Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16500g5.710ON34234213610.0
TDEL0B021005.710ON3403416303e-79
YIL154C (IMP2')5.710ON3463546112e-76
CAGL0H06677g5.710ON3383256051e-75
Smik_9.155.710ON3443545955e-74
Skud_9.145.710ON3513565958e-74
Suva_9.345.710ON3203455901e-73
NDAI0F002305.710ON4862155403e-64
Kpol_1043.765.710ON3723725324e-64
KAFR0D021805.710ON3873885151e-61
KNAG0L021805.710ON4393635156e-61
NCAS0G001905.710ON4432254678e-54
SAKL0E15092g5.710ON3523184564e-53
TBLA0E017405.710ON3752074252e-48
TPHA0E001605.710ON4404414206e-47
Kwal_55.196555.710ON3242944012e-45
KLTH0E00858g5.710ON3242923882e-43
KLLA0A00440g5.710ON3553433194e-33
AFR294W5.710ON3402752871e-28
Ecym_40115.710ON4223622672e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16500g
         (342 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   528   0.0  
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   247   3e-79
YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   239   2e-76
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   237   1e-75
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   233   5e-74
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   233   8e-74
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   231   1e-73
NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   212   3e-64
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...   209   4e-64
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   202   1e-61
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   202   6e-61
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   184   8e-54
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   180   4e-53
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...   168   2e-48
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...   166   6e-47
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   159   2e-45
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   154   2e-43
KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   127   4e-33
AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   115   1e-28
Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   107   2e-25

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/342 (80%), Positives = 274/342 (80%)

Query: 1   MSNQKSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERGRSRVKAARGIKXXXX 60
           MSNQKSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERGRSRVKAARGIK    
Sbjct: 1   MSNQKSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERGRSRVKAARGIKSNSG 60

Query: 61  XXXXXXXXXHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNAXXXXXXXXXXXXXXXXX 120
                    HVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNA                 
Sbjct: 61  SRSRSRNPSHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNADDEEEEEEDEDQEDEDL 120

Query: 121 XXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVS 180
                      NDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVS
Sbjct: 121 VSDEEQVSDVENDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVS 180

Query: 181 FTKLPGGYSRCCQLLSRGKGATTRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHW 240
           FTKLPGGYSRCCQLLSRGKGATTRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHW
Sbjct: 181 FTKLPGGYSRCCQLLSRGKGATTRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHW 240

Query: 241 DGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYAL 300
           DGKQPGSSKETLEQSVKSLRQHVLHKLDCA               HPYPKHLLSEMIYAL
Sbjct: 241 DGKQPGSSKETLEQSVKSLRQHVLHKLDCASASLQDLDVVLLSLSHPYPKHLLSEMIYAL 300

Query: 301 QPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           QPIA            QNFVCSVPTLVIRKKLKRSKRKGISD
Sbjct: 301 QPIALCCSLSLVLTTLQNFVCSVPTLVIRKKLKRSKRKGISD 342

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  247 bits (630), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 190/341 (55%), Gaps = 10/341 (2%)

Query: 5   KSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERGRSRVKA---ARGIKXXXXX 61
           + ILLT  DG+++     P   +     GGVQFDSEQLERGRSR K              
Sbjct: 7   RGILLTGTDGSQS-----PLNVNDNEPAGGVQFDSEQLERGRSRTKIRNNGSSQLSASSS 61

Query: 62  XXXXXXXXHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNAXXXXXXXXXXXXXXXXXX 121
                    +R+ EFLKWTVL+RDPSMRL      +    +                   
Sbjct: 62  RSRSRASSRIRDEEFLKWTVLRRDPSMRLQLNQKDDKKSRDEQSDDEDSEELDLEDDVSD 121

Query: 122 XXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVSF 181
                     ND +IDE+ HYD+G +VLPN+  S+N+VL S+K WI  + +     ++  
Sbjct: 122 EEQVTDVD--NDFDIDEEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANTQEPEIPL 179

Query: 182 TKLPGGYSRCCQLLSRGKGATTRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWD 241
             L GGY R    LS+GKG+TT RS++LC+DLT+ES YAL YV+GAL++NGDTLY+VHWD
Sbjct: 180 ATLAGGYKRAMLPLSKGKGSTTDRSYILCSDLTSESQYALTYVMGALVSNGDTLYVVHWD 239

Query: 242 GKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQ 301
            +    +   L++++ ++R++V H  D                 HP+PK LL+EMI+ LQ
Sbjct: 240 NQSSSDADAKLQKNILTIRENVEHMFDSIGAVIEDFDVVVLSLQHPFPKQLLTEMIHGLQ 299

Query: 302 PIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           P+A            QN+VCSVPTLVIRKKLKR+K+KGIS+
Sbjct: 300 PVALCCSLSMILSTLQNYVCSVPTLVIRKKLKRAKKKGISE 340

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  239 bits (611), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 195/354 (55%), Gaps = 24/354 (6%)

Query: 4   QKSILLTVPDGTRTVLLDEPHRRHSL--AEPGGVQFDSEQLERG---RSRVKAARGIK-- 56
           QKSILLT PDGT++ L       HS+    P  V+FDSEQ+ERG   R R K  RG +  
Sbjct: 2   QKSILLTKPDGTQSNL-------HSIKTETPTTVEFDSEQMERGHRERGRSKKKRGERDS 54

Query: 57  ---XXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNAXXXXXXXXXX 113
                            VR  EFLKWTVL++DPSMRL +    +                
Sbjct: 55  NVSSLSRSRSRASSRSRVREEEFLKWTVLRQDPSMRL-RVVDVDSEEEGEGNDEDDDDGD 113

Query: 114 XXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ 173
                             NDLEIDE+ HYD+G +VLPN+  SINEVL S+K WI+ YE  
Sbjct: 114 GDDMDEEESDEEQVSDIENDLEIDEEFHYDLGMKVLPNFCTSINEVLDSSKPWIAKYEIS 173

Query: 174 ---ETTQDVSFTKLPGGYSRCCQLLSRGKGATT--RRSFVLCTDLTTESHYALAYVIGAL 228
                 +DVS  +L GGY R  QLL++G GA    +RSF+L TDL++ES YAL Y++GA 
Sbjct: 174 IRGHENEDVSLEQLDGGYVRAMQLLTKGAGAEAGNQRSFILYTDLSSESTYALTYLMGAA 233

Query: 229 LNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPY 288
           +N GDT+YIVHW+  +P    +    +V  +R+HV+H  DC                HPY
Sbjct: 234 VNQGDTVYIVHWEPSKPTDDSQMF-ANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPY 292

Query: 289 PKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           PKHLL+EMI+ L+P+A            QNFVCSVP L +RKKLKR+KRKGIS+
Sbjct: 293 PKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 346

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  237 bits (605), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 187/325 (57%), Gaps = 15/325 (4%)

Query: 32  PGGVQFDSEQLERGRSRVK--AARGIKXXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMR 89
           P  +QFDSE + RGRSR K     G                VR  EFLKWTVL+RDPSMR
Sbjct: 15  PTEIQFDSE-IGRGRSRDKRTGGNGAGRLSLSRSRSRASSRVREEEFLKWTVLRRDPSMR 73

Query: 90  L----HKKPHGNGIGNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMG 145
           L      K  G+G G +                             ND EIDE+ H+D+G
Sbjct: 74  LTTLKKNKKSGSGTGGDDDDDDDEDDDDEDDDDEEESDEERVSDIENDAEIDEEFHFDLG 133

Query: 146 TRVLPNYAASINEVLASTKSWI----STYESQETTQDVSFTKLPGGYSRCCQLLSRGKGA 201
           T+VLPN++ SIN+VL ++K WI    ST + ++    V+F  L GGYSR  +L+ +GKGA
Sbjct: 134 TKVLPNFSTSINDVLENSKPWIQKYLSTLDMEKERAGVNFETLEGGYSRALELVRKGKGA 193

Query: 202 T----TRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWDGKQPGSSKETLEQSVK 257
                T ++++LCTDL++ES YAL YV+G+L++NGDTLYIVHWDG    S+K++   +  
Sbjct: 194 EAHPETSKNYILCTDLSSESTYALTYVMGSLVSNGDTLYIVHWDGDSTTSTKDSFIDNAL 253

Query: 258 SLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQ 317
            +++HV H +DC                HPYPKHLL+EMI+ L+P+             Q
Sbjct: 254 RVKKHVRHLMDCVSVIVDDLDVVIISLTHPYPKHLLNEMIHGLKPVTLACSLSLILSSLQ 313

Query: 318 NFVCSVPTLVIRKKLKRSKRKGISD 342
           NFVCSVPTLVIRKKLKRS++KGIS+
Sbjct: 314 NFVCSVPTLVIRKKLKRSRKKGISE 338

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  233 bits (595), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 152/354 (42%), Positives = 192/354 (54%), Gaps = 26/354 (7%)

Query: 4   QKSILLTVPDGTRTVLLDEPHRRHSL--AEPGGVQFDSEQLERG---RSRVKAARGIK-- 56
           QKSILLT PDGT++ L       HS     P  V+FDSEQ+ERG   R R K  RG +  
Sbjct: 2   QKSILLTKPDGTQSNL-------HSAKTETPTTVEFDSEQMERGQRERGRSKKKRGDQDS 54

Query: 57  ---XXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNNAXXXXXXXXXX 113
                            VR  EFLKWTVL++DPSMRL      +                
Sbjct: 55  SVSSLSRSRSRASSRSRVREEEFLKWTVLRQDPSMRLRVV---DVDSEEEGEGNDDDGDD 111

Query: 114 XXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ 173
                             NDLEIDE+ HYD+G +VLPN+  SINEVL S+K WI+ YE  
Sbjct: 112 GDDVDEEESDEEQVSDVENDLEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYEIS 171

Query: 174 ---ETTQDVSFTKLPGGYSRCCQLLSRGKGAT--TRRSFVLCTDLTTESHYALAYVIGAL 228
                 + VS  +L GGY R  QLL++G GA    +RSF+L TDL++ES YAL Y++GA+
Sbjct: 172 IRGHEDEGVSLEQLDGGYVRAMQLLTKGAGAEPGNQRSFILYTDLSSESTYALTYLMGAV 231

Query: 229 LNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPY 288
           +N GDTLYIVHW+  +P    +    +V  +R+HV+H  DC                HPY
Sbjct: 232 VNQGDTLYIVHWEPSKPTDDAQMF-ANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPY 290

Query: 289 PKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           PKHLL+EMI+ L+P+A            QNFVCSVP L +RKKLKR+KRKGI +
Sbjct: 291 PKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGICE 344

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  233 bits (595), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 151/356 (42%), Positives = 193/356 (54%), Gaps = 23/356 (6%)

Query: 4   QKSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERG---RSRVKAARGIK---- 56
           QKSILLT PDGT++ L    HR  +   P  V+FDSEQ+ERG   R R K  R  +    
Sbjct: 2   QKSILLTKPDGTQSNL----HRTKT-ETPTTVEFDSEQMERGHRERGRSKKKRDERDSYA 56

Query: 57  ----XXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRLH-KKPHGNGIGNNAXXXXXXXX 111
                             VR  EFLKWTVL++DPSMRL       +              
Sbjct: 57  SSLSRSRSRASRASSRSRVREEEFLKWTVLRQDPSMRLKVADADSDEEEEGEGGDDDDDD 116

Query: 112 XXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYE 171
                               ND EIDE+ HYD+G +VLPN+  SINEVL S+K WI+ YE
Sbjct: 117 EDGDDMDEEESDEEQVSDVENDAEIDEEFHYDLGMKVLPNFCTSINEVLESSKPWIAKYE 176

Query: 172 SQ---ETTQDVSFTKLPGGYSRCCQLLSRGKGAT--TRRSFVLCTDLTTESHYALAYVIG 226
                   + VS  +L GGY R  QLL++G GA    +RSF+L TDL++ES YAL Y++G
Sbjct: 177 ISIRGHENEGVSLEQLDGGYVRAMQLLTKGAGAEPGNQRSFILYTDLSSESTYALTYLMG 236

Query: 227 ALLNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXH 286
           A++N GDTLYI+HW+  +P    +    +V  +R+HV+H  DCA               H
Sbjct: 237 AVVNQGDTLYILHWEPSKPTDDSQMF-ANVARIRKHVMHLFDCAAGVLDDLDVVVLSLTH 295

Query: 287 PYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           PYPKHLL+EMI+ L+P+A            QNFVCSVP L +RKKLKR+KRKGIS+
Sbjct: 296 PYPKHLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVPILAVRKKLKRAKRKGISE 351

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  231 bits (590), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/345 (42%), Positives = 185/345 (53%), Gaps = 34/345 (9%)

Query: 5   KSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERG---RSRVKAARGIKXXXXX 61
           KSILLT PDG +T L      +     P  V+FDSEQLERG   R R K           
Sbjct: 3   KSILLTTPDGAQTNL-----HQTKPETPTTVEFDSEQLERGHRERGRSK----------- 46

Query: 62  XXXXXXXXHVRNGEFLKWTVLKRDPSMRLH--KKPHGNGIGNNAXXXXXXXXXXXXXXXX 119
                     +  +FLKWTVL++DPSMRL    +       N+                 
Sbjct: 47  ----------KEEQFLKWTVLRQDPSMRLRVVDQDSEEDEDNDNNNNNDDDGPNDDDVDD 96

Query: 120 XXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDV 179
                       NDLEIDE+ HYD+G +VLPN+  SIN+VL S K WI+ YE       V
Sbjct: 97  EESDEEQVSDVDNDLEIDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEMGHENDGV 156

Query: 180 SFTKLPGGYSRCCQLLSRGKGAT--TRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYI 237
           S  +L GGY R  QLL++G GA    +R F+L TDL++ES YAL Y++GA+LN GDTLYI
Sbjct: 157 SLERLAGGYVRAMQLLTKGAGAEPGAQRCFILYTDLSSESTYALTYLMGAVLNQGDTLYI 216

Query: 238 VHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMI 297
           VHW+   P    + L  +V  +R+HV+H  DC                HPYPKHLL+EMI
Sbjct: 217 VHWEPSTPVDDAQML-ANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHLLNEMI 275

Query: 298 YALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           + L+P+A            QNFVCSVPTL +RKKLKR+KRKGI +
Sbjct: 276 HGLKPVALCCSLSVILGTLQNFVCSVPTLAVRKKLKRAKRKGICE 320

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  212 bits (540), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 140/215 (65%), Gaps = 12/215 (5%)

Query: 132 NDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ---ETTQDVSFTKLPGGY 188
           ND+EIDE  +YD+G +VLPN+ +SIN++L + K WI+ YE     +  + V+FT L GGY
Sbjct: 273 NDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENEGVNFTTLDGGY 332

Query: 189 SRCCQLLSRGKGATTR--------RSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHW 240
            R  QLL++GKGA+          R ++L TDL++ES YAL Y++GA+LNNGDTLYIVHW
Sbjct: 333 IRAMQLLTKGKGASMDFDPMKPAGRCYILYTDLSSESTYALTYMMGAVLNNGDTLYIVHW 392

Query: 241 DGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYAL 300
           +  +  + K  ++++V  +R+HV+H  DC                HPYPKHLL+EMI+ L
Sbjct: 393 ESSKVANEK-LMQENVGRVRKHVMHMFDCVSAVIDDLDVIILSLTHPYPKHLLNEMIHGL 451

Query: 301 QPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRS 335
           +P++            QNFVCSVPTLVIRKKLKRS
Sbjct: 452 KPVSIACSLTIILSTLQNFVCSVPTLVIRKKLKRS 486

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 36/85 (42%), Gaps = 27/85 (31%)

Query: 34  GVQFDSEQLERGRSRVKAAR---------------------------GIKXXXXXXXXXX 66
            VQFD+E++ERGRSR+K +                            G            
Sbjct: 112 AVQFDAEEIERGRSRIKNSTTHANVNTNANPNNNTNNNMERSNRRIGGSLSTSRSRSRSR 171

Query: 67  XXXHVRNGEFLKWTVLKRDPSMRLH 91
               +R  EFLKWTVL++DPSMRL 
Sbjct: 172 ASSRIREEEFLKWTVLRQDPSMRLQ 196

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score =  209 bits (532), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 140/372 (37%), Positives = 199/372 (53%), Gaps = 30/372 (8%)

Query: 1   MSNQKSILLTVPDGTRTVLLDEPH-RRHSLAEPGGVQFDSEQLE--RGRSRVKAA--RGI 55
           M NQ+SILL   DG +T +   P    ++     GVQFDS Q+E  RGRS+ +    R  
Sbjct: 1   MVNQRSILLHSSDGAQTQIYKSPDVEENNEINNSGVQFDSAQIENDRGRSKRRNGEFRNG 60

Query: 56  KXXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRL-----------HKKPHGNGIGNNAX 104
                          VR+ EFLKWTVL+RDPSMRL           +KK HG    ++  
Sbjct: 61  SGASLSRSRSRANSRVRDEEFLKWTVLRRDPSMRLRTIRKKNQQGLNKKKHGAEEDDDEE 120

Query: 105 XXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTK 164
                                      N+ +IDE + +D+GT+VLPNY  SIN+++ S+K
Sbjct: 121 EDEEEEEEEEDDDDDEISDEEQVSDIENENDIDEDITFDLGTKVLPNYCMSINDIMESSK 180

Query: 165 SWISTYESQETT---QDVSFTKLPGGYSRCCQLLSRGKGATTRR--------SFVLCTDL 213
            WIS Y S+       +V   K+ GG+ +  +L+S+ + ++T          S++L TDL
Sbjct: 181 KWISDYLSRPENLRNDNVHIEKMEGGFVKAMELISKKEDSSTSISSSGKEGDSYILYTDL 240

Query: 214 TTESHYALAYVIGALLNNGDTLYIVHWDGKQP-GSSKETLEQSVKSLRQHVLHKLDCAXX 272
           T+ES YALAYV+GAL+NNGDTLY+VHW+G    G +   +  ++  +R+HV+H LDC+  
Sbjct: 241 TSESTYALAYVLGALVNNGDTLYVVHWEGNNTHGVTDTRIYDNIFRIRKHVMHLLDCSSA 300

Query: 273 XXXXXXXXXXXXXHPYPKHLLSEMIYALQP--IAXXXXXXXXXXXXQNFVCSVPTLVIRK 330
                        HPYPKHLL+EMI+ L+P  +             QN+V S+P LVIRK
Sbjct: 301 VIDRIDILLISLTHPYPKHLLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIPMLVIRK 360

Query: 331 KLKRSKRKGISD 342
           KLKR ++KGI++
Sbjct: 361 KLKRPRKKGINE 372

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  202 bits (515), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 138/388 (35%), Positives = 191/388 (49%), Gaps = 54/388 (13%)

Query: 3   NQKSILLTVPDGTRTVLLDEPHRRHSLAEPG------------GVQFDSEQLERGRSRVK 50
           N KSILLT PDGT+  L     R    + P              VQF+   ++RGRSR+K
Sbjct: 6   NNKSILLTTPDGTQAPLHAVESRTTKDSSPSPKDESILHKNATEVQFN---IDRGRSRLK 62

Query: 51  AARG--------IKXXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRLH------KKPHG 96
             R          +              VR  EFLKWTVL++DPSMRL       KK  G
Sbjct: 63  KQRSNASTSQSFSRSRSRSKSFSRNSSKVREEEFLKWTVLRQDPSMRLFNANEKLKKKEG 122

Query: 97  NGIGNNAXXXXXXXXXXXXXXXXXXXXXX------------XXXXXXNDLEIDEQMHYDM 144
               +                                          N++EIDE++ +D+
Sbjct: 123 TYDSDEIYSSESVEDEDKGDDEDEDEDEESEDFEEEESDEEQVSDIDNEVEIDEKLDFDL 182

Query: 145 GTRVLPNYAASINEVLASTKSWISTYESQ-------ETTQDVSFTKLPGGYSRCCQLLSR 197
           G +VLPN+  SINEVL S K W+  YE +       ETT+     ++  GY R   L+++
Sbjct: 183 GMKVLPNFCVSINEVLESRKPWVQQYEKEIESVLPDETTK---LDEIEDGYIRAIDLVTK 239

Query: 198 GKGATTR---RSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWDGKQPGSSKETLEQ 254
           G+G++     +S++L  DL++ES YAL YV+G ++NNGDTLYIV+W+       +  +  
Sbjct: 240 GEGSSKNGDGQSYILFMDLSSESIYALTYVMGCVINNGDTLYIVNWESTLKHIDETIIYN 299

Query: 255 SVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXX 314
           ++K +++  LH  DC                HPYPKHLLSEMIY L+P+A          
Sbjct: 300 NLKRVKKMTLHLFDCISGVIDNLDVIIVSLTHPYPKHLLSEMIYGLKPMALCCSLSIMLS 359

Query: 315 XXQNFVCSVPTLVIRKKLKRSKRKGISD 342
             QNFVCSVPTLV+R+KLKRSKR+G++D
Sbjct: 360 TLQNFVCSVPTLVVRRKLKRSKRRGLTD 387

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score =  202 bits (515), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 181/363 (49%), Gaps = 55/363 (15%)

Query: 35  VQFDSEQLERGRSRVK---AARG---------------------IKXXXXXXXXXXXXXH 70
           VQFDSEQ+ERGRSR+K   A R                                      
Sbjct: 77  VQFDSEQIERGRSRMKRRDAKRAEARSNSGSRSRSGSRSRSRSRSFSRSRSRTSSRASSR 136

Query: 71  VRNGEFLKWTVLKRDPSMRLH--KKPHGNGIGNNAXXXXXXXXXXXXXXXXXXXXXX--- 125
           +R  EFLKWTVL++DPSMRLH  +  + NG G                            
Sbjct: 137 IREEEFLKWTVLRQDPSMRLHHYRVDYKNGKGRGEDDDDEEEEEEEEEEDDEDDEDDDED 196

Query: 126 ---------------------XXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLASTK 164
                                      ND EIDE+  YD+GT+ LPN+  SINEV++S +
Sbjct: 197 DEDDDGDDDEDSESDEESDEEQVSDVENDAEIDEKFTYDLGTKTLPNFCVSINEVISSAE 256

Query: 165 SWISTYESQ--ETTQDVSFTKLPGGYSRCCQLLSRGKGATTRR-SFVLCTDLTTESHYAL 221
            WI  Y++   E+ + +    + GGY R  +LL+RGKGA+ +  ++++ +DL++ES+YAL
Sbjct: 257 PWIRQYDADHGESQEKIDVRDVEGGYVRAVELLTRGKGASPQADTYIVYSDLSSESNYAL 316

Query: 222 AYVIGALLNNGDTLYIVHWDGKQPGSS--KETLEQSVKSLRQHVLHKLDCAXXXXXXXXX 279
            YV+G L+ NGDT+Y+VHW   + G +     +  +V++LR+  LH  DC          
Sbjct: 317 LYVLGTLVGNGDTVYVVHWHSDRGGGAVTHSEVRSNVRNLRRKALHLFDCLSATVDDLDI 376

Query: 280 XXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKG 339
                 HPYPKHLL+EMI AL P+A            QNFVCSVPT VIRKKLKR+KRKG
Sbjct: 377 VLLSTTHPYPKHLLNEMINALHPVALCCSLSIVLSLLQNFVCSVPTFVIRKKLKRAKRKG 436

Query: 340 ISD 342
           ISD
Sbjct: 437 ISD 439

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  184 bits (467), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 138/225 (61%), Gaps = 15/225 (6%)

Query: 132 NDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ---ETTQDVSFTKLPGGY 188
           ND+EIDE  +YD+G +VLPN+ +SIN++L + K WI+ YE     +   +V   +L GGY
Sbjct: 220 NDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIKGKENDNVEIGRLDGGY 279

Query: 189 SRCCQLLSRGKGA-----------TTRRSFVLCTDLTTESHYALAYVIGALLNNGDTLYI 237
            R  QLL++GKGA              R ++L TDL++ES YAL Y +GA++NNGDTLY+
Sbjct: 280 LRAMQLLTKGKGAYLNTESTATPTPAGRCYILYTDLSSESTYALTYTMGAVINNGDTLYV 339

Query: 238 VHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMI 297
           VH +          L ++V  +R+HV+H  DC                HPYPKHLL+EMI
Sbjct: 340 VHSENSNIFDEPLML-KNVGRIRKHVMHMFDCISAVVDDVDVVALSLTHPYPKHLLNEMI 398

Query: 298 YALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           + L+P+A            QNFVCSVPTLVIRKKLKR+KRKGI+D
Sbjct: 399 HGLKPVALCVPLSIMLSSLQNFVCSVPTLVIRKKLKRAKRKGITD 443

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 38/78 (48%), Gaps = 20/78 (25%)

Query: 34  GVQFDSEQLERGRSRVKAARGIKXXXXXXXXXXXXXHV--------------------RN 73
           GVQFD+EQ+ERGRSR+K +  I              ++                    R 
Sbjct: 76  GVQFDAEQIERGRSRIKKSNAISAGAATMGTSQTGGNIGSLSGSKSRSRSRSRASSRIRE 135

Query: 74  GEFLKWTVLKRDPSMRLH 91
            EFLKWTVL++DPSMRL 
Sbjct: 136 EEFLKWTVLRQDPSMRLQ 153

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  180 bits (456), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 159/318 (50%), Gaps = 24/318 (7%)

Query: 35  VQFDSEQLERGRSRVKAAR-----GIKXXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMR 89
           +Q     L RGR R +  R     G                + +  +LKWTVL+RDPS R
Sbjct: 45  IQIVESPLPRGRGRSREKRSSVGGGTSNTRSLSTRSISGSRIEDESYLKWTVLRRDPSER 104

Query: 90  LHKKPHGNGIGNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVL 149
           LHK        N                              ND EID ++ YD+G RVL
Sbjct: 105 LHK--------NEENDRDESAIDDDDYDEDDVSDEEQISDIENDQEIDSELDYDLGARVL 156

Query: 150 PNYAASINEVLASTKSW----ISTYESQETTQDVSFTKLPGGYSRCCQLLSRGKGATTRR 205
           PN++ SI+ VL S K W    + T + +     +    LPGGY R   L++RGKG ++  
Sbjct: 157 PNFSTSISNVLESNKPWTKKYLQTVDQKAERAKIKLDSLPGGYMRAMSLVTRGKGGSSTH 216

Query: 206 --SFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWDGKQPGSSKET-LEQSVKSLRQH 262
             S++L  DL++ES YAL Y +GA++N+GDTLY+VH +     S+ ET L Q++  L Q 
Sbjct: 217 GSSYILYADLSSESMYALTYTLGAVVNSGDTLYVVHVES----STTETRLLQNIDKLTQQ 272

Query: 263 VLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCS 322
               LDC                HPYPKHL+++MI+ L+P+             QN+VC+
Sbjct: 273 TAFLLDCTSGVVNDLSVVLLSLSHPYPKHLVNQMIHGLKPLLLVVSLSLVLTSLQNYVCN 332

Query: 323 VPTLVIRKKLKRSKRKGI 340
           +PTLV+RKKLKRSKR+GI
Sbjct: 333 IPTLVVRKKLKRSKRRGI 350

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score =  168 bits (425), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 121/207 (58%), Gaps = 4/207 (1%)

Query: 132 NDLEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQ---ETTQDVSFTKLPGGY 188
           N+ E+DE+  ++ G ++LPN+   IN  L   K WI  YESQ   +  + ++  KL  GY
Sbjct: 165 NEAELDEEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQVKGKENEGINLIKLDNGY 224

Query: 189 SRCCQLLSRGKGATTR-RSFVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWDGKQPGS 247
           +R  +  S+GKG +   +S++L +DL++ES YALAY+IG+++ NGD +Y+VHW+G     
Sbjct: 225 ARAIEGYSKGKGCSADGKSYLLYSDLSSESTYALAYLIGSIIKNGDMIYLVHWEGNNKKI 284

Query: 248 SKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXX 307
            ++ L  +V  +R+HVLH LD A               HPYPKH L+E+I+ L       
Sbjct: 285 PEKQLSDNVFRMRRHVLHLLDAASTIIDDAEIMMVSLTHPYPKHFLNELIHGLDISMLCC 344

Query: 308 XXXXXXXXXQNFVCSVPTLVIRKKLKR 334
                    QNFV S+P L++RKKLK+
Sbjct: 345 SLTMILSGLQNFVSSIPMLIVRKKLKK 371

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 44/99 (44%), Gaps = 25/99 (25%)

Query: 1  MSNQKSILLTVPDGTRTVLLDEPHRRHSLAEPGGVQFDSEQLERGRSRVKAARGIKXXXX 60
          MS  + ILLT P+GT T                 VQFDSEQ+E  R R K     K    
Sbjct: 1  MSQHRGILLTTPEGTGTA----------------VQFDSEQIENDRGRSKKRFKDKTNTS 44

Query: 61 XXXX---------XXXXXHVRNGEFLKWTVLKRDPSMRL 90
                             VR+ EFLKWTVL++DPSMRL
Sbjct: 45 RSATGGSSISRSRSRASSRVRDEEFLKWTVLRKDPSMRL 83

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score =  166 bits (420), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 135/441 (30%), Positives = 193/441 (43%), Gaps = 100/441 (22%)

Query: 1   MSNQKSILLTVPDGTRTVLLDEPHRRHSLA-------------------------EPGGV 35
           MSN+KSILLT P+G    +L+E       A                         E  GV
Sbjct: 1   MSNRKSILLTGPEGGTVDILNENETHSKDAANTKNSPIMELSNSAGDYFSAGANNESSGV 60

Query: 36  QFDSEQLE--RGRSRVKAAR------------GIKXXXXXXXXXXXXXHVRNGEFLKWTV 81
           +FDSEQ+E  RGR+R +  R                             VR+ EFLKWTV
Sbjct: 61  KFDSEQIENDRGRTRSRNNREDSSGTGNSFSYSSNNNSKSRSRSRASSMVRDEEFLKWTV 120

Query: 82  LKRDPSMRLHKKPHGNGI--GNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQ 139
           L++DPSMRL  +   +G    ++                             N+LEID+ 
Sbjct: 121 LRKDPSMRLKFRRANDGAHRDHSNEDLEDDDDEYFDEDDDEISDEEQVSDLENELEIDD- 179

Query: 140 MHYDMGTRVLPNYAASINEVLASTKSWISTYESQ------ETTQDVSFTKLPGGYSRCCQ 193
             +D+G +VLPNY  SINEVL  +K W S Y         +   +V   +L GG+ +  +
Sbjct: 180 FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNANVLINELEGGFVKAME 239

Query: 194 LLSRGKG--------------------------ATTRRS--------------------- 206
           L+S+                             A+T  +                     
Sbjct: 240 LISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNTNNTTSSSGSSDSGDS 299

Query: 207 FVLCTDLTTESHYALAYVIGALLNNGDTLYIVHWDGKQPGSS---KETLEQSVKSLRQHV 263
           F+L TDL++ES YAL YV+G L+ N DTLYIVHW+G    ++   K+ +  +++ +R++V
Sbjct: 300 FILYTDLSSESTYALTYVMGTLVKNNDTLYIVHWEGSTTSNNDAMKKKMTSNLQKIRENV 359

Query: 264 LHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQP--IAXXXXXXXXXXXXQNFVC 321
           ++  DC                HPYPKH L+EMIY L+P  +             QN+VC
Sbjct: 360 MYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEMIYGLKPKSLICSLNIMLSPSGLQNYVC 419

Query: 322 SVPTLVIRKKLKRSKRKGISD 342
           S+P LVIRKKLKR++R+GI +
Sbjct: 420 SIPVLVIRKKLKRTRRRGIDE 440

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  159 bits (401), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 133/294 (45%), Gaps = 27/294 (9%)

Query: 43  ERGRSRVKAARGIKXXXXXXXXXXXXXHVRN--GEFLKWTVLKRDPSMRLHKKPHGNGIG 100
           ERGRSR K  RG                +R   G +LKWTVL  DPS RL          
Sbjct: 36  ERGRSREK--RGSSSNNTAQNRSRTTSRIRGDMGSYLKWTVLHHDPSERLQLSAQDG--- 90

Query: 101 NNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVL 160
                                          N++ ID  + YD+G RVLPN+  S+ +VL
Sbjct: 91  -----------KDSSDDEEDVSDEEQVSDVDNEINIDAALGYDLGARVLPNFTNSLWDVL 139

Query: 161 ASTKSWISTYES--QETTQDVSFTKLPGGYSRCCQLLSRGKGATTR----RSFVLCTDLT 214
            + K WI+ Y     E   DV   +L GGY+R  Q++   K   T      S+++  DLT
Sbjct: 140 QTEKPWIAKYNETVDENNTDVKLDELQGGYARAIQVMHSAKSQKTELKPGASYIVYLDLT 199

Query: 215 TESHYALAYVIGALLNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXX 274
            ES YAL YV GA+L+  DTLY+VH   + P    + L  +V  LR    + LD +    
Sbjct: 200 PESFYALLYVFGAVLSPNDTLYVVHISPRVPS---DQLRSNVARLRAQTAYLLDASSAAL 256

Query: 275 XXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVI 328
                      HPYPKHLL+EM+ AL+P+A            QN+VC +PT+VI
Sbjct: 257 DSVSVVILSVSHPYPKHLLNEMVLALKPMALCVPLSLVLSVLQNYVCPIPTVVI 310

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  154 bits (388), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 136/292 (46%), Gaps = 23/292 (7%)

Query: 43  ERGRSRVKAARGIKXXXXXXXXXXXXXHVRNGEFLKWTVLKRDPSMRLHKKPHGNGIGNN 102
           ERGRSR K                       G +LKWTVL+ DPS RL     G   G  
Sbjct: 36  ERGRSREKKGSSANTAVQHRSRTSSRLRGDVGSYLKWTVLQHDPSERLLL---GTKEGAE 92

Query: 103 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDLEIDEQMHYDMGTRVLPNYAASINEVLAS 162
           A                            N+++ID  + YD+G RVLPN+ +S+ +V+ +
Sbjct: 93  ASDDDEDVSDEEQVSDVE-----------NEIDIDAALGYDLGARVLPNFTSSLWDVVQN 141

Query: 163 TKSWISTYESQETTQD--VSFTKLPGGYSRCCQLL----SRGKGATTRRSFVLCTDLTTE 216
            K W++ +      +D  V    L GGY+R  +++     +G  A   RS+++  DLT E
Sbjct: 142 QKPWVAKFNKSVEGKDSGVKLEDLQGGYARAIKIVHGKPQQGAEAREGRSYIIYLDLTPE 201

Query: 217 SHYALAYVIGALLNNGDTLYIVHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXX 276
           S YAL YV GA+L + DTLY+VH   + P    E L  +V+ L     + LD +      
Sbjct: 202 SFYALLYVFGAVLASNDTLYVVHISQRVP---NEQLRANVERLEAEAAYLLDASSAALNA 258

Query: 277 XXXXXXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVI 328
                    HPYPKHLL+E++ AL+P+A            QN+VC +PT+VI
Sbjct: 259 VNVVLLSVSHPYPKHLLNELVIALKPMALCVPLSLVLSSLQNYVCPIPTVVI 310

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  127 bits (319), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 104/343 (30%), Positives = 151/343 (44%), Gaps = 30/343 (8%)

Query: 26  RHSLAEPGGVQFDSEQLE-RGRSRVKAARGIKXXXXXXXXXXXXXHVRNGEFLKWTVLKR 84
           +H  A P       E+ E RGRSR K                    +++  +LKWT+L +
Sbjct: 17  KHLAAPPAFPTIKIEEPEQRGRSRSKTRDTGISSSRSISRSASRVSIKDQAYLKWTILNK 76

Query: 85  DPSMRLHKK-----------PHGNGIGNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXND 133
           DPS RLH K           P     G+                              N+
Sbjct: 77  DPSERLHLKAKKGNTRDSVSPGQENGGDEDEDEDEEEFIEDREDDGEVSEEEQVSDVENE 136

Query: 134 LEIDEQMHYDMGTRVLPNYAASINEVLASTKSWIS---TYESQETTQDVSFTKLPGGYSR 190
           +EIDE + YD+G +VLPN+   I +VL S K W++     +++   +D+   ++  G  R
Sbjct: 137 IEIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHR 196

Query: 191 CCQLLSRGK---GATTRR--SFVLCTDLTTESH----YALAYVIGALLNNGDTLYIVHWD 241
               +S+G     AT+ +  SFV+  D   ES     YAL Y  G++  NGDTLYI++  
Sbjct: 197 AVYHMSKGDNITAATSEKGHSFVVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIIN-- 254

Query: 242 GKQPGSSKETLEQSVKSLRQHVLHKLDC--AXXXXXXXXXXXXXXXHPYPKHLLSEMIYA 299
             Q       +   +  +  H+ +  +C                  HPYPK LL+EM ++
Sbjct: 255 --QCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHS 312

Query: 300 LQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
           LQP +            QNF+ SVP LVIRKKLKRSKR+GI+D
Sbjct: 313 LQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  115 bits (287), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 120/275 (43%), Gaps = 31/275 (11%)

Query: 75  EFLKWTVLKRDPSMRLHKKPHGNGIGNNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDL 134
           EFL+WT+L+ DPS RLH                                        ND 
Sbjct: 90  EFLRWTILRADPSERLH-----------------LGAVEDEEDDDELSDEEQLSDVENDY 132

Query: 135 EIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTYESQETTQDVSFTKLPGGYSRCCQL 194
           ++D ++ YD+G RVLPN+AASI +VL    +W++ Y + +         L    +R  + 
Sbjct: 133 DVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYRASQPAGAARVDVLQDTCTRAVRH 192

Query: 195 LSRGKGA---TTRRSFVLCTDL---TTESHYALAYVIGALLNNGDTLYI-VHWDGKQPGS 247
            +R  GA     +       DL     E  YAL Y  GA+L N DTLYI V  D      
Sbjct: 193 FARHSGAPGPAGKTFLAYLEDLNVSAAEKLYALTYTFGAVLANHDTLYIFVLCDAVD--- 249

Query: 248 SKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXXXXXXXHPYPKHLLSEMIYALQPIAXXX 307
               +E  +  + + V   LDC+               H YP+HLL+E I+A +P     
Sbjct: 250 ----VESHLNRVAEQVAFLLDCSAAALDDLDVVVLALQHAYPRHLLTETIHAFRPAGLIV 305

Query: 308 XXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGISD 342
                      +V SVPTL++RKKLKR++R+GI D
Sbjct: 306 PLQIATRSLAGYVSSVPTLIVRKKLKRARRRGIFD 340

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  107 bits (267), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 143/362 (39%), Gaps = 55/362 (15%)

Query: 28  SLAEPGGVQFDSEQ--LERGRSRVKAARGIKXXXXXXXX----XXXXXHVRNGEFLKWTV 81
           S+  P GV    E+   +RGRSR K +                      +   E L+WT+
Sbjct: 69  SMTSPMGVTIKIEEPPEQRGRSRNKQSDATSSFSTSRSRTKLRSLSRVSIAEHELLRWTI 128

Query: 82  LKRDPSMRLHKKPHGNGIG--------NNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXND 133
           L+ DPS RLH+  H                                            ND
Sbjct: 129 LRHDPSERLHRDSHAGTAARFGDISPQTTTVVPAGAAAGIAEDIEDVLSDEEQISDVEND 188

Query: 134 LEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTY----ESQETTQDVSFTKLPGGYS 189
            E+D  + YD+G RVLPN+A SI + L S  +W++ Y    + Q+  + V    L     
Sbjct: 189 YEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLEN-CK 247

Query: 190 RCCQLLSR--------------------GKGAT----TRRSFVL-CTDLTT---ESHYAL 221
           R  Q +++                    G  A      +++F+L   DL T   E  YAL
Sbjct: 248 RAIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNTSHSEKLYAL 307

Query: 222 AYVIGALLNNGDTLYIV-HWDGKQPGSSKETLEQSVKSLRQHVLHKLDCAXXXXXXXXXX 280
            Y  GA+L N DTLYIV   D          +E  +  +R+ V   LD            
Sbjct: 308 TYTFGAVLANRDTLYIVVQCDAAD-------VEAHLVKVREQVAFLLDATSAALDHLDII 360

Query: 281 XXXXXHPYPKHLLSEMIYALQPIAXXXXXXXXXXXXQNFVCSVPTLVIRKKLKRSKRKGI 340
                HPYP+HLL+E+  A QP A              +V  VPTLV+RKKLKRS+RKGI
Sbjct: 361 ILTLHHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTLVVRKKLKRSRRKGI 420

Query: 341 SD 342
            D
Sbjct: 421 YD 422

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,289,913
Number of extensions: 909728
Number of successful extensions: 1851
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1818
Number of HSP's successfully gapped: 45
Length of query: 342
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 232
Effective length of database: 40,868,139
Effective search space: 9481408248
Effective search space used: 9481408248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)