Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16522g5.711ON64364333680.0
TDEL0B020905.711ON64364924730.0
SAKL0E15114g5.711ON64965424010.0
KLLA0A00418g5.711ON64264723960.0
KLTH0E00836g5.711ON64164323280.0
CAGL0H06699g5.711ON65065423230.0
TPHA0E001505.711ON64661723140.0
Kpol_1043.775.711ON65766423120.0
Kwal_55.196495.711ON64164823070.0
KAFR0D021705.711ON66066323030.0
NCAS0G001805.711ON65465522190.0
Ecym_40105.711ON64465422070.0
TBLA0E017505.711ON66566321630.0
AFR295W5.711ON63161021290.0
NDAI0F002105.711ON65365921210.0
YIL155C (GUT2)5.711ON64961220230.0
Skud_9.135.711ON64961019950.0
Smik_9.145.711ON65259619900.0
KNAG0L021905.711ON64559319400.0
Suva_9.325.711ON53854218890.0
Smik_16.4487.541ON153694860.10
Skud_16.4887.541ON153394830.23
YPR184W (GDB1)7.541ON153694771.2
TDEL0C030307.439ON724174742.5
Suva_16.5167.541ON153694743.1
KNAG0B030805.634ON89383707.0
NCAS0A09880singletonON872175709.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16522g
         (643 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...  1301   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   957   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   929   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   927   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   901   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   899   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   895   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   895   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   893   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   891   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   859   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   854   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   837   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   824   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   821   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   783   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   773   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   771   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   751   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   732   0.0  
Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR18...    38   0.10 
Skud_16.488 Chr16 (844445..849046) [4602 bp, 1533 aa] {ON} YPR18...    37   0.23 
YPR184W Chr16 (902044..906654) [4611 bp, 1536 aa] {ON}  GDB1Glyc...    34   1.2  
TDEL0C03030 Chr3 (540079..542253) [2175 bp, 724 aa] {ON} Anc_7.4...    33   2.5  
Suva_16.516 Chr16 (884486..889096) [4611 bp, 1536 aa] {ON} YPR18...    33   3.1  
KNAG0B03080 Chr2 (593481..596162) [2682 bp, 893 aa] {ON} Anc_5.6...    32   7.0  
NCAS0A09880 Chr1 complement(1975537..1978155) [2619 bp, 872 aa] ...    32   9.1  

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score = 1301 bits (3368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/643 (97%), Positives = 626/643 (97%)

Query: 1   MFARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLPSRE 60
           MFARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLPSRE
Sbjct: 1   MFARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLPSRE 60

Query: 61  DLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMAHGG 120
           DLLSNLQKTDKFDV                 TRGLNVACVEANDFASGTSSKSTKMAHGG
Sbjct: 61  DLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKSTKMAHGG 120

Query: 121 VRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCK 180
           VRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCK
Sbjct: 121 VRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCK 180

Query: 181 LYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIE 240
           LYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIE
Sbjct: 181 LYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIE 240

Query: 241 HGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDK 300
           HGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDK
Sbjct: 241 HGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDK 300

Query: 301 NKNGLPDPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGR 360
           NKNGLPDPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGR
Sbjct: 301 NKNGLPDPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGR 360

Query: 361 VMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLSAWAG 420
           VMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLSAWAG
Sbjct: 361 VMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLSAWAG 420

Query: 421 IRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEVVKEG 480
           IRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEVVKEG
Sbjct: 421 IRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEVVKEG 480

Query: 481 GFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICELFKED 540
           GFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICELFKED
Sbjct: 481 GFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICELFKED 540

Query: 541 ERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFL 600
           ERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFL
Sbjct: 541 ERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFL 600

Query: 601 DAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           DAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV
Sbjct: 601 DAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/649 (71%), Positives = 545/649 (83%), Gaps = 12/649 (1%)

Query: 1   MFARGGK-LFPKALALTGTVG----GALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVN 55
           MFAR G+ L+P+A+ALT        GA+  +  ++ RR    ++N+V + S +D  P+V 
Sbjct: 1   MFARAGRSLWPRAVALTAAATVAGMGAVKYNDSVEQRR----IANDVALQSAVD-TPNVK 55

Query: 56  LPSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTK 115
           LPSREDLLS L KTD+FDV                 TRGLNVA VE +DFASGTSSKSTK
Sbjct: 56  LPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKSTK 115

Query: 116 MAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYF 175
           MAHGGVRYLEKAVF+LS+AQLDLVIEALNERGHML TAPHLCKILPIMIPVY+YWQ+PYF
Sbjct: 116 MAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYF 175

Query: 176 FAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLA 235
           + GCK+YD FAG QNL++SYLL+K  A+++APMLD + LKAGLVYHDGSFNDSRMN+ LA
Sbjct: 176 YVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALA 235

Query: 236 ISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLI 295
           ++AIE+GATVLNY++V QL+KD  T KV+GA+V ++ETG+Q+ VKAKVTVNATGPYSD +
Sbjct: 236 VTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKL 295

Query: 296 LQMDKNKNGLPDPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVK 355
           LQMD+NK+G PDP  P P N +I+T+VAV  P MVVPSAGVHIILPS+YCP+ +GLLDVK
Sbjct: 296 LQMDENKDGKPDPTKPLP-NATISTKVAVENPKMVVPSAGVHIILPSFYCPREMGLLDVK 354

Query: 356 TADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVL 415
           T+DGRVMFFLPWQGKVLAGTTDIPMK VPQ PTA E+DIQDIL+ELQHYIKFPV+REDVL
Sbjct: 355 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKREDVL 414

Query: 416 SAWAGIRPLVMDPRKRK-DTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTID 474
           SAWAGIRPLV+DPRK + +TGGST+GLVR+HL FT++ G++T+AGGKWTTYREMAE+TI+
Sbjct: 415 SAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMAEETIN 474

Query: 475 EVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIIC 534
           EVVK G F+VKPCITRK+KL+G ENW PNL+ALLAQ Y LS AMS HLS NYGTRAP+IC
Sbjct: 475 EVVKVGKFNVKPCITRKLKLSGAENWNPNLAALLAQKYHLSGAMSNHLSENYGTRAPLIC 534

Query: 535 ELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRR 594
           E+F+EDERNQLPV FGGRENVTV  +VNFDSFRYPFTIGE  YS+ +EY+R A DFLMRR
Sbjct: 535 EMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGELNYSVDYEYTRTALDFLMRR 594

Query: 595 TRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           TR+AFLDA  AL AVEGTV VMGD+LNWDS RR+ EIE+  EFI+TFGV
Sbjct: 595 TRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/654 (67%), Positives = 536/654 (81%), Gaps = 16/654 (2%)

Query: 1   MFARGGK--LFPKALALTGTVGGALAV-HQYMDSRRQSSALSNEVPVVSPIDPRPSVNLP 57
           MFA   +  + P A A   TVGGA  + HQ    ++Q S ++N+V V +P+  +  +NLP
Sbjct: 1   MFANATRRMVVPAAFA-AATVGGATILWHQ---QQQQKSVINNDVTVTNPVQ-KSKINLP 55

Query: 58  SREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMA 117
           +R+DLLS L KT++FDV                 TRGLNVA VE NDFASGTSSKSTKMA
Sbjct: 56  TRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTKMA 115

Query: 118 HGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFA 177
           HGGVRYLEKA +ELS+AQLDLV+EALNER HML TAPHLCKILPIMIPVY+YWQ PYF+ 
Sbjct: 116 HGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYV 175

Query: 178 GCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAIS 237
           GCK+YD FAG QNL+SSY+L+ + A+E+APMLD SKLKAGLVYHDGSFNDSRMN+TLA++
Sbjct: 176 GCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVT 235

Query: 238 AIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQ 297
           A+E GATVLNY++V QL+K+  T KVEGA+ +D+ETG+ +++KAKV VNATGP+SD ILQ
Sbjct: 236 AVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQ 295

Query: 298 MDKNKNGLPDPQPPQPANV--SIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVK 355
           MD++  GLPD +  Q +N+  +I+++VAV  P MVVPSAGVHI+LPS+YCPK +GLLD K
Sbjct: 296 MDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAK 355

Query: 356 TADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVL 415
           T+DGRVMFFLPWQGKVLAGTTDIPMK +P+NPTATEADIQDIL+ELQHYIKFPV+REDVL
Sbjct: 356 TSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDVL 415

Query: 416 SAWAGIRPLVMDPRKR------KDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMA 469
           SAWAGIRPLV DPRKR      +    ST+ LVR+H +FTS+  L+T+AGGKWTTYREM+
Sbjct: 416 SAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMS 475

Query: 470 EQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTR 529
           E+TI+EVVK G F+ KPCITRK+KLAG EN+ PNL A+LAQ Y LS  M+++L+NNYGTR
Sbjct: 476 EETINEVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTR 535

Query: 530 APIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATD 589
           AP+ICELFK+D++N+LP+AFGG+ENVTV  +V+FDSFRYPFTIGE  YSI +EY+R A D
Sbjct: 536 APLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALD 595

Query: 590 FLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           FLMRRTRYAFLDA  ALTAV+GTVKVMGDEL+WDS RRQ E E+ TEFIKTFGV
Sbjct: 596 FLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/647 (68%), Positives = 523/647 (80%), Gaps = 9/647 (1%)

Query: 1   MFA--RGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLPS 58
           MFA  R  K+   +      V GA+++   ++  R ++ L N+V V S I  + +V+LPS
Sbjct: 1   MFAAKRASKVLLGSAVSAAAVFGAVSM---VNQSRDTNTLQNDVSV-STIK-KSNVDLPS 55

Query: 59  REDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMAH 118
           R +LLS L KTDKFDV                 TRGLNVA VE NDFASGTSSKSTKMAH
Sbjct: 56  RANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKMAH 115

Query: 119 GGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAG 178
           GGVRYLEKA +ELS+AQLDLVIEALNER HML TAPHLCKILPIMIPVY+YWQVPYF+ G
Sbjct: 116 GGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFYVG 175

Query: 179 CKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISA 238
            K+YD FAG QNL+SSYLLS + ASE+APMLD SKLKAGLVYHDGSFNDSRMNS+LAI+A
Sbjct: 176 TKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAITA 235

Query: 239 IEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQM 298
           IE GATVLNYV++ QL+K+  T KVEGAI  D+ETG +YQ+KAKV VNATGPYSD +LQM
Sbjct: 236 IEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLLQM 295

Query: 299 DKNKNGLPDPQPPQP--ANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKT 356
           D++  GLPD    Q    N +++T++AV  P MVVPSAGVHI+LPS+YCPK +GLLD +T
Sbjct: 296 DQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDAQT 355

Query: 357 ADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLS 416
           +DGRVMFFLPWQGKVLAGTTDIPMK +P+NPTATEADIQDIL+ELQHYI FPV+REDVLS
Sbjct: 356 SDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDVLS 415

Query: 417 AWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEV 476
           AWAGIRPLV DPRK     GST+ LVR+H +FTS + L+T++GGKWTTYREMAE+TIDEV
Sbjct: 416 AWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETIDEV 475

Query: 477 VKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICEL 536
           VK G F+ KPC+T+K+KL GGENW PNLSALL+Q Y LS AMS+HL+NNYGTRAP+ICEL
Sbjct: 476 VKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLICEL 535

Query: 537 FKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTR 596
           F ED RN+LPVA  G+ENV+V  HV++DSFRYP+TIGE  YS+++EY+R   DFLMRRTR
Sbjct: 536 FNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMRRTR 595

Query: 597 YAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           YAFLDA  AL AVEGTVKVMGDEL WDS +RQ EI++ TE+IKTFGV
Sbjct: 596 YAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/643 (67%), Positives = 508/643 (79%), Gaps = 9/643 (1%)

Query: 8   LFPKALALTGTVGGALAVHQY--MDSRRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSN 65
           +F + ++     G  LA   Y     +R  SA  NEV V  P+       +PSR +LL  
Sbjct: 1   MFARTVSRRVLAGATLAAGGYAAFALQRDRSA-HNEVHVSIPLKAEAPA-IPSRSELLDK 58

Query: 66  LQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMAHGGVRYLE 125
           + KTD+FDV                 TRGLNVA VE NDFASGTSSKSTKMAHGGVRYLE
Sbjct: 59  MAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLE 118

Query: 126 KAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWF 185
           KA +ELS+AQLDLVIEALNERGHML TAPHLCK+LPIMIPVY+YWQVPYF+ GCK+YD F
Sbjct: 119 KAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLF 178

Query: 186 AGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATV 245
           AG QNL+SSY+++   ASE+APMLD S LKAGLVYHDGSFNDSRMN+ LA++AIE GATV
Sbjct: 179 AGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATV 238

Query: 246 LNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGL 305
           LNY++VT+LLK+  T +VEGA+  D+ETGK++++ AKV VN+TGP+SD ILQMD  K+GL
Sbjct: 239 LNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGL 298

Query: 306 PDPQPPQPANV---SIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGRVM 362
           P     Q AN    SI + VAV+ P MVVPSAGVHI+LP++YCPK +GLLD KT+DGRVM
Sbjct: 299 PRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVM 358

Query: 363 FFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLSAWAGIR 422
           FFLPWQGKVLAGTTDIPMK VP+NPTATEADIQDIL+ELQHYIKFPV+REDVLSAWAGIR
Sbjct: 359 FFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIR 418

Query: 423 PLVMDPR--KRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEVVKEG 480
           PLV DPR  K  D   ST+GLVRNH +FTS+ GL+T+AGGKWTTYREMAE+TIDEVVK+G
Sbjct: 419 PLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQG 478

Query: 481 GFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICELFKED 540
            F  KPCIT+KIKLAG E W PN  A+LAQ Y LS  M++HL+NNYGTR+PIICE+F+ D
Sbjct: 479 HFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRD 538

Query: 541 ERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFL 600
           E+NQLPV FGGRENVTV  +VNFDSFRYPFTI E  YS+++EY+R A DFLMRRTR+ FL
Sbjct: 539 EKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFL 598

Query: 601 DAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           DA  AL AV+GTV +MGDEL WD  +R  EI++ ++FIKTFGV
Sbjct: 599 DAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/654 (66%), Positives = 514/654 (78%), Gaps = 15/654 (2%)

Query: 1   MFAR---GGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLP 57
           MFAR     +   + LA T   G  LAV  + ++  +   +SN+V ++SP++ +P V LP
Sbjct: 1   MFARVAASTRAHSRLLAGTVAAGATLAVANHYNNNNK--LISNDVSLISPVE-KPDVKLP 57

Query: 58  SREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMA 117
           +R++LL  L +T++FDV                 TRGLNVA VE NDFASGTSSKSTKMA
Sbjct: 58  TRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKNDFASGTSSKSTKMA 117

Query: 118 HGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFA 177
           HGGVRYLEKA +E+S+AQLDLVIEALNER H+L TAPHLCK+LPI+IPVY+YWQVPYF+A
Sbjct: 118 HGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIIIPVYNYWQVPYFYA 177

Query: 178 GCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAIS 237
           GCK+YD FAG QNL+ SYL+SK    E+APMLD S LKAGLVYHDGSFND+RMN+TLA++
Sbjct: 178 GCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGSFNDTRMNATLAVT 237

Query: 238 AIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQ 297
           AIE+ ATVLNY++V QL+KD    KV GA+VED+ETGK Y V+AKV VNATGPYSD +LQ
Sbjct: 238 AIENSATVLNYMEVKQLVKDKD-GKVAGAVVEDRETGKTYSVRAKVVVNATGPYSDRLLQ 296

Query: 298 MDKNKNGLPDP--QPPQP-----ANV-SIATEVAVNKPNMVVPSAGVHIILPSYYCPKTV 349
           MD N +GLPD   Q  +P     A V SI ++VAV KPNMVVPSAGVHIILPS+YCPK +
Sbjct: 297 MDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGVHIILPSFYCPKEM 356

Query: 350 GLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPV 409
           GLLD KT+DGRVMFFLPWQGKVLAGTTDIP+K VP+NPTATEADIQDIL+ELQ YIKFPV
Sbjct: 357 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQDILKELQPYIKFPV 416

Query: 410 RREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMA 469
           +REDVLSAWAGIRPLV DPRK+    GST+GLVR+H IFTS+ GL+T+AGGKWTTYR MA
Sbjct: 417 KREDVLSAWAGIRPLVTDPRKKSKADGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMA 476

Query: 470 EQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTR 529
           E+TIDEVVK G F  KPCITRK+KLAG ENW PNL ALLAQ Y LSQ MS +L+ NYGTR
Sbjct: 477 EETIDEVVKNGKFDAKPCITRKLKLAGAENWDPNLPALLAQKYHLSQKMSHYLAENYGTR 536

Query: 530 APIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATD 589
           AP+ICE+F ED  N+LP+    +E   VL HV+FDSFRYP TI E  Y+I++EY+R A D
Sbjct: 537 APLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYPITIAELKYAIKYEYARTALD 596

Query: 590 FLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           FLMRRTR+AFLDA  AL AVEGTV++MGD L WD  RRQ EI   TEFIKTFGV
Sbjct: 597 FLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEIRYSTEFIKTFGV 650

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/617 (68%), Positives = 505/617 (81%), Gaps = 3/617 (0%)

Query: 27  QYMDSRRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVXXXXXXXXXXXX 86
           Q  ++   +S + NE  + +P+D  P+VN+P+R +L++NL+ TD+FDV            
Sbjct: 33  QSTNNWDNASIIQNEAVLANPVD-SPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGS 91

Query: 87  XXXXXTRGLNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNER 146
                TRGLNVA VE +DFASGTSSKSTKMAHGGVRYLEKAVF+LS+AQLDLVIEALNER
Sbjct: 92  ALDAATRGLNVALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNER 151

Query: 147 GHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELA 206
            H+L TAPHLCKILPIMIPVY YWQVPYF+AG K+YD FAG QNL+SSYL+SK  A E+A
Sbjct: 152 AHLLYTAPHLCKILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIA 211

Query: 207 PMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGA 266
           PMLDESKLKAGLVYHDG+FNDSRMNSTLAI+AIE+GATVLNY++V QLLKD S++++ GA
Sbjct: 212 PMLDESKLKAGLVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGA 271

Query: 267 IVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANVSIATEVAVNK 326
           IVED ETG++ Q+ AKV VNATGPYSD ILQMD NKNG PD +  Q A  SIAT+VAV  
Sbjct: 272 IVEDIETGEKIQINAKVIVNATGPYSDKILQMDNNKNGKPD-EFTQSAETSIATKVAVQN 330

Query: 327 PNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQN 386
           P+MVVPSAGVHIILPS+YCP+ +GLLD  T+DGRVMFFLPWQGKVLAGTTDIPMKTVP+N
Sbjct: 331 PHMVVPSAGVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPEN 390

Query: 387 PTATEADIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHL 446
           PTATEADIQDIL+ELQHYIKFPV+REDVLSAWAGIRPLV DPRK    G + E LVR+H 
Sbjct: 391 PTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEGATQE-LVRSHF 449

Query: 447 IFTSETGLITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSA 506
           IFTS+ GL+T+AGGKWTTYREMAE+TID VVK G F+VKPC TRK+KLAGGEN+ PNL+A
Sbjct: 450 IFTSDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAA 509

Query: 507 LLAQHYKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSF 566
           LLAQ Y L   +S+HL+NNYGTR+P+IC++F  D+ N+LP+   G+E   V   V+FDSF
Sbjct: 510 LLAQKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSF 569

Query: 567 RYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSAR 626
           RYP++I E  Y + HEY+R   DFLMRR+R+AFLDA  AL +VEGTVK+MGDELNWD  R
Sbjct: 570 RYPYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEER 629

Query: 627 RQREIEECTEFIKTFGV 643
           R++E +   E+IKTFGV
Sbjct: 630 RKQETDYSIEYIKTFGV 646

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/664 (67%), Positives = 518/664 (78%), Gaps = 28/664 (4%)

Query: 1   MFARG--------GKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRP 52
           MFA+G         KL   ALA    VG  L     + +   ++A+ N+    SP+D   
Sbjct: 1   MFAKGTLSKLTTSKKLLYSALA----VGTGLTASTLLTNNSSNNAVYNDPSKPSPVDTT- 55

Query: 53  SVNLPSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSK 112
            V LPSR DLLS L+KT +FDV                 TRGLNVA VE ND+ASGTSSK
Sbjct: 56  DVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSSK 115

Query: 113 STKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQV 172
           STKMAHGGVRYLEKAVF+LS+AQLDLVIEALNER H+L TAPHLCKILPIMIPVY YWQV
Sbjct: 116 STKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQV 175

Query: 173 PYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNS 232
           PYF+ G K+YD FAG QNL+SSYLLSK+ A E+APMLD SKLKAGLVYHDGSFNDSRMN+
Sbjct: 176 PYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNA 235

Query: 233 TLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYS 292
           TLAISAIE GATVLNY++V QL+KD  T K+ GAIVED ETG+ YQ+KAKV VNATGPYS
Sbjct: 236 TLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYS 295

Query: 293 DLILQMDKNKNGLPDPQPPQ--------PANV----SIATEVAVNKPNMVVPSAGVHIIL 340
           D ILQMD NKNGLPD    +        P NV    SI+ EVAV  PNMVVPSAGVHIIL
Sbjct: 296 DTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIIL 355

Query: 341 PSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRE 400
           PSYYCP  +GLLD  TADGRVMFFLPWQGKVLAGTTDIPMKTVP+NPTATEADIQDIL+E
Sbjct: 356 PSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKE 415

Query: 401 LQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGG 460
           LQHYIKFPV+REDVLSAWAGIRPLV DPR +K  GG+T+ +VR+H IFTS+ GL+T+AGG
Sbjct: 416 LQHYIKFPVKREDVLSAWAGIRPLVQDPRVQK--GGATQEVVRSHFIFTSDNGLVTIAGG 473

Query: 461 KWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQ 520
           KWTTYREMAE+TIDEVVK+G F+ KPCITRK+KLAG ENW  NL+ALL+Q Y +S  M++
Sbjct: 474 KWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMAE 533

Query: 521 HLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLH-HVNFDSFRYPFTIGEFLYSI 579
           HL+NNYGTR+PIICE+ KE + N+LPV   GREN ++ + HV +DSFRYP+TI E  YS+
Sbjct: 534 HLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSM 593

Query: 580 RHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIK 639
            +EY+R A DFLMRRTRYAFLDA  AL AV GTVK+MGD LNWD+ RR+RE    T++IK
Sbjct: 594 DYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIK 653

Query: 640 TFGV 643
           TFGV
Sbjct: 654 TFGV 657

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/648 (65%), Positives = 507/648 (78%), Gaps = 12/648 (1%)

Query: 1   MFARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNLPSRE 60
           MFAR   L  + L       G  A +   + +   S    EV V  P+       LP+R 
Sbjct: 1   MFAR--TLSKRVLTTATLAAGGYAAYMVQNDKIARS----EVRVTRPLKAEAPA-LPTRS 53

Query: 61  DLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMAHGG 120
           +LL  + KT++FDV                 TRGLNVA VE NDFASGTSSKSTKMAHGG
Sbjct: 54  ELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKMAHGG 113

Query: 121 VRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFAGCK 180
           VRYLEKA +ELS+AQLDLVIEALNERGHML TAPHLCK+LPIMIPVY+YWQVPYF+ GCK
Sbjct: 114 VRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCK 173

Query: 181 LYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAISAIE 240
           +YD FAG QNL+SSY++S   ASE+APMLD S LKAGLVYHDGSFNDSRMN+ LA++AIE
Sbjct: 174 MYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIE 233

Query: 241 HGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDK 300
            GATVLNY++VTQL+K+  + ++EGA+V D+ETG+++++KAKV VN+TGP+SD +LQMD 
Sbjct: 234 RGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDA 293

Query: 301 NKNGLPDPQPPQPANV---SIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKTA 357
            K+G P     Q AN    SI + +AV+ P MVVPSAGVHI+LP++YCPK +GLLD KT+
Sbjct: 294 AKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTS 353

Query: 358 DGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLSA 417
           DGRVMFFLPWQGKVLAGTTDIPMK VP+NPTATEADIQDIL+ELQHYIKFPV+R DVLSA
Sbjct: 354 DGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSA 413

Query: 418 WAGIRPLVMDPR--KRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDE 475
           WAGIRPL+ DPR  K  D   ST+GLVRNH ++TS+ GL+T+AGGKWTTYREMAE+TIDE
Sbjct: 414 WAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDE 473

Query: 476 VVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICE 535
           VVK+G F  KPCIT+KIKLAG E W PN  A+LAQ Y LS  M++HL+NNYGTR+PIICE
Sbjct: 474 VVKQGKFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICE 533

Query: 536 LFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRT 595
           +FK DE+NQLPV FGGRENVTV  +VNFDSFRYPFTIGE  YS+++EY+R A DFLMRRT
Sbjct: 534 MFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRT 593

Query: 596 RYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           R+ FLDA  AL AV+GTV VMGDEL W   RRQ E ++ +EFIKTFG+
Sbjct: 594 RFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/663 (65%), Positives = 518/663 (78%), Gaps = 23/663 (3%)

Query: 1   MF-ARGGKLFPKALAL---TGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRPSVNL 56
           MF A+   L PK +     T TVGG   ++     R  + +   +  ++SP+D R SVNL
Sbjct: 1   MFTAKTKNLLPKVVVAGIATVTVGGI--IYAKKGPRIHAPSYQEDGKLISPLDKR-SVNL 57

Query: 57  PSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKM 116
           P+R DL+S L KT++FDV                 TRGLNVA VE  DFASGTSSKSTKM
Sbjct: 58  PTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKM 117

Query: 117 AHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFF 176
           AHGGVRYLEKA +ELS+AQLDLVIEALNER H+L TAPHLCKILPIMIPVY+YWQ+PYF+
Sbjct: 118 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFY 177

Query: 177 AGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAI 236
           AGCK+YD FAG QNL+SSYLLSK  A+++APMLD +KLKAGLVYHDG+FNDSRMNSTLA+
Sbjct: 178 AGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAV 237

Query: 237 SAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLIL 296
           +AIE+G+TVLNY++V QLLK+  + K+EGAIVED ETGKQY +KAKV +NATGPYSD IL
Sbjct: 238 TAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAIL 297

Query: 297 QMDKNKNGLPDP-QPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVK 355
           QMD+N  GLPDP       N  IAT+V+V+ P MVVPSAGVHIILPS+YCPK +GLLD K
Sbjct: 298 QMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357

Query: 356 TADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVL 415
           T+DGRVMFFLPWQGKVLAGTTD+PMK +P+NPTATEADIQDIL+ELQHYI+FPV+REDVL
Sbjct: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417

Query: 416 SAWAGIRPLVMDPRKRKDTG-GSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTID 474
           SAWAGIRPLV DPR     G GST+GLVR+H IFTS+ GL+T+AGGKWTTYR MAE+T+D
Sbjct: 418 SAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETVD 477

Query: 475 EVVKEGGFS-VKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPII 533
           E +K G F+ VKPCITR IKLAGGENW PNL ALLAQ Y LS  +SQHL++NYGTRAPII
Sbjct: 478 EAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLADNYGTRAPII 537

Query: 534 CELFKEDERNQLPVAFGGR--------ENVTVLHHVN-----FDSFRYPFTIGEFLYSIR 580
           CE++ +D +N+LP+A            EN   L + N     F+ FRYPFT+GE  YS+ 
Sbjct: 538 CEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYSVN 597

Query: 581 HEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKT 640
           +EY+  A DFLMRR+R+AFLDA  A+ AVEGTVK+MGDELNWD +RR +EIE   ++IKT
Sbjct: 598 YEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYIKT 657

Query: 641 FGV 643
           FGV
Sbjct: 658 FGV 660

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/655 (64%), Positives = 498/655 (76%), Gaps = 13/655 (1%)

Query: 1   MFARGGK-LFPKALALTGTVGGALAVHQYMDSRRQS--SALSNEVP-VVSPIDPRPSVNL 56
           MF+RG K +  K LA+   V     V+    S++ S  +  S   P +VSP+D    V+L
Sbjct: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTL-QVSL 59

Query: 57  PSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKM 116
           P+R  LL  L++  +FDV                 TRGL VA VE NDFASGTSSKSTKM
Sbjct: 60  PTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKM 119

Query: 117 AHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFF 176
           AHGGVRYLEKA F+LS++QLDLVIEALNER H+L TAPHLCKILPI+IPVY+YWQVPYF+
Sbjct: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179

Query: 177 AGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAI 236
           AGCKLYD FAG QNL++SYLLS++ A ELAPML+ + LKA LVYHDGSFNDSR+N+TLAI
Sbjct: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239

Query: 237 SAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLIL 296
           +AIE GATVLNYV+V +LLKDS T  + G  V D ETG    V +KV VNATGP+SD IL
Sbjct: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299

Query: 297 QMDKNKNGLPDPQPPQPANVS---IATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLD 353
           QMDKN  GLPD     P  ++   I++++AV  PNMVVPS+GVHIILPSYYCPK +GLLD
Sbjct: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359

Query: 354 VKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRRED 413
           V+T+DGRVMFFLPWQGKV+AGTTDIPM  VP+ P A EADIQDIL+ELQHYIKFPV+RED
Sbjct: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419

Query: 414 VLSAWAGIRPLVMDPR----KRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMA 469
           VLSAWAGIRPLV DPR      K   GST+GLVR+H IFTS+ GL+T+AGGKWTTYREMA
Sbjct: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479

Query: 470 EQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGT 528
           E+TIDEVVK G F   KPCITR++KLAG E W PN+SALL+Q Y L   M+ +LS+NYGT
Sbjct: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539

Query: 529 RAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKAT 588
           R+PIICELF  DE N+LPV   G E   +L + +F++FRYP TIGE  YS+R+EY+R A 
Sbjct: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTAL 599

Query: 589 DFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           DFLMRRTR+AFLDA  AL AV GTVK+MGDE NW S RRQ E E+  +FIK+FGV
Sbjct: 600 DFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/654 (64%), Positives = 504/654 (77%), Gaps = 21/654 (3%)

Query: 1   MFAR--GGKLFPKALALTGTVGGALAVHQYMDSRRQSSA---LSNEVPVVSPID---PRP 52
           MF R    K+ P A A     G ++   Q++  +   S    ++NE+P    ++   P P
Sbjct: 1   MFFRYTSRKVIPWAAAAATVTGASVVSWQFVSQQHAISNTGFVANELPAELKLEKHAPAP 60

Query: 53  SVNLPSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSK 112
               PSR  LL  LQKTD+FDV                 TRGLNVA +E ND+ASGTSSK
Sbjct: 61  ----PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSK 116

Query: 113 STKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQV 172
           STKMAHGGVRYLEKA +ELS+AQLDLVIEALNER HML TAPHLCKILPIMIPVY +WQV
Sbjct: 117 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQV 176

Query: 173 PYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNS 232
           PYF+ G K+YD+FAGKQNL+SSYLLS T AS++APMLD SKLKAGLVYHDGSFNDSRMNS
Sbjct: 177 PYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNS 236

Query: 233 TLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYS 292
           TLA++AIE+GAT+LNY++V QLLK+  T KVEGAI  D+ETGKQY VKAKV V+ATGP+S
Sbjct: 237 TLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFS 296

Query: 293 DLILQMDKNKNGLPDPQPPQPAN--VSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVG 350
           D ILQM+ +  GLPD      AN   +I T+VAV  P MVVPS+GVHIILPS+YCPK +G
Sbjct: 297 DRILQMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMG 356

Query: 351 LLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVR 410
           LLD +T+DGRVMFFLPWQGKVLAGTTDIPMK VP+NPTATEADIQDIL+ELQHYIKFPV+
Sbjct: 357 LLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVK 416

Query: 411 REDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAE 470
           REDV SAWAGIRPLV DPRK       T+ LVR+H +FTS++GL+T++GGKWTTYREMA+
Sbjct: 417 REDVQSAWAGIRPLVKDPRK---DNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQ 473

Query: 471 QTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTR 529
           +TIDEVVK G F + KPCITRKIKL G ENW PNL A+L+Q Y L   +S++LS NYGT+
Sbjct: 474 ETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTK 533

Query: 530 APIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATD 589
           A  ICE+F+ D+RNQLPV+    +      +V++D+FRYPFT+GE  Y+IR+EY+RK  D
Sbjct: 534 AAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFTVGELKYNIRNEYARKPLD 590

Query: 590 FLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           FLMRRTRYAFLDA  A+ AV GTVK+MGDEL WDSA+R+ E +   EFIKTFGV
Sbjct: 591 FLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/663 (60%), Positives = 496/663 (74%), Gaps = 23/663 (3%)

Query: 2   FARGGKLFPKALALTGTVGGALAVHQYMDSRRQSSALSNEVPVVSPIDPRP--------S 53
            +R  +     LA+     G+L  + +    + S   S+  P+ + ++           S
Sbjct: 5   LSRVSRPLKTTLAILTVASGSLLTYNHFYLNQSSLLYSDTKPLKTSLNSEEDLQKIANGS 64

Query: 54  VNLPSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKS 113
              PSR +LLSNL+KT KFDV                 TRGLNVA +E NDFAS TSSKS
Sbjct: 65  YKPPSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKS 124

Query: 114 TKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVP 173
           TKMAHGGVRYLEKAVF+LS+AQLDLVIEALNER HML+TAPHLCKILPIMIPVY+YW+VP
Sbjct: 125 TKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVP 184

Query: 174 YFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNST 233
           YF+AGCK+YD+FAG QNL+S+YLLSKT A ++APMLD  KLKA LVYHDGSFND+RMN +
Sbjct: 185 YFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVS 244

Query: 234 LAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSD 293
           LA++AIE+GATVLNY++V +L+KD  T K++GA V D+ET K+Y V AKV VN+TGP+SD
Sbjct: 245 LAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSD 304

Query: 294 LILQMDKNKNGLPDPQPPQPANVSIA----------TEVAVNKPNMVVPSAGVHIILPSY 343
            ILQMD+NK+G PD      AN+  +          + +AV+ P MVVPSAGVHIILPSY
Sbjct: 305 NILQMDRNKSGYPDIF--DKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSY 362

Query: 344 YCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQH 403
           YCPK +G+LDVKTADGRVMFFLPWQ KVLAGTTDIPMK VP+NP ATEADI+DIL ELQH
Sbjct: 363 YCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQH 422

Query: 404 YIKFPVRREDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAGG 460
           Y KFPV+REDVLSAWAGIRPLV DPRK         ST+GLVR+H IFTSE  L+T+AGG
Sbjct: 423 YCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGG 482

Query: 461 KWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQ 520
           KWTTYR MAE+TIDE +K G    KP +T+ + L+GGENWTPN +ALL+Q Y +  ++S+
Sbjct: 483 KWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSK 542

Query: 521 HLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIR 580
           +LS NYGTRAPIICEL K+D++N+LPV   G+E+  +L +V+F + RYP+T+ E  Y I 
Sbjct: 543 YLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCID 602

Query: 581 HEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKT 640
           +EYSR A DFL+RRTR+ FLDA  A+ AVEGTV +MGDELNWDS +R  EI++  E+IKT
Sbjct: 603 NEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKT 662

Query: 641 FGV 643
            GV
Sbjct: 663 LGV 665

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/610 (65%), Positives = 481/610 (78%), Gaps = 11/610 (1%)

Query: 37  ALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLN 96
           +L NEVP    ++ R     PSR +LL  LQKT++FDV                 TRGLN
Sbjct: 30  SLVNEVPTELKLERRAPAP-PSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLN 88

Query: 97  VACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHL 156
           VA +E NDFASGTSSKSTKMAHGGVRYLEKAV+ELS+AQLDLVIEALNER H+L TAPHL
Sbjct: 89  VALLEMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHL 148

Query: 157 CKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKA 216
           CK+LPIMIPVY +WQVPYF+ G K+YD+FAG QNL+SSYLLS + A E+APMLD SKLKA
Sbjct: 149 CKVLPIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKA 208

Query: 217 GLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQ 276
           GLVYHDGSFNDSRMN+T+A++AIE+GATVLNY++V +L+K+    KVEGA+  D+ETGK+
Sbjct: 209 GLVYHDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKE 268

Query: 277 YQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPAN--VSIATEVAVNKPNMVVPSA 334
           Y V+AKV VNATGP+SD +LQMD +  GLPD +     N   +IATEVAV  P MVVPS+
Sbjct: 269 YAVRAKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSS 328

Query: 335 GVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADI 394
           GVHIILPSYYCPK +GLLD +T+DGRVMFFLPWQGKVLAGTTDIPMK VP NPTATEADI
Sbjct: 329 GVHIILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADI 388

Query: 395 QDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSETGL 454
           QDIL+ELQHYIKFPV+REDV SAWAGIRPLV DPRK       T+GLVR+HL+FTS+ G+
Sbjct: 389 QDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRKNL---SDTQGLVRSHLVFTSKNGM 445

Query: 455 ITLAGGKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYK 513
           +T++GGKWTTYREMAE+T++EVVK G F + KPCITRK+KL+G E+W  NL ALL+  Y 
Sbjct: 446 VTISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYN 505

Query: 514 LSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIG 573
           +   +++HLS NYGT+A  +CELF++D  N LPV+    +  +    +++++FRYP+TIG
Sbjct: 506 IPPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIG 561

Query: 574 EFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEE 633
           E  +++ HEY+R   DFLMRRTRYAFLDA  AL AV+GTVKVMGD L WDSA+R  E + 
Sbjct: 562 ELKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKY 621

Query: 634 CTEFIKTFGV 643
             E+IKTFGV
Sbjct: 622 AIEYIKTFGV 631

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/659 (61%), Positives = 501/659 (76%), Gaps = 22/659 (3%)

Query: 1   MFARGGK--LFPKALALTGTVGGALAVH-QYMDSRRQSSALSNEVP-VVSPIDPRPSVNL 56
           MFAR  K  +F   LA T    G L V  +Y    + ++  S+  P ++SP++    +NL
Sbjct: 1   MFARRPKTTIF---LAATAITAGTLVVRRKYHSGTKFNNFQSDFNPYLISPVE-DVEINL 56

Query: 57  PSREDLLSNLQKTD-KFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTK 115
           PSR  L + L   D +FD+                 TRGLNVA VE +DFASGTSSKSTK
Sbjct: 57  PSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTK 116

Query: 116 MAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYF 175
           MAHGGVRYLEKA  + S++QLDLVIEALNER H+L TAPHLCKILPI+IPVY+YWQ+PYF
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 176 FAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLA 235
           +AGCK YD+FAG QNL+SSYL+S+  A E+APMLD + LKA LVYHDGSFNDSR+NS++A
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 236 ISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLI 295
           I+AIE+GATVLNYV+V +LLKD ++NK+ G  V+D+ETG+   VK+KV VNATGPYSD I
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 296 LQMDKNKNGLP-----DPQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVG 350
           LQMDKN +GLP     DP+   P ++S  +++AV+ P MVVPS+GVHIILPSYYCPK +G
Sbjct: 297 LQMDKNLSGLPDLANIDPKMYDPNDIS--SKIAVSNPKMVVPSSGVHIILPSYYCPKQMG 354

Query: 351 LLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVR 410
           LLD +T DGRVMFFLPWQGKV+AGTTDIPM  VP  P A E DIQDIL+ELQHYIKFPVR
Sbjct: 355 LLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVR 414

Query: 411 REDVLSAWAGIRPLVMDPRKRKDTG----GSTEGLVRNHLIFTSETGLITLAGGKWTTYR 466
           REDVLSAWAGIRPLV DPR   D      G+T+GLVR+H +FTS+ GLIT+AGGKWTTYR
Sbjct: 415 REDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYR 474

Query: 467 EMAEQTIDEVVKEGGFS--VKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSN 524
           EMAE+TIDEVVK G F+   KPC T+ +KL G ENW PNL ALL+Q + LS  M+++LS 
Sbjct: 475 EMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSE 534

Query: 525 NYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYS 584
           NYGTR+ IIC+LF+ +E N+LPV   G E+  +L +V+F++FRYP TI E  Y++++EY+
Sbjct: 535 NYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYA 594

Query: 585 RKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           R   DFLMRRTR+A+LDA  AL AV+GTVKVMGDE  WDS RR++EI+  T FI++FGV
Sbjct: 595 RTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/612 (62%), Positives = 454/612 (74%), Gaps = 17/612 (2%)

Query: 49  DPRPSVNLP-------SREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVE 101
           DP   V  P       SR DLL  L KT +FDV                 TRGLNVA VE
Sbjct: 38  DPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVE 97

Query: 102 ANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILP 161
             DFASGTSSKSTKM HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LP
Sbjct: 98  KGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLP 157

Query: 162 IMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYH 221
           I+IP+YS WQVPY + GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYH
Sbjct: 158 ILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYH 217

Query: 222 DGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKA 281
           DGSFNDSR+N+TLAI+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ A
Sbjct: 218 DGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINA 277

Query: 282 KVTVNATGPYSDLILQMDKNKNGLPD-PQPPQPANVSIATEVAVNKPNMVVPSAGVHIIL 340
           K  VNATGPYSD ILQMD+N +GLPD P        S   ++AV  P MV+PS GVHI+L
Sbjct: 278 KCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVL 337

Query: 341 PSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRE 400
           PS+YCPK +GLLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+E
Sbjct: 338 PSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKE 397

Query: 401 LQHYIKFPVRREDVLSAWAGIRPLVMDPR---KRKDTGGSTEGLVRNHLIFTSETGLITL 457
           LQHYI+FPV+REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+
Sbjct: 398 LQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITI 457

Query: 458 AGGKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQ 516
           AGGKWTTYR+MAE+T+D+VV+ GGF ++KPC TR IKLAG E WT N  ALLAQ+Y LS 
Sbjct: 458 AGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSS 517

Query: 517 AMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFT 571
            MS +L  NYGTR+ IICE FKE   N+LP++   +EN  +        VNFD+FRYPFT
Sbjct: 518 KMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFT 577

Query: 572 IGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREI 631
           IGE  YS+++EY R   DFL+RRTR+AFLDA  AL AV  TVKVMGDE NW   +RQ E+
Sbjct: 578 IGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWEL 637

Query: 632 EECTEFIKTFGV 643
           E+   FIKTFGV
Sbjct: 638 EKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/610 (61%), Positives = 452/610 (74%), Gaps = 20/610 (3%)

Query: 50  PRPSVNLP--SREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFAS 107
           P P+   P  SR DLL  L KT +FDV                 TRGLNVA VE  DFAS
Sbjct: 44  PFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFAS 103

Query: 108 GTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVY 167
           GTSSKSTKM HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+Y
Sbjct: 104 GTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIY 163

Query: 168 SYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFND 227
           + WQVPY + GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYHDGSFND
Sbjct: 164 NTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFND 223

Query: 228 SRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNA 287
           SR+N+TLAI+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ AK  VNA
Sbjct: 224 SRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNA 283

Query: 288 TGPYSDLILQMDKNKNGLPDPQPPQPAN-----VSIATEVAVNKPNMVVPSAGVHIILPS 342
           TGPYSD ILQMD+N +G    QP  P N      S   ++AV  P MV+PS GVHI+LPS
Sbjct: 284 TGPYSDAILQMDRNPSG----QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPS 339

Query: 343 YYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQ 402
           +YCPK +GLLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQ
Sbjct: 340 FYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQ 399

Query: 403 HYIKFPVRREDVLSAWAGIRPLVMDPR---KRKDTGGSTEGLVRNHLIFTSETGLITLAG 459
           HYI+FPV+REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+AG
Sbjct: 400 HYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAG 459

Query: 460 GKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAM 518
           GKWTTYR+MAE+T+D+VV+ G F ++KPC TR IKLAG E WT N  ALLAQ+Y LS  M
Sbjct: 460 GKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKM 519

Query: 519 SQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIG 573
           S +L  NYGTR+ IICE FKE   N+LP++   +EN  +        VNFD+FRYPFTIG
Sbjct: 520 SNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIG 579

Query: 574 EFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEE 633
           E  YS+++EY R   DFL+RRTR+AFLDA  AL +   TVKVMGDE NW   +RQ E+E+
Sbjct: 580 ELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEK 639

Query: 634 CTEFIKTFGV 643
              FIKTFGV
Sbjct: 640 TINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/596 (62%), Positives = 447/596 (75%), Gaps = 10/596 (1%)

Query: 58  SREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKMA 117
           SR DLL  L KT +FDV                 TRGLNVA VE  DFASGTSSKSTKM 
Sbjct: 57  SRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMI 116

Query: 118 HGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFFA 177
           HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+YS  QVPY + 
Sbjct: 117 HGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYM 176

Query: 178 GCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAIS 237
           GCK YD+FAG QNL+ SYLLSK+   E APML    LKA LVYHDGSFNDSR+N+TLAI+
Sbjct: 177 GCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAIT 236

Query: 238 AIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQ 297
           A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++KAK  VNATGPYSD ILQ
Sbjct: 237 AVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQ 296

Query: 298 MDKNKNGLPD-PQPPQPANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDVKT 356
           MD+N +G PD P        S   ++AV  P MV+PS GVHI+LPS+YCPK +GLLDV+T
Sbjct: 297 MDRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRT 356

Query: 357 ADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDVLS 416
           +DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQHYI+FPV+REDVLS
Sbjct: 357 SDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLS 416

Query: 417 AWAGIRPLVMDPR---KRKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQTI 473
           AWAG+RPLV DPR        G +T+G+VR+H +FTS+  LIT+AGGKWTTYR+MAE+TI
Sbjct: 417 AWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETI 476

Query: 474 DEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPI 532
           D+VV+ GGF ++ PC TR IKLAG E WT N  ALLAQ+Y LS  MS +L  NYGTR+ I
Sbjct: 477 DKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSI 536

Query: 533 ICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIGEFLYSIRHEYSRKA 587
           ICE FKE   N+LP++   +EN  +        VNFD+FRYPFTIGE  YS+++EY R  
Sbjct: 537 ICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTP 596

Query: 588 TDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
            DFL+RRTR+AFLDA  AL +V  TVKVMGDE NW   +RQ E+E+   FIKTFGV
Sbjct: 597 LDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/593 (62%), Positives = 444/593 (74%), Gaps = 12/593 (2%)

Query: 57  PSREDLLSNLQKTDKFDVXXXXXXXXXXXXXXXXXTRGLNVACVEANDFASGTSSKSTKM 116
           P R  +L  LQ T KFDV                  RGL VA VE  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 117 AHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFF 176
           AHGGVRYLEKAVFELS+ QLDLV+EALNER H+L  APHL KILPI+IPVY YW+VPYF+
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 177 AGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAI 236
           AGCK+YD+FAG QNL+SSYLLS+   S +APMLD+ KLK GLVYHDG FNDSR+ +TLAI
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 237 SAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLIL 296
           SA+E GATV NYV V QL+KD +T  + GA VEDQETG  + V AK+ VNATGPYSD IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 297 QMDKNKNGLPDPQPPQ--PANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDV 354
           QMD N  GLP+ +P +  P N  I    AV  P MVVPS GVHI LPS+YCP  +GLLD 
Sbjct: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 355 KTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDV 414
            T+DGRVMFFLPWQGKV+AGTTDIP+K VP++P+ TEADIQDIL+ELQHYI+FPVRREDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 415 LSAWAGIRPLVMDPRKRKDTGGS--TEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQT 472
           LSAWAGIRPLV DPR  + + GS  TEGLVR+H IFTS T L+T+AGGKWTTYREMAE+T
Sbjct: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473

Query: 473 IDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYK-LSQAMSQHLSNNYGTRA 530
           +DEV+K G F  +KPC TRK KL G ++W  N  A L Q Y  L  ++++HL+NNYG RA
Sbjct: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533

Query: 531 PIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDF 590
           PIICE+F+ D+ ++LPV   G  +  V  +++ ++F YPFTI E  Y IR EY R A DF
Sbjct: 534 PIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDF 592

Query: 591 LMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643
           L+RR+R+AFLDA  AL AV+ TV ++GDEL WD+ +R  E  +   +IKTFGV
Sbjct: 593 LLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/542 (64%), Positives = 422/542 (77%), Gaps = 18/542 (3%)

Query: 116 MAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYF 175
           M HGGVRYLEKA +E S+AQLDLVIEALNER H++ TAPHLC +LPI+IP+Y+ WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 176 FAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLA 235
           +AGCK YD+FAGKQNL+SSYLLSK+   E APML    LKA LVYHDGSFNDSR+N+TLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 236 ISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLI 295
           I+A+E+GATVLNYV+V +L+KD ++ KV GA   D ET +  ++ AK  VNATGPYSD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 296 LQMDKNKNGLPDPQPPQPAN-----VSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVG 350
           LQMD+N +G    QP  P N      S   +VAV  P MV+PS GVHI+LPS+YCPK +G
Sbjct: 181 LQMDRNASG----QPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236

Query: 351 LLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVR 410
           LLDV+T+DGRVMFFLPWQGKVLAGTTDIP+K VP+NP  TEADIQDIL+ELQHYI+FPV+
Sbjct: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296

Query: 411 REDVLSAWAGIRPLVMDPRK---RKDTGGSTEGLVRNHLIFTSETGLITLAGGKWTTYRE 467
           REDVLSAWAG+RPLV DPR        G +T+G+VR+H +FTS+ GLIT+AGGKWTTYR+
Sbjct: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356

Query: 468 MAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNY 526
           MAE+TID+VV+ GGF ++KPC TR IKLAG E WT N  ALLAQ+Y LS  MS +L  NY
Sbjct: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416

Query: 527 GTRAPIICELFKEDERNQLPVAFGGRENVTVLHH-----VNFDSFRYPFTIGEFLYSIRH 581
           GTR+ IICE FK+   N+LP++   +EN T+  +     VNFD+FRYPFTIGE  YS+++
Sbjct: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476

Query: 582 EYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTF 641
           EY R   DFL+RRTR+AFLDA  AL +V  TVKVMGDE NW   +RQ E+E+   FIKTF
Sbjct: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536

Query: 642 GV 643
           GV
Sbjct: 537 GV 538

>Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR184W
            (REAL)
          Length = 1536

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 11/94 (11%)

Query: 246  LNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGL 305
            +++VK  QLL+D+   +    I ED     +Y V AK+ VN  G Y DL       K+G 
Sbjct: 1307 ISFVKWNQLLQDNFEKRY--YIPEDPSEDAEYDVNAKLGVNRRGIYRDLY------KSGK 1358

Query: 306  PDPQPPQPANVSIATEVAVNKPNMVVPSAGVHII 339
            P        N ++A  VA   P + VP   +  I
Sbjct: 1359 PYEDYQLRPNFAVAMTVA---PELFVPQHAIKAI 1389

>Skud_16.488 Chr16 (844445..849046) [4602 bp, 1533 aa] {ON} YPR184W
            (REAL)
          Length = 1533

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 43/94 (45%), Gaps = 11/94 (11%)

Query: 246  LNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGL 305
            +++V+  QLL+D+   +    I ED     +Y V AK+ VN  G Y DL       K+G 
Sbjct: 1307 VSFVEWNQLLQDNFEKRY--YIPEDPAEDAEYDVDAKLGVNRRGIYRDLY------KSGK 1358

Query: 306  PDPQPPQPANVSIATEVAVNKPNMVVPSAGVHII 339
            P        N +IA  VA   P + VP   V  I
Sbjct: 1359 PYEDYQLRPNFAIAMTVA---PELFVPEHAVKAI 1389

>YPR184W Chr16 (902044..906654) [4611 bp, 1536 aa] {ON}  GDB1Glycogen
            debranching enzyme containing glucanotranferase and
            alpha-1,6-amyloglucosidase activities, required for
            glycogen degradation; phosphorylated in mitochondria;
            activity is inhibited by Igd1p
          Length = 1536

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 11/94 (11%)

Query: 246  LNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGL 305
            +++ +  QLL+D+   +    + ED      Y V AK+ VN  G Y DL       K+G 
Sbjct: 1307 IDFTEWNQLLQDNFEKRY--YVPEDPSQDADYDVSAKLGVNRRGIYRDLY------KSGK 1358

Query: 306  PDPQPPQPANVSIATEVAVNKPNMVVPSAGVHII 339
            P        N +IA  VA   P + VP   +  I
Sbjct: 1359 PYEDYQLRPNFAIAMTVA---PELFVPEHAIKAI 1389

>TDEL0C03030 Chr3 (540079..542253) [2175 bp, 724 aa] {ON} Anc_7.439
           YPR031W
          Length = 724

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 75/174 (43%), Gaps = 13/174 (7%)

Query: 153 APHL-CKILPIMIPVY---SYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPM 208
           APHL   IL  +I ++   +  QV Y+   C+   +++ K+ L+    L + Y S  + +
Sbjct: 471 APHLFADILREVIKLFDIPNSQQVSYYI--CR---YWSMKKELKRGAPLVRKYESNSSSL 525

Query: 209 LDESKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIV 268
           LDES+L+  +   D   ND R    L+   I   A VLN ++ T       T   E  I+
Sbjct: 526 LDESQLQERVEVTDILLNDLRRLKELSNLTIRRTA-VLNRLRETNDKIKPLTESPENYIL 584

Query: 269 EDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANVSIATEV 322
            +    K    +A  ++        ++ Q+   K        PQ +NVS   EV
Sbjct: 585 RNMVINKFVDSEAFKSLECEISDKIILSQLQSCKEFTI---SPQNSNVSFEAEV 635

>Suva_16.516 Chr16 (884486..889096) [4611 bp, 1536 aa] {ON} YPR184W
            (REAL)
          Length = 1536

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 11/94 (11%)

Query: 246  LNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGL 305
            +++    QL++D+   K    I ED     +Y V+AK  VN  G Y DL       K+G 
Sbjct: 1307 VSFAGWNQLVQDNFEKKY--YIPEDPTKDAEYDVEAKSGVNRRGIYRDLY------KSGK 1358

Query: 306  PDPQPPQPANVSIATEVAVNKPNMVVPSAGVHII 339
            P        N +IA  VA   P + VP   +  I
Sbjct: 1359 PYEDYQLRPNFAIAMTVA---PELFVPEHAIKAI 1389

>KNAG0B03080 Chr2 (593481..596162) [2682 bp, 893 aa] {ON} Anc_5.634
           YOR038C
          Length = 893

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 281 AKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANVSIATEVAVNKPNM-VVPSAGVHII 339
           +K TV   G  +   ++   +K+  PD  PP+PA++          P + V  S  +   
Sbjct: 406 SKATVLPAGEKTKKTMEHRDSKSQTPDTTPPKPASI----------PGVKVTQSTSMEFN 455

Query: 340 LPSYYCPKTVGLLDVKTADGRVM 362
           +PSY  PK +     +TA+G ++
Sbjct: 456 MPSYSVPKDLKRKPKETANGEII 478

>NCAS0A09880 Chr1 complement(1975537..1978155) [2619 bp, 872 aa]
           {ON} 
          Length = 872

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 71/175 (40%), Gaps = 33/175 (18%)

Query: 471 QTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSALLAQHYKLSQAMSQHLSNNYGTRA 530
           ++ID  + E   +    +TRK  L+G EN TP L   L     +  +  +++ N+     
Sbjct: 6   KSIDITLPEEDSTYDKHLTRKRSLSGSENVTPRLKFALCNPTIVQNSTVKNVDNSINNTD 65

Query: 531 PIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDF 590
             I + F+          F  + N     H++FD  +        + S R    RK ++F
Sbjct: 66  NSIKDSFR----------FIAKHNT----HIDFDKLK-------MVASSR----RKLSEF 100

Query: 591 LMRRTRYAFLDAANAL---TAVEGTVKVMGDELNWDSAR--RQREIEECTEFIKT 640
                 +A+L     +      E  +++   E+N+ +    R+R   +C E I+T
Sbjct: 101 ---SKLFAYLPEQKLIRYCQVAENNIEICNKEINFANPEELRKRHASKCKEHIRT 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,143,339
Number of extensions: 2775839
Number of successful extensions: 7528
Number of sequences better than 10.0: 34
Number of HSP's gapped: 7622
Number of HSP's successfully gapped: 34
Length of query: 643
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 527
Effective length of database: 40,180,143
Effective search space: 21174935361
Effective search space used: 21174935361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)