K     + + F  L  K +     SV+P   L       P 
Sbjct: 139 NYNPSQEASNSGVQDEETHKQIIIEMKRCFENLQNKSFK----SVLPIVLLNTLRKCYPQ 194

Query: 681 FNIPD------DQQDAQEFL 694
           F   D       QQDA+E  
Sbjct: 195 FAERDAQGGFYKQQDAEELF 214

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 17/103 (16%)

Query: 926  FVTLPPVLVIHLSRFYYD-----LTKKNETV-----ITYPLILNIVLKNNETLKYRLYAV 975
            F + PPVL + L RF YD     L K N+       I     L+     +    Y L+ V
Sbjct: 377  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 976  VNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            + H+G++ +GHY +++  +           WY FDD+ V   T
Sbjct: 437  LVHSGDISTGHYYAMIQPDA-------HGSWYRFDDDRVIKAT 472

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDL 626
              G +N GATCY+NS+LQ    T +FR L
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKL 224

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 51/122 (41%), Gaps = 15/122 (12%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMYM 659
           GLRN+G TCY N+ LQ L+     R+     N     NP+L   G+L             
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLAYNEP---NPDLH--GQLVIQLRNCFNAFAQ 161

Query: 660 NGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEF---LMLTIDRLHDE-LSNQT 709
                  P   L +   + P F   D       QQDA+E    L+ TID +  E LS++ 
Sbjct: 162 RKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTIDTVFGESLSSKF 221

Query: 710 EV 711
           E+
Sbjct: 222 EI 223

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 10/106 (9%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRKMY 658
            G +N+G TCY+N+ LQ L+  N  RD+    N  +  +       ++ K   + +++ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCF 168

Query: 659 MN----GGCSVVPTSFLKICNFLRPDFNIPDD------QQDAQEFL 694
            N       SV+P   L       P F   D       QQDA+E  
Sbjct: 169 ENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELF 214

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 34/130 (26%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV---ITYPLILNIV-------------LKNNET--LKY 970
            LP VLV+ L RF + L   N  +   I +P  LN+              + N +   + Y
Sbjct: 354  LPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIGNGKVPDIIY 413

Query: 971  RLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKV 1030
             L  +V+H G +  GHY +    +          QW+ F+D +V       ++SQ   +V
Sbjct: 414  ELIGIVSHKGTVNEGHYIAFCKISGG--------QWFKFNDSMVS------SISQ--EEV 457

Query: 1031 SSKDVYVLFY 1040
              +  Y+LFY
Sbjct: 458  LKEQAYLLFY 467

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 6/36 (16%)

Query: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLF 618
           VP +ER +       ++GL N+G+TC+++S+LQCL 
Sbjct: 127 VPAMERRD------GLSGLINMGSTCFMSSILQCLI 156

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYP--LILN-IVLKNNE-----TLKY 970
           ++ T  V  P VL++HLSR  ++     KN   +T+P  L++N  +L+NN+      ++Y
Sbjct: 379 VKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAVRY 438

Query: 971 RLYAVVNHNGNLISGHYTSLVNK 993
           +L A++ H G    GHY    +K
Sbjct: 439 KLCAMIKHIGTHSQGHYACFRHK 461

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 62/137 (45%), Gaps = 36/137 (26%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIV----LKNNETL--KYRLY 973
            + +  +  P  L+IHL +F ++ T   K +  ++YP+ L++        +  L  KY+L 
Sbjct: 699  KRSTILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQLL 758

Query: 974  AVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSS 1032
            +VV H G +L SGHY +   K  D         W  +DDE              +NK+S 
Sbjct: 759  SVVVHEGRSLSSGHYIAHC-KQPDG-------SWATYDDEY-------------INKISE 797

Query: 1033 KDV------YVLFYERI 1043
            +++      Y L Y R+
Sbjct: 798  REMLKEPNAYYLLYTRL 814

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 65/164 (39%), Gaps = 52/164 (31%)

Query: 927  VTLPPVLVIHLSRFYYD----------LTKKNETVIT-YPLILNIVLKNNETLKYRLYAV 975
            V LP VLVIHLSR  ++          +  + E  +T Y  I N+ L  N  + Y L +V
Sbjct: 345  VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 976  VNHNGNLISGHYTS----------------------LVNKNRDHDLENNRQQ-------- 1005
            V H G+   GHY                        + N+N + ++ NN  +        
Sbjct: 405  VKHTGSHSRGHYMCYRRKGDILFDKEDESFVDSRSIITNRNHNENITNNHGKRRYKRVKS 464

Query: 1006 -----WYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044
                 ++   D  +K   +   L++       K  Y+L+YER++
Sbjct: 465  ASQYPYWQISDGAIKQRATSTVLNE------QKYAYMLYYERVN 502

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 86/205 (41%), Gaps = 44/205 (21%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF-----NPELEDT-----GKLSK 648
           TGL N+G TCY+NS+LQ  FA +  RD  E  NY +       N +L+       G+++ 
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD--EIINYTKTVDDIENNLQLQGITRRVGGRVTN 804

Query: 649 SFSV------------LIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQ----- 691
           +  V            L  +M  +    V P   L    F   +  +  D +D +     
Sbjct: 805 TIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSEDGKSQRDN 864

Query: 692 ---EFLMLTIDRLHDEL-----SNQTEVLNAHPELLLYDAETS---KVQKEEYKQWFENS 740
              E + +  D  +D L     SN     N   E LL D +++   K+++EE K+   N+
Sbjct: 865 ISTETVDVGADGKNDNLLVDFDSNIGA--NGRDEKLLVDLDSNISDKIKEEEVKKI--NT 920

Query: 741 LINTKFSPIDKIFQGQLENGLHCKK 765
           L     + + KI   QLEN L   +
Sbjct: 921 LKPVTSTRVAKISPDQLENALEMGR 945

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 16/106 (15%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGK-----LSKSFSVLI 654
           G +N+G TCY+N+ LQ L+     RD+    N      P +++T K     + + F  L 
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTP-VDETHKKIVVEMKRCFENLK 168

Query: 655 RKMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
            K Y     SV+P   L       P F   D       QQDA+E  
Sbjct: 169 SKSYK----SVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELF 210

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 14/76 (18%)

Query: 970  YRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDE---VVKHETSHGNLSQ 1025
            Y L  V+ H G N  SGHY S +  + D D      +WY F+D+   VV  E   G    
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKVSVVPKEKIEGLAGG 478

Query: 1026 GVNKVSSKDVYVLFYE 1041
            G     S    +L Y+
Sbjct: 479  G----ESDSALILIYK 490

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 11/105 (10%)

Query: 939  RFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDH 997
            ++ +DLT   E + +  +    +  +N+T  Y+L  VV H+G +   GHYT+ V      
Sbjct: 739  KYDHDLTIPKEALSS--INAKFLFSDNDT-SYKLTGVVYHHGLSSSGGHYTADV------ 789

Query: 998  DLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYER 1042
             L  + ++WY  DD  V        ++ G     S+  Y+L Y+R
Sbjct: 790  -LHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTAYILIYQR 833

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 39.3 bits (90), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 56/134 (41%), Gaps = 27/134 (20%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTK---KNETVITYPLILNI--VLKNNET------LK 969
            I+  +   LP VLV+ L RF + L     K    I YP  LN+     + ++      L 
Sbjct: 343  IKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDLI 402

Query: 970  YRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNK 1029
            Y L  VV H G +  GHY +          +   +QW+ F+D +V   T    L++    
Sbjct: 403  YELIGVVAHKGTVNEGHYVATT--------KVAGRQWFKFNDSMVSSVTQEEALNE---- 450

Query: 1030 VSSKDVYVLFYERI 1043
                  Y+LFY  +
Sbjct: 451  ----QAYLLFYSVL 460

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 16/132 (12%)

Query: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELED 642
           VP++ER +       + GL NLG+TC+++S+LQ L     F + F  S       P  + 
Sbjct: 127 VPSVERRD------GLHGLLNLGSTCFMSSILQILIRNPYFFN-FSISQSHSKKCPIQDP 179

Query: 643 TGKLSKSFSVLIRKMYMNGGCS---VVPTSF------LKICNFLRPDFNIPDDQQDAQEF 693
              +S +   ++ + Y +   S   V P +       L +C++   +      QQDA EF
Sbjct: 180 KSCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYSQQDAHEF 239

Query: 694 LMLTIDRLHDEL 705
               +++LH + 
Sbjct: 240 WQFLLNQLHHDF 251

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 23/124 (18%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFR------------DLFEPSNYERFFNPELEDTGKL 646
            GL NLG +CYINS+LQCL    +              D+  PS   +    +L +  KL
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIKL 381

Query: 647 SKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
                    ++Y +G   + P SF K       +F+  + QQDA EFL    D L  ++ 
Sbjct: 382 EP-------ELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTLDKKIF 430

Query: 707 NQTE 710
           +++E
Sbjct: 431 SRSE 434

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 16/77 (20%)

Query: 970  YRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDE--VVKHETSHGNLSQG 1026
            Y+L AVV H GN   SGHY + + K+ + +     ++W  ++DE  VV  E +   +   
Sbjct: 717  YKLVAVVCHKGNSAHSGHYVAFIRKSVEQE-----EKWVLYNDEKIVVAVEDNFEEI--- 768

Query: 1027 VNKVSSKDVYVLFYERI 1043
                  K+ Y+ FY R+
Sbjct: 769  -----RKNGYLYFYSRV 780

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 33/74 (44%), Gaps = 8/74 (10%)

Query: 970  YRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVN 1028
            YRL  VV H+G +   GHYT+ V       L   + +WY  DD  V          +G  
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNVTEIRQEDVFKRGDE 775

Query: 1029 KVSSKDVYVLFYER 1042
               SK  Y+L Y+R
Sbjct: 776  ASDSKTAYILIYQR 789

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 21/106 (19%)

Query: 921  IRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNE------------TL 968
            IR  +   LPPVL++ L RF + +   +  +  Y +  ++ L   +             L
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDY-IFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 969  KYRLYAVVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
             ++L A++ H G +  GHYT++   N D         W  F+D +V
Sbjct: 411  TFKLSAIIPHQGTVDKGHYTTICRINGD--------VWAKFNDSMV 448

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 23/115 (20%)

Query: 599 TGLRNLGATCYINSMLQCLF------------ATNMFRDLFEPSNYERFFNPELEDTGKL 646
            GL NLG +CY+NS+LQCLF              +  +D+  P+N    F  +L    KL
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNN---FKCQLI---KL 376

Query: 647 SKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
           + +  V  +  Y  G   + P SF K       +F+    QQD+ EFL   +D L
Sbjct: 377 NNAMKVEPQN-YPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL 426

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 57/140 (40%), Gaps = 18/140 (12%)

Query: 569 SQLDSYPMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDL-- 626
           + L S P+++  F          +  A    G +N+G TCY+N+ LQ L+  N  R++  
Sbjct: 79  ANLISKPIKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMIL 138

Query: 627 -FEPSNYERFFNPELEDTGK-----LSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPD 680
            + PS        + E+T K     + + F  L  K +     SV+P   L       P 
Sbjct: 139 NYNPSQGVSNNGVQDEETHKQIVIEMKRCFENLQNKSFK----SVLPIVLLNTLRKCYPQ 194

Query: 681 FNIPD------DQQDAQEFL 694
           F   D       QQDA+E  
Sbjct: 195 FAERDPQGGFYKQQDAEELF 214

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 51/130 (39%), Gaps = 19/130 (14%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTK----KNETVITYPLILNIVLKNNETL--KYRLYAV 975
            R      LP  L +HL RF Y   K    K    I YP  L +    +  L  +Y L + 
Sbjct: 505  RLVGLKRLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASA 564

Query: 976  VNHNGNLIS-GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLS-QGVNKVSSK 1033
            V H G+    GHY SL         +     W  FDDE V+       LS  G N   S 
Sbjct: 565  VIHLGDGPQYGHYISLC--------KTETFGWLLFDDETVEAVDEQTVLSFTGEN---SD 613

Query: 1034 DVYVLFYERI 1043
              YVLFY  +
Sbjct: 614  TAYVLFYNEV 623

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           I G  N G TCY NS+LQC F  ++FR
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFR 152

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 58/131 (44%), Gaps = 23/131 (17%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYA 974
            R      LP  L +HL RF Y   ++N  +     + YPL L++    N  +  +Y L  
Sbjct: 952  RIVGLKQLPKTLSLHLKRFKYS-EEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNG 1010

Query: 975  VVNH-NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSK 1033
            +V H  G    GHY ++         +N++  W   DDE V+  +    L     K  SK
Sbjct: 1011 IVVHMGGGPQHGHYVAIC--------KNDKFGWLLMDDETVETISEETVLRC---KGDSK 1059

Query: 1034 DV---YVLFYE 1041
            D+   YVLFY+
Sbjct: 1060 DLTTAYVLFYK 1070

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 600 GLRNLGATCYINSMLQCLF-ATNMFRDLFE 628
           G  N G TCY NS+LQCL+  TN+  ++ +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQ 546

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYE 633
           TGL N+G TCY+NS+LQ  F  +  RD  +  NYE
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYIQ--NYE 728

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 51/130 (39%), Gaps = 27/130 (20%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTG---------KLSKSF 650
           G +N+G TCY+NS LQ L+     R+L    N          D+          +L + F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 651 SVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDD------QQDAQE-----FLMLTI- 698
             L  K +     SV+P   L       P F   D       QQDA+E     F  L++ 
Sbjct: 169 QNLKNKSFK----SVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVV 224

Query: 699 --DRLHDELS 706
             D+  DE S
Sbjct: 225 FGDKFEDEFS 234

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 970  YRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            Y L  V+ H G N  SGHY S +  + D D      +WY F+D+ V
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDED------KWYKFNDDKV 470

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 19/132 (14%)

Query: 922  RATNFVTLPPVLVIHLSRFYYDLTKKNE----TVITYPLILNIVLKNNETL--KYRLYA- 974
            R      LP +L +HL RF Y  T+         I YPL L +    + ++  +Y L   
Sbjct: 551  RIVGLKQLPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGI 610

Query: 975  VVNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKH--ETSHGNLSQGVNKVSS 1032
            VV+  G    GHY SL         +N +  W  FDDE V+   E+S       ++ +++
Sbjct: 611  VVHMGGGPHHGHYVSLC--------KNEKFGWLLFDDETVESVDESSVMKFCGDLHDLTT 662

Query: 1033 KDVYVLFYERID 1044
               YVLFY+ I+
Sbjct: 663  --AYVLFYKEIN 672

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 64/170 (37%), Gaps = 40/170 (23%)

Query: 665 VVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAE 724
           V PTSF++I       F+     QDA EFL   ++ L D L                   
Sbjct: 421 VSPTSFVEILKRENVLFSTMM-HQDAHEFLNFLLNELSDSLQ------------------ 461

Query: 725 TSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXXXXXXTFYILSLAIP 784
                    +Q  ++S+I    + ID++F+G + N   C  C         F    + + 
Sbjct: 462 ---------RQISDDSIITPNDNFIDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPIEV- 511

Query: 785 KPXXXXXXXXKGNW-VNLEDCINMFTSDEVMSRENAWDCPKCGVTVQKEK 833
                      GN   ++++ ++ F   E+++  N + C KC    + E+
Sbjct: 512 ----------NGNCETDIQEMLSDFHQKEMLNGSNKFYCDKCCGLQEAER 551

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 80/181 (44%), Gaps = 36/181 (19%)

Query: 597 SITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELED-TGKLSKSFSVLIR 655
            ++GL N+G+TCY++ ++QCL     F  L    N   F   +  D T  +S +   ++ 
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYF--LKYSLNQSHFKICKTHDPTTCISCALDSIVT 192

Query: 656 KMYMNGGCS-----VVPTSFLKICNFLRPDFNIPDD-----QQDAQEFLMLTIDRLHDEL 705
             Y   G S     V  T+   + + L   + I  +     QQDA EF    ++RLH E 
Sbjct: 193 DFY---GISDLDDDVKKTNNDGLIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRLHSEY 249

Query: 706 SNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKK 765
            +     N  P       +T+ +++  ++      L N  +    K+FQG L++ + C +
Sbjct: 250 KS-----NIGP------TDTAPLKEGNHE------LCNCIYH---KVFQGFLKSSIVCPE 289

Query: 766 C 766
           C
Sbjct: 290 C 290

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 21/99 (21%)

Query: 929  LPPVLVIHLSRFYYDLTK---KNETVITYPLILNI-----VLKNNET-----LKYRLYAV 975
            L PVL+    RF + L+    K   VI +PL LN+     V + +++     L Y L  +
Sbjct: 352  LSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDLIYELIGI 411

Query: 976  VNHNGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            + H G +  GHYT++         +    QW  F+D +V
Sbjct: 412  ICHTGTVNEGHYTAIC--------KIPEGQWIKFNDSMV 442

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 37/145 (25%)

Query: 929  LPPVLVIHLSRFYY--DLTKKN-----------------------ETVITYPLILNIVLK 963
            LP VL+I L RF +  ++ K N                       E +I    + +I LK
Sbjct: 771  LPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 830

Query: 964  NNET----LKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            N+ +     +Y+L  V+ H+G +   GHYT+ V  +++H+      +WY  DD  +    
Sbjct: 831  NHTSGVDDRRYKLTGVIYHHGVSSDGGHYTADV-YHKEHN------KWYRIDDVNITELE 883

Query: 1019 SHGNLSQGVNKVSSKDVYVLFYERI 1043
                L  G     S+  Y+L Y+++
Sbjct: 884  DDDVLKGGEEASDSRTAYILMYQKV 908

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 14/80 (17%)

Query: 965  NETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNL 1023
            NE  KY+L +VV H GN + SGHY + + K  +     N ++W  ++DE +        +
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIE-----NVERWVLYNDEKIV-------I 229

Query: 1024 SQGVNKVSSKDVYVLFYERI 1043
            ++ + ++ SK+ Y+  Y R+
Sbjct: 230  AEDLEEL-SKNGYIYIYSRV 248

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE 639
           + G  N G TCY NS+LQCL+  +  RD       E  F+PE
Sbjct: 126 VFGFENFGNTCYCNSVLQCLYNFSELRDNLILYPEEAKFDPE 167

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 17/124 (13%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV-----ITYPLILNIVLKNNETL--KYRLYAVVNHNG- 980
            LP +L +HL RF Y   + N  +     ITYP  L++    + ++  KY L  ++ H G 
Sbjct: 549  LPKILSLHLKRFKYS-EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGA 607

Query: 981  NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFY 1040
                GHY ++         +  +  W  +DDE V+       L    +       Y+LFY
Sbjct: 608  GPQHGHYVAMC--------KTEKFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILFY 659

Query: 1041 ERID 1044
            + I+
Sbjct: 660  KTIE 663

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 10/72 (13%)

Query: 926 FVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNI---VLKNNE-----TLKYRLYAV 975
            V  P VL+IHLSR  ++ T   +N   + +  IL +   V++N+      ++ Y L A+
Sbjct: 466 VVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGINSVNYELKAI 525

Query: 976 VNHNGNLISGHY 987
           V H G+   GHY
Sbjct: 526 VKHAGSHSQGHY 537

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYP--LILN-IVLKNNETL-----KY 970
           ++ T  V+ P VL++HLSR  +D     KN   + +P  LILN   +K +  +     +Y
Sbjct: 395 LKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVHCVRY 454

Query: 971 RLYAVVNHNGNLISGHY 987
           +L A++ H G    GHY
Sbjct: 455 KLQAMIKHTGTHFQGHY 471

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 49/114 (42%), Gaps = 21/114 (18%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELE-----DTGKLSKSFSVL 653
            GL NLG +CY+NS++Q L    +      PS    F   E           L   +  L
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGV------PSWSLDFLGSEFPLDVVYPANNLKCQWIKL 376

Query: 654 IR------KMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
           +       K+Y NG   + PT+F K       +F+  + QQDA EFL   +D L
Sbjct: 377 LNAMKHEPKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSL 426

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 45/105 (42%), Gaps = 12/105 (11%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDL---FEPS-NYERFFNPELEDTGKLSKSFSVLIR 655
           G +N+G TCY+N+ LQ L+  +  RD    F+ S N ++  N E E   KL         
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDK--NGENETHIKLVTELKRCFE 165

Query: 656 KMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
            +      SV+P   L       P F   D       QQDA+E L
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELL 210

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 959  NIVLKNNETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            N+    N +  Y L  ++ H G N  SGHY + +   RD   EN+   WY F+D+ V
Sbjct: 419  NLQTGENPSSVYDLVGIITHQGANSESGHYQAFI---RD---ENDENIWYKFNDDKV 469

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 35/141 (24%)

Query: 929  LPPVLVIHLSRF-YYDLTKKNETVITY----------------------PL--ILNIVLK 963
            LP VL+I L RF + + T K+ ++I Y                      P+  I +    
Sbjct: 662  LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNAL 721

Query: 964  NNETLKYRLYAVVNHNG-NLISGHYTSLV-NKNRDHDLENNRQQWYYFDDEVVKHETSHG 1021
             +E  +Y L  V+ H+G +   GHYT+ V +K  D        +WY  DD  +       
Sbjct: 722  RDEDRQYSLSGVIYHHGLSSDGGHYTADVYHKETD--------KWYRIDDINITEVQKDS 773

Query: 1022 NLSQGVNKVSSKDVYVLFYER 1042
             L  G + V S+  Y+L Y++
Sbjct: 774  VLKGGEDGVDSRTAYILMYQK 794

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLT--KKNETVITYPLILNI---VLKNNET-----LKY 970
           ++ T  V  P  LV+HLSR  +D    ++N   + +  IL     V+++N+      + Y
Sbjct: 424 VKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGINPISY 483

Query: 971 RLYAVVNHNGNLISGHY 987
           +L A+V H+G+   GHY
Sbjct: 484 KLKAIVAHSGSHSQGHY 500

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 60/141 (42%), Gaps = 33/141 (23%)

Query: 929  LPPVLVIHLSRF-YYDLTKKNETVITY------------------PLILNIV------LK 963
            LP VL+I L RF + + T K+ +++ Y                   LI+ I         
Sbjct: 693  LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAY 752

Query: 964  NNETLKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGN 1022
             +E  +Y L  V+ H+G +   GHYT+ V  +R+ D      +WY  DD  +        
Sbjct: 753  KDENRRYHLTGVIYHHGVSSDGGHYTADV-YHRESD------KWYRIDDVSIIELEKEDV 805

Query: 1023 LSQGVNKVSSKDVYVLFYERI 1043
            L  G     S+  Y+L Y++I
Sbjct: 806  LKGGEESGDSRTAYILMYQKI 826

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/158 (20%), Positives = 65/158 (41%), Gaps = 24/158 (15%)

Query: 580 QFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERF---- 635
           ++++  +  + N   ++   G+ N G  C+++S+LQ L     F  +    +Y       
Sbjct: 314 KYTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKIG 373

Query: 636 --FNPELEDTGKLSKSFS----------VLIRKMYMNGGCSVVPTSF-LKICNFLRPDFN 682
              +P L+   +L + F           V   K+       + P +  +K  +F +    
Sbjct: 374 SSVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLSK 433

Query: 683 IP-------DDQQDAQEFLMLTIDRLHDELSNQTEVLN 713
           +P         Q+DA+EFL   +D+LH+E     + LN
Sbjct: 434 LPKFRDLRWGHQEDAEEFLTHLLDQLHEEFITSIDALN 471

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 52/142 (36%), Gaps = 34/142 (23%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLK------------------------- 963
            LP VL+I L RF +      + ++ Y      V K                         
Sbjct: 638  LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSNF 697

Query: 964  -NNETLKYRLYAVVNHNGNLISG-HYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHG 1021
             ++   KY+L  VV H+G   SG HYT+ V             +W+  DD  +       
Sbjct: 698  YDDAGTKYKLVGVVYHHGVSPSGGHYTADV-------YHQEMDKWFRIDDVNIAELNKEE 750

Query: 1022 NLSQGVNKVSSKDVYVLFYERI 1043
             L  G +   S+  Y+L Y++I
Sbjct: 751  VLKGGEDGFDSRTAYILMYQKI 772

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 12/144 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNM--FRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+NS++QCL    +  + D         F    +  TG L      L+  
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNA 401

Query: 657 MYMN------GGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTE 710
             +N      G   + P SF +       +F   ++QQD+ EFL    + L   L  + +
Sbjct: 402 FKLNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGLFPKIQ 457

Query: 711 VLNAHPELLLYDAETSKVQKEEYK 734
             + +P  LL      K+Q  E K
Sbjct: 458 DASINPNNLLKFIMEDKLQCVECK 481

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 60/144 (41%), Gaps = 37/144 (25%)

Query: 929  LPPVLVIHLSRFYY--DLTKKN-----------------------ETVITYPLILNIVLK 963
            LP VL+I   RF +  ++ K N                       E +I    + +I LK
Sbjct: 774  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 833

Query: 964  NNET----LKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            NN +     +Y+L  V+ H+G +   GHYT+ V     +  E+N+  WY  DD  +    
Sbjct: 834  NNTSGIDDRRYKLTGVIYHHGVSSDGGHYTADV-----YHSEHNK--WYRIDDVNITELE 886

Query: 1019 SHGNLSQGVNKVSSKDVYVLFYER 1042
                L  G     S+  Y+L Y++
Sbjct: 887  DDDVLKGGEEASDSRTAYILMYQK 910

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 55/142 (38%), Gaps = 37/142 (26%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDL------------------------------FEP 629
           G+ N    C+++S+LQ L     F D+                              F+ 
Sbjct: 461 GIINRANICFMSSVLQVLLYCKPFIDVINVLSTRNTNSRVGTSSCKLLDACLTMYKQFDK 520

Query: 630 SNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCS----VVPTSFLKICNFLRPDFNIP- 684
             YE+ F    +D  K ++S +    K      C+    V P  F K  + + P F    
Sbjct: 521 ETYEKKFLENADDAEKTTESDAKKSSKSKSFQHCATADAVKPDEFYKTLSTI-PKFKDLQ 579

Query: 685 -DDQQDAQEFLMLTIDRLHDEL 705
              Q+DA+EFL   +D+LH+EL
Sbjct: 580 WGHQEDAEEFLTHLLDQLHEEL 601

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 967  TLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            + KY+L AV+ H GN + SGHY + + K     +   ++QW  ++DE +
Sbjct: 702  SAKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKI 745

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625
           TG+ N+G TCY+NS+LQ  FA +  R+
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLRE 748

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 66/168 (39%), Gaps = 56/168 (33%)

Query: 927  VTLPPVLVIHLSRFYYDLTK--KNETVIT---------YPLILNIVLKNNETLKYRLYAV 975
            V LP +LV+HLSR  ++     +N   +          Y L  N  +  N  +KY L +V
Sbjct: 337  VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 976  VNHNGNLISGHY----------------------TSLVN---KNRDHDLENNRQQWYYFD 1010
            V H G+   GHY                      +++VN   K R+HD     Q+  + D
Sbjct: 397  VKHTGSHSRGHYICYRRKADIRFDKGEESSLEGASTIVNNEAKTRNHD-----QKIGHND 451

Query: 1011 DEVVKHETSHGNLSQGVNKVS---------------SKDVYVLFYERI 1043
            D   +H+     L     ++S                K VY+L+YER+
Sbjct: 452  DRRSRHKKVKSVLQYPYWQISDTAIEESTTSTVLNEQKYVYMLYYERV 499

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLT--KKNETVITYP---LILNIVLKNN-----ETLKY 970
           +R + F   P + +IHLSR  ++     +N   + +    L+   +LK++     ET+KY
Sbjct: 318 VRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKY 377

Query: 971 RLYAVVNHNGNLISGHY 987
           +L ++V H G+   GHY
Sbjct: 378 KLKSIVKHTGSHYQGHY 394

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLT--KKNETVITY--PLILN-IVLKNNETL-----KY 970
           ++ T  V  P VL++HLSR  +D    +KN   +++   L++N  V++NN+ +      Y
Sbjct: 439 VKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIRKDSY 498

Query: 971 RLYAVVNHNGNLISGHY 987
           +L +++ H G+  +GHY
Sbjct: 499 KLRSMLRHQGSHSTGHY 515

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRD--LFEPSNYERFFN 637
           TG+ N+G TCY+NS+LQ  F+ +  R+  L     YE F++
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYD 792

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFR 624
           TGL N+G TCY+NS+LQ  F+ +  R
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 598 ITGLRNLGATCYINSMLQCLFATNMFR 624
           + G  N G TCY NS+LQCL+    FR
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFR 140

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 17/107 (15%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTG------KLSKSFSVL 653
           G+ N+G TCY+N+ LQ L+     R+         F + +    G      +L +     
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLRE-----QILAFDDKKATAEGMDLYHVQLIREIQAT 115

Query: 654 IRKMYMNGGCSVVPTSFLKICNFLRPDFNIPD------DQQDAQEFL 694
            RK+    G ++ P   L+I   + P F+  D       QQDA+E  
Sbjct: 116 FRKLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELF 162

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 23/122 (18%)

Query: 599 TGLRNLGATCYINSMLQCLF------------ATNMFRDLFEPSNYERFFNPELEDTGKL 646
            GL NLG +CY+NS+LQ LF             T    D+  PSN       +L +  K+
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMKI 381

Query: 647 SKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706
                    + Y NG   + PTSF +       +F+    QQD+ EF    I++L  ++ 
Sbjct: 382 EP-------ERYPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVL 430

Query: 707 NQ 708
           N+
Sbjct: 431 NK 432

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYD---LTKKN------ETVITYPLILNIVLKNNET--LK 969
           ++   FV  P + VIHLSR  Y+    T+        ET+  +  +      N  T  ++
Sbjct: 326 LKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVR 385

Query: 970 YRLYAVVNHNGNLISGHYTSLVNK 993
           YRL ++V H G+  SGHY  L  K
Sbjct: 386 YRLKSIVIHTGSHYSGHYQVLRRK 409

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 58/141 (41%), Gaps = 35/141 (24%)

Query: 929  LPPVLVIHLSRFYYDLTKKNETV------------------------ITYPL--ILNIVL 962
            LP VL+I L RF + +T  N+                          +T P+  + +  L
Sbjct: 783  LPRVLLIQLKRFAF-VTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSL 841

Query: 963  KNNETLKYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHG 1021
            +++   +Y+L  V+ H+G+    GHYT+ V             +WY  DD  +    +  
Sbjct: 842  RDDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQTNKWYRIDDVNISELKNDH 894

Query: 1022 NLSQGVNKVSSKDVYVLFYER 1042
             L    N + ++  Y+L YE+
Sbjct: 895  VLDADDNDMGTRTAYILIYEK 915

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625
            GL N+G TCY+NS+LQ  FA +  R+
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLRE 788

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 598 ITGLRNLGATCYINSMLQCLFAT----NMFRDLFEPSNYERFFNPELEDTGKLSKSFSVL 653
           + GL N G TC++NS+LQ L ++    +   D+ E S   +       +    S +F  L
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAHFLDDIIEESEPNK-------NELNFSVAFKTL 117

Query: 654 IRKMYMNGGCS---VVPTSFLKICNFLRPDFNI--PDDQQDAQEFLMLTIDRLHDELSNQ 708
           + K+    G +     P + LK      P+ NI    DQ+DAQEF    I +L  +L  +
Sbjct: 118 LDKLNAKYGRNRKYYRPNALLKTMES-GPNKNILLGYDQEDAQEFFQQIISQLEKDLKKE 176

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDL 626
            GL N+G TCY+NS+LQ  F+    RD 
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDF 789

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 77/195 (39%), Gaps = 29/195 (14%)

Query: 594 VALSITGLRNLGATCYINSMLQCLFATNMFRD-----------LFEPSNY---ERFFNPE 639
           VA    G+ N+G TCY+NS+LQ  F     RD           L + S Y    R    E
Sbjct: 693 VATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGGRE 752

Query: 640 LEDTGKL-SKSFSVLIRKMY-----MNGGCSVVPTSFLKICNFLRPDFNIP--DDQQDAQ 691
           +    +L S  F   +R ++      N  C V PT  L    F   +  +   DD    +
Sbjct: 753 VSKQEELRSVQFVYHLRDLFNDMIHTNSRC-VTPTKELVYLAFAPSNVEVEFGDDTVAQK 811

Query: 692 EFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFS-PID 750
           E + LT D + D       + +   ++++     S V   E+K   E      ++S  + 
Sbjct: 812 ELIDLTTDVVEDPTDTTRHLASCDDDIIMC---QSPVALPEHKTSSEAG--TQQYSVQVA 866

Query: 751 KIFQGQLENGLHCKK 765
           KI   QLEN L   +
Sbjct: 867 KISADQLENTLEIGR 881

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 599 TGLRNLGATCYINSMLQCLFATN-MFRDLFEPSNYERFFNPELEDTGKLSK 648
           TG+ N+G TCY+NS+LQ  F+   + R + E       FN  L ++G + +
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSNSGHIRR 786

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 51/118 (43%), Gaps = 22/118 (18%)

Query: 599 TGLRNLGATCYINSMLQCLF-----------ATNMFRDLFEPSNYERFFNPELEDTGKLS 647
            GL NLG +CY+NS+LQ LF             +  RD+  PS   +    +L +  K +
Sbjct: 313 CGLNNLGNSCYMNSVLQVLFNGAVPDWSLEVLGDFPRDVVYPSTNLKCQLIKLRNAIKRN 372

Query: 648 KSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDEL 705
            S        Y  G   + P++F +       +F+    QQDA EF    ID L  +L
Sbjct: 373 PS-------DYTTG---IKPSTFKRCIGESHEEFS-SGRQQDAMEFFTYFIDELDKKL 419

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 6/47 (12%)

Query: 969  KYRLYAVVNHNGNLI-SGHYTSLVNKNRDHDLENNRQQWYYFDDEVV 1014
            +Y L AV+ H GN + SGHY + + KN D  +     +W  ++DE +
Sbjct: 701  QYTLRAVICHKGNSVQSGHYVAFIKKNVDGQV-----KWALYNDEKI 742

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
            Anc_8.202 YER151C
          Length = 829

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 60/138 (43%), Gaps = 31/138 (22%)

Query: 929  LPPVLVIHLSRFYY--------DLTKKN------ETV---ITYP---LILNIVLKNNETL 968
            LP VL+I L RF +        D+T  N      E +   I Y    +I +  + +N T+
Sbjct: 698  LPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELIIPSESVSSNATM 757

Query: 969  ---KYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLS 1024
               +Y L  V+ H+G +   GHYT+ V       L +  ++WY  DD  +        L 
Sbjct: 758  SNREYSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRIDDVNINELEEDDVLK 810

Query: 1025 QGVNKVSSKDVYVLFYER 1042
             G     S+  Y+L Y++
Sbjct: 811  GGEEDNDSRTAYILMYQK 828

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 11/129 (8%)

Query: 599 TGLRNLGATCYINSMLQCLFATNM--FRDLFEPSNYERFFNPELEDTGKLSKSFSVLIRK 656
            GL NLG +CY+NS+LQ LFA ++  + D+   +  + F    +  +  +      L+  
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSNNVKCQLIKLLNA 378

Query: 657 MYMNGGC---SVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL-----HDELSNQ 708
           M +N       + P SF         +F   + QQDA EFL   ++ L       EL+N 
Sbjct: 379 MKINPSRYPEGIKPRSFKNCIGQNNKEF-TSNKQQDALEFLSYFVNELDKKLFKKELTNP 437

Query: 709 TEVLNAHPE 717
            +++  + E
Sbjct: 438 GDLMRCYME 446

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFR 624
           TGL N+G TCY+NS+LQ  F  +  R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFR 624
           TGL N+G TCY+NS+LQ  F  +  R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 598 ITGLRNLGATCYINSMLQCLF 618
           + GL N G TCY NS+LQCL+
Sbjct: 98  VFGLENYGNTCYCNSVLQCLY 118

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 35.4 bits (80), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILN----IVLKNN----ETLKY 970
           ++ T  V  P +L+IHLSR  ++     +N   + +   L     I+ KN       +KY
Sbjct: 444 VKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVNNVKY 503

Query: 971 RLYAVVNHNGNLISGHY 987
           RL A V H G   +GHY
Sbjct: 504 RLRATVRHQGTHSAGHY 520

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 599 TGLRNLGATCYINSMLQCLFATN-MFRDLFEPSNYERFFNPELEDTGKLSK 648
           TG+ N+G TCY+NS+LQ  F+   + R + E       FN  L ++G + +
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSGHVRR 786

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFN 637
           TG+ N+G TCY+NS+LQ  F+    R      NY++  N
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYI--LNYQKTLN 772

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYD---LTKKNETV-------ITYPLILNIVLKNNETLKY 970
           I+    +  P  L++HLSR  ++   +T+    V       +   +++N   +  E +KY
Sbjct: 328 IKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKY 387

Query: 971 RLYAVVNHNGNLISGHY 987
            L +VV H G+ + GHY
Sbjct: 388 ELKSVVKHTGSHVQGHY 404

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 50/114 (43%), Gaps = 22/114 (19%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMF-----------RDLFEPSNYERFFNPELEDTGKLS 647
            GL NLG +CY+NS++Q LF   +            RD+  PS   +    +L +  K+ 
Sbjct: 318 CGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRDVVFPSTNLKCQLIKLRNALKIH 377

Query: 648 KSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701
                   + Y +G   V P S  K       +F+    QQDA EFL   ID+L
Sbjct: 378 P-------EKYQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKL 420

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 969  KYRLYAVVNHNG-NLISGHYTSLV-NKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQG 1026
            KY+L  V+ H+G +   GHYT+ V NK  D        +WY  DD  +        L  G
Sbjct: 786  KYQLTGVIYHHGLSSDGGHYTADVFNKTAD--------KWYRIDDINITELKKDDVLKGG 837

Query: 1027 VNKVSSKDVYVLFYERI 1043
             +   ++  Y+L Y+++
Sbjct: 838  EDGTDTRTAYILMYQKL 854

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 58/144 (40%), Gaps = 37/144 (25%)

Query: 929  LPPVLVIHLSRFYY--DLTKKN-----------------------ETVITYPLILNIVLK 963
            LP VL+I   RF +  ++ K N                       E +I    + +I LK
Sbjct: 772  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 831

Query: 964  NNETLK----YRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            N+ +      Y+L  V+ H+G     GHYT+ V     +  E+N+  WY  DD  +    
Sbjct: 832  NHTSGADDRIYKLTGVIYHHGVGSDGGHYTADV-----YHSEHNK--WYRIDDVNITELE 884

Query: 1019 SHGNLSQGVNKVSSKDVYVLFYER 1042
                L  G     S+  Y+L Y++
Sbjct: 885  DDDVLKGGEEASDSRTAYILMYQK 908

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625
           TG+ N+G TCY+NS+LQ  F  +  R+
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLRE 703

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFR 624
           TGL N+G TCY+NS+LQ  F+    R
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
            YER151C (REAL)
          Length = 905

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 59/144 (40%), Gaps = 37/144 (25%)

Query: 929  LPPVLVIHLSRFYY--DLTKKN-----------------------ETVITYPLILNIVLK 963
            LP VL+I   RF +  ++ K N                       E +I    + +I LK
Sbjct: 767  LPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 826

Query: 964  NNET----LKYRLYAVVNHNG-NLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHET 1018
            N+ T      Y+L  V+ H+G +   GHYT+ V     +  E+N+  WY  DD  +    
Sbjct: 827  NHATGIADRNYKLTGVIYHHGISSDGGHYTADV-----YHSEHNK--WYRIDDVNIIELE 879

Query: 1019 SHGNLSQGVNKVSSKDVYVLFYER 1042
                L  G     S+  Y+L Y++
Sbjct: 880  DDDVLKGGEEASDSRTAYILMYQK 903

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 81/408 (19%), Positives = 139/408 (34%), Gaps = 95/408 (23%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPS-NYERFFNPELEDTGK-----LSKSFSV 652
           TGL N G  C+INS LQ L  +  F           +F N   +  G      L +  + 
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNENPKQEGNRYALPLHQVMAE 128

Query: 653 LIRKMYMNGGCSVVPTSFLKICNFLRPDFN--IPDDQQDAQEFLMLTIDRLHDELSNQTE 710
            I  +      + V +S  KI   +   F   +   Q DAQEF  L ++ LH+E      
Sbjct: 129 FIYDLQAPTFLNTVESSD-KIIVTMESIFKQKMSRRQNDAQEFTQLLLEVLHNEYQELIR 187

Query: 711 VLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGXXX 770
           ++N                       F  + ++    P    F+G+  + L C KCG   
Sbjct: 188 LMN-----------------------FITNNLDIPTYP----FEGKYCHELTCLKCGRNS 220

Query: 771 XXXX-TFYILSLAIPKPXXXXXXXXKGNWVNLEDCINMFTSDEVMSRENAWDCPKCGVTV 829
                 F IL+L +P              ++L++ I+   SD +      + C  C V+ 
Sbjct: 221 EVKMFDFDILTLNLPAQPS----------ISLDELISGSNSDVI----EGFSCTVCKVSA 266

Query: 830 QKEKSESNQRHNKQXXXXXXXXXPEPRKAKKKDEEGSSLKSKTKFLLFPRKRXXXXXXXX 889
               + ++  + +          PE +   + DE  +S                      
Sbjct: 267 ILGGTGTHNPNTRSLIKSLKEIFPELKINTELDEPLNSF--------------------- 305

Query: 890 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRATNFVTLPPVLVIHLSRFYYDLTK--K 947
                                          ++ T FV +P +L+IHL+R  ++     +
Sbjct: 306 -------------VDSYSHDGVITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTR 352

Query: 948 NETVITY--------PLILNIVLKNNETLKYRLYAVVNHNGNLISGHY 987
           N   I Y         L+++ V      ++Y L + + H+G+   GHY
Sbjct: 353 NACKIAYDEKLLLEHQLVMDGVSVMRNNIQYTLSSAIKHSGSHSMGHY 400

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRD 625
           GL+N+G TCY+N+ LQ L+     R+
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLRE 130

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRD 625
           GL N+G TCY+NS+LQ  FA    R+
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRN 751

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 599 TGLRNLGATCYINSMLQCLFATN-MFRDLFEPSNYERFFNPELEDTGKLSK 648
           TG+ N+G TCY+NS+LQ  F+   + R + +       FN  L ++G + +
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRR 785

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 6/57 (10%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKLSKSFSVLIR 655
            G+ N+G TCY+NS+LQ  F+    R      NY   ++  +ED   L  + S + R
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLR------NYVLQYSKTIEDFKTLENNASTVRR 763

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625
            GL N+G TCY+NS+LQ  F  +  R+
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNI---VLKNNET-----LKY 970
           ++ T     P +L++HLSR  ++ T   +N   + +   L+     ++NN       +KY
Sbjct: 436 VKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKY 495

Query: 971 RLYAVVNHNGNLISGHY 987
           +L ++V H G    GHY
Sbjct: 496 KLKSMVKHQGTHSQGHY 512

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 5/39 (12%)

Query: 600 GLRNLGATCYINSMLQCLFATNMFRDLF-----EPSNYE 633
           GL N+G TCY+NS+LQ  F+    R+         SNYE
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSISNYE 749

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYDLTK--KNETVITYPLILNIV---LKNNET-----LKY 970
           ++ T     P +L++HLSR  ++     +N   +T+   L+     ++NN       +KY
Sbjct: 438 VKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVKPIKY 497

Query: 971 RLYAVVNHNGNLISGHY 987
           +L A+V H G    GHY
Sbjct: 498 KLKAMVKHEGTHSQGHY 514

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 19/115 (16%)

Query: 598 ITGLRNLGATCYINSMLQCLFATN---MFRDLFEPSNYERFFNPELEDTGKLSKSFSVLI 654
           I GL N G TC++NS+LQ L ++     F D    +  E   N +++ T  L +   +L 
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIENGSEN--NGDIKFTETLRELLLILN 114

Query: 655 RKMYMNGGCSVVPTSFLKICNFLRPDFNIPD-------DQQDAQEFLMLTIDRLH 702
           +K Y           + K    L+   N P+       DQ+DAQEF    +  L 
Sbjct: 115 KKYYKE-------KPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLE 162

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 921 IRATNFVTLPPVLVIHLSRFYYD--LTKKNETVITYPLILNIVLKN----NETLK----- 969
           I+  + +  P +L+IHLSR  Y+  +  +N   + +   ++I  +     NE LK     
Sbjct: 335 IKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVD 394

Query: 970 YRLYAVVNHNGNLISGHY 987
           Y+L +++ H G   SGHY
Sbjct: 395 YQLQSIIKHTGTHNSGHY 412

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,765,452
Number of extensions: 5459221
Number of successful extensions: 22417
Number of sequences better than 10.0: 316
Number of HSP's gapped: 22618
Number of HSP's successfully gapped: 542
Length of query: 1044
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 924
Effective length of database: 39,721,479
Effective search space: 36702646596
Effective search space used: 36702646596
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)