Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16478g5.709ON39139121230.0
TDEL0B021105.709ON38938511741e-160
NCAS0G002005.709ON43840311321e-153
Kpol_2001.775.709ON41340111131e-150
NDAI0F002405.709ON46432510611e-142
YIL153W (RRD1)5.709ON39335210371e-139
TPHA0D046505.709ON42138910311e-138
SAKL0E15070g5.709ON38537110181e-136
Suva_9.355.709ON39333010131e-135
Skud_9.155.709ON40233710111e-135
Smik_9.165.709ON39331510101e-135
KLTH0E00880g5.709ON3713919881e-132
Kwal_55.196615.709ON3713159741e-130
Ecym_40125.709ON3953849531e-126
TBLA0E016905.709ON4883549561e-125
CAGL0H06655g5.709ON4244009451e-125
AFR293C5.709ON3653189211e-122
KAFR0D021905.709ON4263819111e-120
KLLA0A00462g5.709ON3533558741e-115
KNAG0L021705.709ON3963888241e-107
ACR139C8.674ON3593524142e-46
Kpol_1013.48.674ON3582984082e-45
YPL152W (RRD2)8.674ON3583194046e-45
NDAI0E024108.674ON3592964046e-45
Ecym_23998.674ON3513064021e-44
Smik_6.3498.674ON3583193951e-43
CAGL0M02255g8.674ON3582953942e-43
Skud_16.1308.674ON3582543933e-43
TPHA0D012408.674ON3592823908e-43
SAKL0H06622g8.674ON3552963881e-42
ZYRO0F07326g8.674ON3522413862e-42
NCAS0C016908.674ON3593003853e-42
KLTH0D11176g8.674ON3532613829e-42
KAFR0H024408.674ON3533083802e-41
Suva_16.1588.674ON3583193792e-41
Kwal_26.87838.674ON3553003793e-41
KLLA0F11187g8.674ON3602883723e-40
KNAG0J016908.674ON3632983706e-40
TDEL0A062008.674ON3552323628e-39
TBLA0C018608.674ON3563623495e-37
KLLA0A10373gna 1ON20641750.59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16478g
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   822   0.0  
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   456   e-160
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      440   e-153
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   433   e-150
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      413   e-142
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   404   e-139
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   401   e-138
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   396   e-136
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   394   e-135
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   394   e-135
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   393   e-135
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   385   e-132
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   379   e-130
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   371   e-126
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   372   e-125
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   368   e-125
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   359   e-122
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   355   e-120
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   341   e-115
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   322   e-107
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   164   2e-46
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   161   2e-45
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   160   6e-45
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   160   6e-45
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   159   1e-44
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   156   1e-43
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   156   2e-43
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   155   3e-43
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   154   8e-43
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   154   1e-42
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   153   2e-42
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   152   3e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   151   9e-42
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   150   2e-41
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   150   2e-41
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   150   3e-41
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   147   3e-40
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   147   6e-40
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   144   8e-39
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   139   5e-37
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    33   0.59 

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/391 (100%), Positives = 391/391 (100%)

Query: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS 60
           MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS
Sbjct: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS 60

Query: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCI 120
           VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCI
Sbjct: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCI 120

Query: 121 VELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVV 180
           VELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVV
Sbjct: 121 VELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVV 180

Query: 181 RKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHL 240
           RKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHL
Sbjct: 181 RKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHL 240

Query: 241 NLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHF 300
           NLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHF
Sbjct: 241 NLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHF 300

Query: 301 WFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAA 360
           WFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAA
Sbjct: 301 WFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAA 360

Query: 361 SEARAPPARTRMGPPTARTTNSTAHHDLTKR 391
           SEARAPPARTRMGPPTARTTNSTAHHDLTKR
Sbjct: 361 SEARAPPARTRMGPPTARTTNSTAHHDLTKR 391

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/385 (56%), Positives = 278/385 (72%), Gaps = 11/385 (2%)

Query: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67
            T+F +PVK IFDSQ   +FQ SVAI RLKY ++KYA++I+   I   PS I VVN  V 
Sbjct: 11  QTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEVVNRVVS 70

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           +L+ +S LVD+TPP  GPRRYGNLACRDWH K+D  +  L ++VLP  +H CI EL +YL
Sbjct: 71  LLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELSYYL 130

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GNSFGS+TRLDYGTGHELSFLAV+GA+DMLGL+T EF G+D LL+ + YY +VRKLILTY
Sbjct: 131 GNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYKLVRKLILTY 190

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247
           TLEPAGSHGVWGLDDHFH+ Y+ GS+QW++    P+ PRD+ N  LVQ+YA  NLYCQ I
Sbjct: 191 TLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLYCQAI 250

Query: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307
            FI+ VK GPF EHSSMLYD+A+TV TW+K++SGL+KMY VEVL KFPVVQHFWFG GFY
Sbjct: 251 DFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFGPGFY 310

Query: 308 PWVDNQTGKQLLIYDPADADRR---NTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEAR 364
           PW+ ++ G++L IY+ A+++++   + ++              P+PH         S+  
Sbjct: 311 PWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPIPH------GKLSQVH 364

Query: 365 APPARTRMGPPTA--RTTNSTAHHD 387
             P R  M PPT+  RT N +A  +
Sbjct: 365 KLPTRGTMQPPTSLPRTFNRSAKKE 389

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  440 bits (1132), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 221/403 (54%), Positives = 280/403 (69%), Gaps = 23/403 (5%)

Query: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIP-QGP-SR 58
           M +L  + TQF+ P KRIFDSQ T +FQ+S+A+ RL++F+QKY  ++  V  P +G  S 
Sbjct: 30  MAVLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSS 89

Query: 59  ISVVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVL------ 112
           +++VN  V +LNH+S L+D+TPPL GPRRYGNLACRDWH K++ Q+P+L  ++L      
Sbjct: 90  VTLVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPK 149

Query: 113 ----PDRFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGED 168
                   H CI EL +Y+ N+FGS+TRLD+GTGHELSF+A + AIDMLGL+TD  QG D
Sbjct: 150 VSGESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTD 209

Query: 169 FLLIMNAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDI 228
            LL+ N YYA+VRKLILTYTLEPAGSHGVWGLDDHFHLAY+ GS+QW   + AP+RPRD+
Sbjct: 210 ILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDV 267

Query: 229 LNHHLVQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAV 288
            +  LV++YA  NLYCQ I FI+QVK GPF EHS +LYD+AT+V TW+K++ GL+KMY  
Sbjct: 268 KDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMD 327

Query: 289 EVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYD--PADADRRNTSSTGGKYAAFVSSIN 346
           EVL KFPVVQHFWFG GFYPW++  TGK L IY+  P D D         +YA      N
Sbjct: 328 EVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPED-DETEQEREIQQYAPHWHKEN 386

Query: 347 SPVPHFPAPSTTAASEARAPPARTRMGPPTARTTNSTAHHDLT 389
           + V     P  TA         RT M PP++R  NS   HD T
Sbjct: 387 AHV-RTAKPGITAMPSVTN--TRTNMAPPSSRMMNS---HDPT 423

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  433 bits (1113), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 271/401 (67%), Gaps = 24/401 (5%)

Query: 3   MLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGP--SRIS 60
           +L  E  +F  PVKRI+DSQ T  FQ+SVAI RLKYFI KY K++  V+IP     S I 
Sbjct: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP 66

Query: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPD------ 114
            VN+ V +++ +SLLVD+TPP  GPRR+GNL+CR+WH K+D  + SL  K+L D      
Sbjct: 67  TVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNIS 126

Query: 115 -RFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIM 173
            +    +VEL +YLGNSFGS+TRLDYGTGHELSF+AV+  IDMLGL+T+  +G D L+I 
Sbjct: 127 SKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIF 186

Query: 174 NAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHL 233
           N YY +++KLILTYTLEPAGSHGVWGLDDHFH AY+ GSAQW+     PL+P DI+N  L
Sbjct: 187 NEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDL 246

Query: 234 VQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNK 293
           V EYA+ N+YC  I FI  VK GPF EHS MLYD++ +VH W+K+ESGL+KMY VEVLNK
Sbjct: 247 VCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNK 306

Query: 294 FPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKY---AAFVSSINSPVP 350
           FPVVQHFWFGTG +PW+DN T K L +Y   + D + T+S   K    +    S      
Sbjct: 307 FPVVQHFWFGTGLFPWIDNNTKKSLPLY---ENDAKKTTSIHTKSPSPSPLGISTRRDFS 363

Query: 351 HFPAPSTTAASEARAP--------PAR-TRMGPPTARTTNS 382
            F +P+       R P        P R + MGPP+  + NS
Sbjct: 364 KFTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNS 404

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  413 bits (1061), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 249/325 (76%), Gaps = 8/325 (2%)

Query: 3   MLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGP----SR 58
           +L  + T F+ PVKRIFDSQ T +FQ+S+A+ RL++F+Q+Y +++  V IP  P    S 
Sbjct: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72

Query: 59  ISVVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPD-RFH 117
           I +VN  + +LN +S +V  TPPL+GPRRYGNLACRDWH+KI+ ++P L  K +P     
Sbjct: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQ 132

Query: 118 HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYY 177
             I+EL +Y+ NSFGS+TRLDYGTGHELSF+A + A+DMLGLF D   G+D L++ NAYY
Sbjct: 133 PSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-LTGKDLLIMFNAYY 191

Query: 178 AVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEY 237
           ++VR+LILTYTLEPAGSHGVWGLDDHFHLAY+ GS+QW N   APL P++I N  LV++Y
Sbjct: 192 SLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDY 249

Query: 238 AHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVV 297
           +  NLYCQ I F+  VK GPF EHS +LYD++T+V  W K++ GL+KMY  EVLNKFPVV
Sbjct: 250 STKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVV 309

Query: 298 QHFWFGTGFYPWVDNQTGKQLLIYD 322
           QHFWFGTGFYPW++ QT ++L +Y+
Sbjct: 310 QHFWFGTGFYPWINFQTLRELPVYE 334

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  404 bits (1037), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 257/352 (73%), Gaps = 10/352 (2%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQ---GPSRISVVNEFVG 67
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +I+  + P      S I++VN  +G
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE++P   +++LP  +H  + EL +YL
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYL 132

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GNSFGS+TRLDYGTGHELSF+A V A+DMLG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 133 GNSFGSSTRLDYGTGHELSFMATVAALDMLGMFP-HMRGADVFLLFNKYYTIMRRLILTY 191

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PR+IL+  LV+EY   N YCQ 
Sbjct: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFYCQG 251

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 252 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 311

Query: 307 YPWVDNQTGKQLLIY---DPADADRRNTSSTGGKYAA--FVSSINSPVPHFP 353
           +PWV+ Q G  L ++   +    ++ N  S G +  +  F +S + P P  P
Sbjct: 312 FPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMPPPGVP 363

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  401 bits (1031), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/389 (50%), Positives = 257/389 (66%), Gaps = 22/389 (5%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGP--SRISVVNEFVGV 68
           F+ P+KRI+DSQ T  FQ+S+AI RLKY++ KY  +++ V IP     S I++VNE   +
Sbjct: 14  FSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITIVNEMSSL 73

Query: 69  LNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLP-----------DRFH 117
           L  +S  +D  PP EGPRRYGNLACR+WH+ ID ++P L  KVL            ++  
Sbjct: 74  LTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEKGEFEKLK 133

Query: 118 HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYY 177
            CI+EL +YL NS GSATRLDYGTGHELSFLAV+ A+DMLGL+T+ F+G D L + + YY
Sbjct: 134 GCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYY 193

Query: 178 AVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEY 237
            +V+KLI+TYTLEPAGSHGVWGLDDHFHL+Y+ GS+Q +     P  P DI+N  +V EY
Sbjct: 194 ELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIINKKIVTEY 253

Query: 238 AHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVV 297
            H N YC TI FIY+VK GPF EHS +LYD++TTV++W K+ SGL+KMY VEVLNKFPVV
Sbjct: 254 MHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEVLNKFPVV 313

Query: 298 QHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSIN---------SP 348
           QHFWFG GFYPW + +T K L +Y        N  ++    +   +++N         S 
Sbjct: 314 QHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNKDRSVNQNPSQ 373

Query: 349 VPHFPAPSTTAASEARAPPARTRMGPPTA 377
           +   P    TA         R  MGPP++
Sbjct: 374 LNRIPQNRYTAIPVNNRDLRRPPMGPPSS 402

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  396 bits (1018), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 195/371 (52%), Positives = 250/371 (67%), Gaps = 19/371 (5%)

Query: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66
            +T+F  PVK+IFD+Q T +FQ+SV + RL+ ++ KY  ++   NIP   S    VN F 
Sbjct: 13  SHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPST-SNNDAVNRFT 71

Query: 67  GVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHY 126
            +++ +S  +D+TPPL GPRR+GN ACR WH K+   + +L +  +P+++H CIVE+ +Y
Sbjct: 72  QIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYY 131

Query: 127 LGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILT 186
           LGN+FGS  RLDYGTGHELSFLAVV AIDML L+     GED L + N YY +V+KLI T
Sbjct: 132 LGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLIAT 191

Query: 187 YTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQT 246
           YTLEPAGSHGVWGLDDHFHLAY+ GS+Q A     PLRP DIL+ H V++YA  NLY Q 
Sbjct: 192 YTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQA 251

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI +VK G F EHS MLYD+A TV TW+K++ GL+KMY+ EVLNKFPVVQHFWFGTGF
Sbjct: 252 IAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTGF 311

Query: 307 YPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSI-NSPVPHFPAPSTTAASEARA 365
           +PWV+ ++G  L  Y+    +  + SS        V+SI N P         TA      
Sbjct: 312 FPWVNVKSGAILPTYEANQEENPHFSS--------VTSISNMP---------TATKSVLP 354

Query: 366 PPARTRMGPPT 376
             + T M PPT
Sbjct: 355 ATSSTTMPPPT 365

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  394 bits (1013), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/330 (56%), Positives = 242/330 (73%), Gaps = 8/330 (2%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQ---GPSRISVVNEFVG 67
           F+TPVKRIFD+Q T +FQ+S+AI R+KY + KY  +++    P      S I +VN  + 
Sbjct: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           VL+  + L+D TPPL GPRRYGNLACR+WH K+D  +    R+VLP ++H  + EL +YL
Sbjct: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYYL 132

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GNSFGS+TRLDYGTGHELSF+A V A+D+LGLF    +G D  L+ + YYA++R+LILTY
Sbjct: 133 GNSFGSSTRLDYGTGHELSFMATVAALDLLGLFP-HLRGTDVFLLFSKYYAIMRRLILTY 191

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PRD+L+  LV+EY   N YCQ 
Sbjct: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYCQG 251

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI QVK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 252 INFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGTGF 311

Query: 307 YPWVDNQTGKQLLIYDPADA---DRRNTSS 333
           +PW++ Q G  L +++  +    D+ N +S
Sbjct: 312 FPWINVQNGTDLPVFEEKEEESIDQANATS 341

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  394 bits (1011), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 185/337 (54%), Positives = 247/337 (73%), Gaps = 8/337 (2%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQG---PSRISVVNEFVG 67
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +++    P      S I++VN  +G
Sbjct: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE +    +++LP  +H  + EL +YL
Sbjct: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVPELQYYL 141

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GNSFGS+TRLDYGTGHELSF+A V A+D+LG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 142 GNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRGNDVFLLFNKYYTIMRRLILTY 200

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW      APL+PR++L+  LV +Y   N YCQ 
Sbjct: 201 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFYCQG 260

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 261 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 320

Query: 307 YPWVDNQTGKQLLIYDPAD---ADRRNTSSTGGKYAA 340
           +PWV+ Q G  L +++  +    ++ N +S G  + +
Sbjct: 321 FPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTS 357

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/315 (58%), Positives = 239/315 (75%), Gaps = 5/315 (1%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQG---PSRISVVNEFVG 67
           F+TPVKRIFD+Q TL+FQ+S+AI R+KY + KY  +++    P      S I + N  + 
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           VL+ ++ L+D+TPPL GPRRYGNLACR+WH K+DE++P   R++LP  +H  + EL +YL
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQYYL 132

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GNSFGS+TRLDYGTGHELSF+A V A+D+LG+F    +G D  L+ N YY ++R+LILTY
Sbjct: 133 GNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP-HLRGTDVFLLFNKYYTIMRRLILTY 191

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYK-EAPLRPRDILNHHLVQEYAHLNLYCQT 246
           TLEPAGSHGVWGLDDHFHL Y+ GS+QW     +APL+PR+IL+  LV+EY + N YCQ 
Sbjct: 192 TLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFYCQG 251

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI +VK GPF EHS +LYD+A TV  W+K+  GL+KMY+VEVL KFPVVQHFWFGTGF
Sbjct: 252 INFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGTGF 311

Query: 307 YPWVDNQTGKQLLIY 321
           +PWV+ Q G  L ++
Sbjct: 312 FPWVNIQNGTNLPVF 326

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/391 (48%), Positives = 247/391 (63%), Gaps = 23/391 (5%)

Query: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS 60
           +  +   +  F  P KRIFDS+ +  FQ+SVA+ RLK ++ KY   ++ V IP+  S   
Sbjct: 3   LERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE-TSTNH 61

Query: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCI 120
            V  F  +L  +S LVD TP L GPRRYGNLACR WH K+DE + +L  K LP+  H  I
Sbjct: 62  EVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSI 121

Query: 121 VELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVV 180
           VEL +YLGN+FGS  RLDYGTGHELSF A + A+DMLG++  +FQ  D L + + YYA+V
Sbjct: 122 VELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALV 181

Query: 181 RKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHL 240
           RKL+LTYTLEPAGSHGVWGLDDHFHL Y+FG++QW + K AP+ PR++ +  +V EY   
Sbjct: 182 RKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKT 241

Query: 241 NLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHF 300
           N YCQ I FI+QVK GPF EHS ML+D++ +V TW+K++ GL+KMY  EVLNKFPVVQHF
Sbjct: 242 NFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHF 301

Query: 301 WFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAA 360
           WFGTG +PW     G  L  Y+ +   +                    + H  AP+ T  
Sbjct: 302 WFGTGLFPWTSLGDGYALPTYEASQEAQGQV-----------------LQHTTAPAPTNL 344

Query: 361 SEARAPPARTRMGPPTARTTNSTAHHDLTKR 391
           +      AR +M PP  R  N     D  +R
Sbjct: 345 NS-----ARRQMNPPNLRGINRLTSQDRFRR 370

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  379 bits (974), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/315 (55%), Positives = 230/315 (73%), Gaps = 1/315 (0%)

Query: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67
            T F  PVKRIFDS+ T  FQ+SVA++RLK  + KY  +++   IP   S  +V++    
Sbjct: 10  TTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS-LRK 68

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYL 127
           +L+  S LVD+TP L GPRRYGNLACRDWH K++EQ+    ++ LP++++  IVEL +YL
Sbjct: 69  ILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELAYYL 128

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           GN+FGS  RLDYGTGHELSF +V+ A+DMLG++   FQ +D L + N YY++VRKLI  Y
Sbjct: 129 GNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLITKY 188

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247
           +LEPAGSHGVWGLDDHFHL Y+FG++QWA+ K+A   PR+I +  +V EYA  N YCQ I
Sbjct: 189 SLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFYCQAI 248

Query: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307
            FI++VK GPF EHS MLYD++ +V TW+K++ GL+KMY  EVLNKFPVVQHFWFGT  +
Sbjct: 249 SFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTALF 308

Query: 308 PWVDNQTGKQLLIYD 322
           PW     G  L  Y+
Sbjct: 309 PWTSTDGGDVLPTYE 323

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  371 bits (953), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 250/384 (65%), Gaps = 23/384 (5%)

Query: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67
            T+F+ PVKRIFDS  T +FQ S+ + RL+  +++Y  +++   +P+  +  SV + FV 
Sbjct: 7   KTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV-SSFVS 65

Query: 68  V-LNHMSLLVDQTPPLEG-PRRYGNLACRDWHAKIDEQMPSLWRKVLPDR----FHHCIV 121
           + L+    L+D+TPP    PRR+GN+ACRDWHAK+ E+M SLWR+ LP      + +CI+
Sbjct: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125

Query: 122 ELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLF-TDE----FQGEDFLLIMNAY 176
           EL +YLGN+FGS  RLDYGTGHELSFLAVV A+DMLGL+ T E      G D L + N Y
Sbjct: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185

Query: 177 YAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKE-APLRPRDILNHHLVQ 235
           Y++V KLILTYTLEPAGSHGVWGLDDH HLAY+ G++QW++  + AP++  DIL+   + 
Sbjct: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLY 245

Query: 236 EYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFP 295
           +Y   NLYC +I F+ +VK GPF +HS MLYD++ TV TW+K  SGL+KMY VEVLNKFP
Sbjct: 246 QYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFP 305

Query: 296 VVQHFWFGTGFYPWVDNQTGKQLLIYD----------PADADRRNTSSTGGKYAAFVSSI 345
           VVQHFWFGTGF+PWVD + G  L  Y+            D D    S+T    A   S  
Sbjct: 306 VVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGSSGK 365

Query: 346 NSPVPHFPAPSTTAASEARAPPAR 369
            +     P P  T       P  R
Sbjct: 366 LTTSAAMPPPRMTTGYSHHTPSGR 389

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  372 bits (956), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/354 (52%), Positives = 239/354 (67%), Gaps = 26/354 (7%)

Query: 6   NENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEF 65
           + N  F+ P K+IFDSQ T  F  S+A  R++YFI KY ++I   NIP  P+  +  N+ 
Sbjct: 10  DSNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIP--PTDYTSSNDT 67

Query: 66  VG----VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLP---DRFH- 117
           +     ++N +  LV++TPPL GPRRYGNL+CR WH ++D+ +  L+ K L     +F+ 
Sbjct: 68  ISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNK 127

Query: 118 -HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAY 176
               +EL++Y   S GS TRLDYGTGHELSFLA +GA+DML L TD   G D L I N Y
Sbjct: 128 DQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEY 186

Query: 177 YAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQW----ANYKE---------APL 223
           Y ++RKLIL YTLEPAGSHGVWGLDDHFHL Y+FGS+QW    A+  E         AP+
Sbjct: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246

Query: 224 RPRDILNHHLVQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLM 283
           +P DILN +L++++   N YCQ+I FI  VK GPF EHS +L+D+A  VH W K+ SGL+
Sbjct: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306

Query: 284 KMYAVEVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGK 337
           KMY VEVLNKFPVVQHFWFGTGFYPW+++ T  +L  Y+ A  D  NT+ T  K
Sbjct: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELA-PDDNNTTYTINK 359

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  368 bits (945), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/400 (48%), Positives = 253/400 (63%), Gaps = 37/400 (9%)

Query: 11  FNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVGVLN 70
           F+ PVKRI+DSQ    FQ+S AI RL+  I KY  ++   ++        VV   V VL+
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD-LELSGVVGGVVKVLD 60

Query: 71  HMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFH---HCIVELVHYL 127
            +  LV +TPP+ GPRRYGN+ACRDWH KI+ ++P L   ++   F     C+VEL +YL
Sbjct: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120

Query: 128 GNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
            NSFGSATRLD+GTGHELSFLA V A+DMLG     F G+  L I + YY++V +LIL+Y
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA---SFDGDQVLYIFDRYYSLVHRLILSY 177

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247
           TLEPAGSHGVWGLDDHFHLAY+ GS+QW N K+  + P D+ +  LV++Y+  N++C+T+
Sbjct: 178 TLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTL 237

Query: 248 GFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFY 307
            F++ VK G FREHS ML+D++ +V TWAK+  GL KMY  EVLNKFPV+QHFWFGTGFY
Sbjct: 238 NFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFY 297

Query: 308 PWVDNQTGKQLLIYDPA-DADRRNTSSTGGK---------YAAFVSSINSPV---PHFPA 354
           PWVD + GK L  Y+ + D D  N   T  +          + F+S  N      P  P 
Sbjct: 298 PWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGTRVVESRFLSPGNETFVRRPQLPQ 357

Query: 355 PS-----------------TTAASEARAPPARTRMGPPTA 377
            S                 TT ++ + A P + RMGPPT+
Sbjct: 358 DSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRMGPPTS 397

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  359 bits (921), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 227/318 (71%), Gaps = 3/318 (0%)

Query: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66
           E TQF+ PVKRIFD+  T +FQ S+ + RL+  +++Y K++    IP+     +VV  FV
Sbjct: 6   EGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVR-FV 64

Query: 67  GVLNHMSLLVDQTPPLEGP-RRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVH 125
            +L  +  L+D+TPP  G  RR+G+LACRDWH ++  ++  L   +LP+       EL +
Sbjct: 65  CILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRY 124

Query: 126 YLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFT-DEFQGEDFLLIMNAYYAVVRKLI 184
           YLG++FGS  RLDYGTGHEL+FLAVV A+DMLGL+T D+F GED L +   YYA+V +LI
Sbjct: 125 YLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLI 184

Query: 185 LTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYC 244
           LTY LEPAGSHGVWGLDDH HLAY+ G++QWA  +  P++P DIL+   V  Y+  NLYC
Sbjct: 185 LTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYC 244

Query: 245 QTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGT 304
            +I F+ +VK G F +HS ML+D+A TV TW+K+ +GL+KMY VEVLNKFPVVQHFWFGT
Sbjct: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304

Query: 305 GFYPWVDNQTGKQLLIYD 322
           GF+PWVD   G  L  Y+
Sbjct: 305 GFFPWVDMAHGMSLPNYE 322

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  355 bits (911), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 245/381 (64%), Gaps = 24/381 (6%)

Query: 9   TQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV-G 67
           ++F+ P KRIFDSQ T  FQ SVA  RLKYF  KY  ++  V +P   +    +  ++  
Sbjct: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILD 74

Query: 68  VLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRF-----HHCIVE 122
           +L+  S  +D+TPPL  PRR+GNL+CR WH KI+  +P   + ++ D F      +   E
Sbjct: 75  LLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTII-DNFSTIENENMFNE 133

Query: 123 LVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRK 182
           L +YL NSFGS TRLDYGTGHELSFLA +  IDM+ +  D    +DFLLI  +YY + RK
Sbjct: 134 LNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD-MTADDFLLIWQSYYNLTRK 192

Query: 183 LILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNL 242
           LILTYTLEPAGSHGVWGLDDHFHLAY+FGS+Q  +   + L P+DIL   +V E+   NL
Sbjct: 193 LILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLIS-DISHLAPKDILKKDVVAEHKENNL 251

Query: 243 YCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWF 302
           YCQ I FI+ VK+GPF EHS +LYD++  V +W+K+  GL+KMY  EVLNKFPVVQHFWF
Sbjct: 252 YCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWF 311

Query: 303 GTGFYPWVDNQTGKQLLIYDPADADRRNTS------STGGKYAAF--VSSINSPV--PHF 352
           G GF+PW DN +GK L +++ ++ +  N +      S+    A+F    S  SP+  P++
Sbjct: 312 GDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIMNPNY 371

Query: 353 PA-----PSTTAASEARAPPA 368
                  PS +  S    PP+
Sbjct: 372 KMSMHRPPSLSKNSREMKPPS 392

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/355 (47%), Positives = 232/355 (65%), Gaps = 13/355 (3%)

Query: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66
           EN +F+ P KRIFDSQ TL+FQ SVA+VR++Y +QKY  +     IP         N  V
Sbjct: 6   ENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNIVV 65

Query: 67  GVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHY 126
            +L  +S L+D+TPP     RYGNL+ RDW  K   Q+ +   ++LP+++++ I+EL +Y
Sbjct: 66  ELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELSYY 125

Query: 127 LGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILT 186
           + N+FGS  R+DYGTGHELSFLAV+  +DML + T   +G   L   N+YY V++KLILT
Sbjct: 126 ISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET--IKGPALLYCFNSYYDVIQKLILT 183

Query: 187 YTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQT 246
           Y LEPAGSHGVWGLDDHFH +Y+ G+ Q  +   + L P+DI N  L+++ +  NL+C++
Sbjct: 184 YKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTS-LIPKDISNTRLMEQNSSSNLFCKS 242

Query: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306
           I FI  VK GPF  HS +LY+++ +VHTW K++ GL+KMY VEVLNKFPVVQHFWFGT F
Sbjct: 243 IRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGTAF 302

Query: 307 YPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAAS 361
           +PW        L IY PA+ +           A F+++ N+     P P +T+ S
Sbjct: 303 FPWTSYGNNHSLPIYQPAENNDD---------ADFLTA-NNATTKMPPPLSTSTS 347

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 235/388 (60%), Gaps = 23/388 (5%)

Query: 4   LTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVN 63
           L  E+  F  P KRIFDSQ T  FQ SVA+ R+++ I+KY +++ R +   G S  + V 
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM-RGDTSGGIS--ASVA 72

Query: 64  EFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVEL 123
             + +L+ +  LVD+TPPL GPRRYGNLACRDWH K+D  +P L  +V         +E 
Sbjct: 73  RMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEA 132

Query: 124 VHYLGNSFGSATRLDYGTGHELSFLAVVGAIDML----GLFTDEFQGEDFLLIMNAYYAV 179
            +YL NSFGS  RLDYGTGHELSFLA V A+DM+    G+   E        + + YY +
Sbjct: 133 EYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELS-----RLWDRYYRL 187

Query: 180 VRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLV-QEYA 238
           VR+LI+ Y LEPAGSHGVWGLDDHFHLAY++G++Q+AN     ++PRD+L+  +  ++ A
Sbjct: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFAN-NPVGVQPRDVLSGVIPGRDDA 246

Query: 239 HLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQ 298
             N   + IGF+  VK GPF E+S ML D+ + V +W K++ GL +MY  EVLNKFPVVQ
Sbjct: 247 PANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306

Query: 299 HFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTT 358
           HFWFGT F+PW   + G  L +Y+ +    + T  +G       +++         P+  
Sbjct: 307 HFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTL---------PALD 357

Query: 359 AASEARAPPARTRMGPPTARTTNSTAHH 386
            ++ A  P  R  MGPP  R  N    H
Sbjct: 358 TSTMASVPSRRPAMGPPAGRQVNKFIQH 385

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 171/352 (48%), Gaps = 20/352 (5%)

Query: 16  KRIFDSQCTLEFQASVAIVRLKYFIQKYAKII-NRVNIPQGPSRISVVNEFVGVLNHMSL 74
           KR+       +++AS     L  F+   A+ +  R N          +     +L  M  
Sbjct: 13  KRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSPAIEALEALLEEMQG 72

Query: 75  LVDQTPPLE--GPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNSFG 132
           +    P L+     R+G +  RD+H ++  +  +L  +V P        EL  YLGN++G
Sbjct: 73  IAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQELAVYLGNAWG 132

Query: 133 SATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTYTLEPA 192
              R+DYG+GHEL+F+  +  +   G+ ++       L +   Y  V+R L   Y LEPA
Sbjct: 133 DCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAVLRVFVKYMDVMRVLETKYWLEPA 192

Query: 193 GSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGFIYQ 252
           GSHGVWGLDD+  L ++FG+ Q A +K   L+P+ I N  +V+ + +  LY   I FI +
Sbjct: 193 GSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPKSIHNPEVVELFENRYLYFGCIAFINR 250

Query: 253 VK-RGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYPWVD 311
           VK     R HS ML D+ + V +W K+  G++KMY  EVL K P++QHF+F + F P  D
Sbjct: 251 VKTTASLRWHSPMLDDI-SGVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF-SRFLPVPD 308

Query: 312 NQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEA 363
             +  +    + AD      S+ G                 P PS  AASEA
Sbjct: 309 GVSPPRTSEEELADCSEHAHSTWGDCCG------------IPIPSAVAASEA 348

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  161 bits (408), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 161/298 (54%), Gaps = 14/298 (4%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS-VVNEFVGVLNHM 72
           P KR+   +    +  S     L  FI+K AK +      Q    I+  +  F+G+L  +
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 73  SLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
           + ++D+ P ++  +  R+G +  RD++ ++  Q  +L     P      + +L  YL  S
Sbjct: 63  NNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDF----LLIMNAYYAVVRKLILT 186
           +G+  R+DYG+GHEL+FL ++  +    +F    + +DF    L I   Y  V+R L   
Sbjct: 123 WGNKQRIDYGSGHELNFLCLLYGLHKYKIFD---ESKDFTNMVLKIFIEYLRVMRILETK 179

Query: 187 YTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQT 246
           Y LEPAGSHGVWGLDD+  L ++FG+ Q A +K   L+P  I N  LV+ +    LY   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPLSIHNEELVEMFQDKYLYFSC 237

Query: 247 IGFIYQVKRG-PFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG 303
           + FI  VK     R HS ML D+ + V  W+K+  G++KMY  EVL+K P++QHF+FG
Sbjct: 238 VAFINSVKTSTSLRFHSPMLDDI-SGVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  160 bits (404), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/319 (32%), Positives = 166/319 (52%), Gaps = 9/319 (2%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS-VVNEFVGVLNHM 72
           P KR+        ++ S        FI   A+ +      Q    IS  +N  + +L+ +
Sbjct: 3   PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQI 62

Query: 73  SLLVDQTPPLEG--PRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
             +  + P ++     R+G +  RD++ ++      + R   P      + +L  YL  S
Sbjct: 63  KDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLILTYTL 189
           +G+  R+DYG+GHEL+F+ ++  +   G+F       + +L +   Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWL 182

Query: 190 EPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGF 249
           EPAGSHGVWGLDD+  L ++FG+ Q   +K   L+P  I N+ LV+ +AH  LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIHNNELVEMFAHRYLYFGCIAF 240

Query: 250 IYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYP 308
           I +VK     R HS ML D+ + V TW+K+  G++KMY  EVL+K P++QHF+F + F P
Sbjct: 241 INKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-SEFLP 298

Query: 309 WVDNQTGKQLLIYDPADAD 327
             D  +  +  I+D  D D
Sbjct: 299 CPDGVSPPRGHIHDGTDKD 317

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  160 bits (404), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 155/296 (52%), Gaps = 12/296 (4%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS-VVNEFVGVLNHM 72
           P KR+        ++AS     L  FI   A+ +      Q    IS  +N    +L  +
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 73  SLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
             ++D+ P LE     R+G    R ++ +I+E    L  +  P   H  + +L  YL  S
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYLDES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAI---DMLGLFTDEFQGEDFLLIMNAYYAVVRKLILTY 187
           +G+  R+DYG+GHEL+F+  +  +   D+L L  D       L+I   Y  ++R L   Y
Sbjct: 123 WGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNM--VLIIFIKYLDIMRSLETKY 180

Query: 188 TLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTI 247
            LEPAGSHGVWGLDD+  L ++FG+ Q A +K   L+P  I N  LV+ +A   LY   I
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKH--LKPLSIHNEELVEMFAKKYLYFGCI 238

Query: 248 GFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWF 302
            FI  VK     R HS ML D+ + V  W+K+  G++KMY  EVL+K P++QHF+F
Sbjct: 239 AFINSVKTTASLRWHSPMLDDI-SGVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 159/306 (51%), Gaps = 19/306 (6%)

Query: 60  SVVNEFVGVLNHMSLLVDQTPPLE--GPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFH 117
           S +     +L+ ++ +VD+ P ++  G  R+G +  RD++ ++ E    L   +  +   
Sbjct: 50  SQIENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTD 109

Query: 118 HCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYY 177
             + EL  Y   S+G   R+DYG+GHEL+F+  +  +    + +D  +    L +   Y 
Sbjct: 110 EQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYL 169

Query: 178 AVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEY 237
            V+R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q   +K   L+P+ I N  +V+ +
Sbjct: 170 DVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPKSIHNPEIVEVF 227

Query: 238 AHLNLYCQTIGFIYQVK-RGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPV 296
               +Y + + FI +VK     R HS ML D+ + V TW+K+  G++KMY  EVL K P+
Sbjct: 228 EKRYMYFECVAFINKVKTTASLRWHSPMLDDI-SGVRTWSKVAEGMVKMYKAEVLGKLPI 286

Query: 297 VQHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPS 356
           +QHF+F T F P  +N +  +    D A  D    S + G +              P PS
Sbjct: 287 MQHFFFST-FLPGPENVSAPR----DGATDDAHCISHSHGGWGDCCG--------IPIPS 333

Query: 357 TTAASE 362
             AA+E
Sbjct: 334 AIAATE 339

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  156 bits (395), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 170/319 (53%), Gaps = 9/319 (2%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISV-VNEFVGVLNHM 72
           P KR+  S     ++ S        FI   A+ +      Q    +S  ++  + +L+++
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 73  SLLVDQTPPLE--GPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
             ++ + P ++     R+G +  RD++ ++ +      R   P      + +L  YL  S
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYLDES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLILTYTL 189
           +G+  R+DYG+GHEL+F+ ++  +   G+F       + +L +   Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETRYWL 182

Query: 190 EPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGF 249
           EPAGSHGVWGLDD+  L ++FG+ Q  ++K   L+P  I N+ LV+ +A+  LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTSHKH--LKPISIHNNELVEMFANRYLYFGCIDF 240

Query: 250 IYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYP 308
           I +VK     R HS ML D+ + V TW+K+  G++KMY  EVL+K P++QHF+F + F P
Sbjct: 241 INKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SDFLP 298

Query: 309 WVDNQTGKQLLIYDPADAD 327
             +  +  +  I+D  D D
Sbjct: 299 CPEGVSPPRGHIHDGTDVD 317

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/295 (33%), Positives = 154/295 (52%), Gaps = 8/295 (2%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS-VVNEFVGVLNHM 72
           P KRI   +    ++ S     +  FI+  AK +      Q    +S  V   + VL  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 73  SLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
             L+   P ++     R+G +  RD++  + E+   L     P      I +L  YL  S
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIM-NAYYAVVRKLILTYTL 189
           +G+  R+DYG+GHEL+F+  +  +    +F  +    + +L++   Y  ++R++   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYWL 182

Query: 190 EPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGF 249
           EPAGSHGVWGLDD+  L ++FG+ Q A +K   L+P+ I N  LV+ +A   LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLAPHKH--LKPKSIHNEELVEMFADKYLYFGCIAF 240

Query: 250 IYQVKRG-PFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG 303
           I  VK     R HS ML D+ + V  W+K+  G++KMY  EVL K P++QHF+F 
Sbjct: 241 INSVKTSTSLRWHSPMLDDI-SGVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYFS 294

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  155 bits (393), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 146/254 (57%), Gaps = 11/254 (4%)

Query: 53  PQGPSRISVVNEFVGVLNHMSLLVDQTPPLEG--PRRYGNLACRDWHAKIDEQMPSLWRK 110
           P     IS++N    +L+ +  ++ + P ++     R+G +  RD++ ++ +    L R 
Sbjct: 47  PISEQIISMMN----LLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRS 102

Query: 111 VLPDRFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFL 170
             P      + +L  YL  S+G+  R+DYG+GHEL+F+ ++  +   G+F       + +
Sbjct: 103 EFPHLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLI 162

Query: 171 L-IMNAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDIL 229
           L +   Y  ++R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q   +K   L+P  I 
Sbjct: 163 LKVFIEYLQIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIH 220

Query: 230 NHHLVQEYAHLNLYCQTIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAV 288
           N+ LV+ +AH  LY   I FI +VK     R HS ML D+ + V TW+K+  G++KMY V
Sbjct: 221 NNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYKV 279

Query: 289 EVLNKFPVVQHFWF 302
           EVL+K P++QHF+F
Sbjct: 280 EVLSKLPIMQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  154 bits (390), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 146/282 (51%), Gaps = 7/282 (2%)

Query: 87  RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNSFGSATRLDYGTGHELS 146
           R+G +  RD++  +  Q  +L ++  P      I +L  Y+  S+G+  R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYVDESWGNKQRIDYGSGHELN 138

Query: 147 FLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLILTYTLEPAGSHGVWGLDDHFH 205
           F+  +  +    +F  E    + +L +   Y  ++R L L Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQYWLEPAGSHGVWGLDDYHF 198

Query: 206 LAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGFIYQVKRGP-FREHSSM 264
           L ++FG+ Q + +K   L+P  I N  L++ +A   LY   I FI  VK     R HS M
Sbjct: 199 LPFLFGAYQLSTHKH--LKPSSIHNDDLIEMFADKYLYFGCIEFINSVKTTTTLRWHSPM 256

Query: 265 LYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYPWVDNQTGKQLLIYDPA 324
           L D+ + V  W+K+  G+ KMY  EV+ K P++QHF+F   F    +N +  +  I+D  
Sbjct: 257 LDDI-SGVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFNDMFLICPENVSPPREHIHDGG 315

Query: 325 DADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEARAP 366
           + D     + G  ++ +       VP   A S   A     P
Sbjct: 316 EEDE--CLAEGHAHSTYGDCCGIKVPSAIAASQINAMNKNKP 355

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  154 bits (388), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 154/296 (52%), Gaps = 10/296 (3%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIIN-RVNIPQGPSRISVVNEFVGVLNHM 72
           P KR+        +  S     L  FI K  + +  R N        S ++E   +L+ +
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 73  SLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIV-ELVHYLGN 129
           + +V   P ++     R+G +  RD++  +  +   +    L D+     V EL  Y   
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEM-ISSLSDKLSTPQVDELAAYFRK 121

Query: 130 SFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLILTYT 188
           S+G+ TR+DYG+GHEL+F+  +  ++    F  E    + +L +   Y  V+R L   Y 
Sbjct: 122 SWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYW 181

Query: 189 LEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIG 248
           LEPAGSHGVWGLDD+  L ++FG+ Q A +K   L+P+ I N   V+ +    LY   IG
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPKSIHNKEFVEMFEKRYLYFGCIG 239

Query: 249 FIYQVKRG-PFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG 303
           FI  VK     R HS ML D+ + V TW+K+  G++KMY  EVL K P++QHF+FG
Sbjct: 240 FINSVKTSISLRWHSPMLDDI-SGVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFG 294

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 135/241 (56%), Gaps = 7/241 (2%)

Query: 68  VLNHMSLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVH 125
           +L  ++ L+D+ P ++     R+G +  RD++  +      L     P      + EL  
Sbjct: 58  LLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAV 117

Query: 126 YLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLI 184
           YL  S+G+  R+DYG+GHEL+F+  +  + +  +F  E    D +L +   Y  ++R L 
Sbjct: 118 YLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILE 177

Query: 185 LTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYC 244
             Y LEPAGSHGVWGLDD+  L ++FG+ Q A +    LRP+ I N  +V+ +    +Y 
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPH--LRPKSIHNEEVVEMFMDKYIYF 235

Query: 245 QTIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG 303
             I FI  VK     R HS ML D+ + V TWAK+  G++KMY  EVL+K P++QHF+FG
Sbjct: 236 GCIAFINSVKSTASLRWHSPMLDDI-SGVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

Query: 304 T 304
            
Sbjct: 295 N 295

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 161/300 (53%), Gaps = 16/300 (5%)

Query: 13  TPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKII-----NRVNIPQGPSRISVVNEFVG 67
            P KRI        ++ S     L  FI   A+ +     +++  P  PS  S+ +    
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSS---- 57

Query: 68  VLNHMSLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVH 125
           +L+ ++ LVD+ P ++  +  R+G +  RD++ +++E+  SL +          + +L  
Sbjct: 58  LLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSI 117

Query: 126 YLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMN-AYYAVVRKLI 184
           YL  S+G+  R+DYG+GHEL+F+  +  +   GLF  E    + +L++   Y  ++R L 
Sbjct: 118 YLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLE 177

Query: 185 LTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYC 244
             Y LEPAGSHGVWGLDD+  L ++FG+ Q   +K   L+P  I N  LV+ +    LY 
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKH--LKPMSIHNEELVELFKDKFLYF 235

Query: 245 QTIGFIYQVKRG-PFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG 303
             I FI  VK     R HS ML D+ + V  W+K+  G++KMY  EVL K P++QHF+F 
Sbjct: 236 GCISFINSVKTTTSLRWHSPMLDDI-SGVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYFS 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  151 bits (382), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 93/261 (35%), Positives = 140/261 (53%), Gaps = 11/261 (4%)

Query: 48  NRVNIPQGPSRISVVNEFVGVLNHMSLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMP 105
           N    P G S  S       +L  ++ L +Q P  +     R+G +  R ++  +  +  
Sbjct: 42  NEYQKPTGSSIESCCQ----LLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQ 97

Query: 106 SLWRKVLPDRFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQ 165
            L ++           EL  Y   S+G  +R+DYG+GHEL+FL  +  +   G+F +   
Sbjct: 98  GLIQRAFDALDGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPAD 157

Query: 166 GEDFLL-IMNAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLR 224
             + +L +   Y  V+R L   Y LEPAGSHGVWGLDD+  L ++FG+ Q + +K   L+
Sbjct: 158 YRNMVLKLFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKH--LK 215

Query: 225 PRDILNHHLVQEYAHLNLYCQTIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLM 283
           P+ I N  +V+ +    LY   I FI +VK     R HS ML D+ + V TWAK+  G++
Sbjct: 216 PKSIHNSEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDI-SGVKTWAKVAEGMI 274

Query: 284 KMYAVEVLNKFPVVQHFWFGT 304
           KMY  EVLNK P++QHF+FG+
Sbjct: 275 KMYKAEVLNKLPIMQHFFFGS 295

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  150 bits (380), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/308 (32%), Positives = 158/308 (51%), Gaps = 13/308 (4%)

Query: 12  NTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISV-VNEFVGVLN 70
           + P KR+        + +S     L  FI   A+ +   +  Q    IS  V+  + +L+
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAEVSSTLALLD 62

Query: 71  HMSLLVDQTPPL-EGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGN 129
            +  +VD+ P L +   R+G    R ++  +     +L  K       + I +L  Y   
Sbjct: 63  SVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLSIYFYE 122

Query: 130 SFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDF-LLIMNAYYAVVRKLILTYT 188
           S+G+  R+DYG+GHEL+F+  +  +    +F  E    +  +L+   Y  ++R+L   Y 
Sbjct: 123 SWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRLETLYW 182

Query: 189 LEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIG 248
           LEPAGSHGVWGLDD+  L ++FG+ Q +N+K   L+P+ I N  +V  +    LY   I 
Sbjct: 183 LEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKH--LKPKSIHNDEIVDMFKDKYLYFGCIA 240

Query: 249 FIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFG---- 303
           FI  VK     R HS ML D++  V  W+K+  G++KMY  EVL+K PV+QHF+F     
Sbjct: 241 FINSVKTTASLRWHSPMLDDISG-VKKWSKVSEGMIKMYVAEVLSKLPVMQHFYFSEFLA 299

Query: 304 --TGFYPW 309
             TG  P+
Sbjct: 300 CPTGISPY 307

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/319 (31%), Positives = 167/319 (52%), Gaps = 9/319 (2%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISV-VNEFVGVLNHM 72
           P KR+  ++    ++ S        F+   AK +      Q    +S  +   + +L+ +
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQITRMLSLLSRV 62

Query: 73  SLLVDQTPPLEG--PRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNS 130
             ++++ P +      R+G +  RD++ ++ +    L +          + +L  YL  S
Sbjct: 63  RDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYLDES 122

Query: 131 FGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLILTYTL 189
           +G+  R+DYG+GHEL+F+ ++  +   G+F       + +L +   Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETKYWL 182

Query: 190 EPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGF 249
           EPAGSHGVWGLDD+  L ++FG+ Q   +K   L+P  I N  LV+ ++   LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIHNSELVEMFSDRYLYFGCIAF 240

Query: 250 IYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYP 308
           I +VK     R HS ML D+ + V TW+K+  G++KMY  EVL+K P++QHF+F + F P
Sbjct: 241 INKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SEFLP 298

Query: 309 WVDNQTGKQLLIYDPADAD 327
             +  +  +  I+D  DAD
Sbjct: 299 CPEGVSQPRGHIHDGTDAD 317

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 155/300 (51%), Gaps = 16/300 (5%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKII-----NRVNIPQGPSRISVVNEFVGV 68
           P KR+  SQ    +       +L  FI + A+ +     N+   P G S    +++   +
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGAS----IDKCCSL 58

Query: 69  LNHMSLLVDQTPPLEGPR--RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHY 126
           L+ +  +  Q P  E     R+G +  R ++  +  +   L  K           ELV Y
Sbjct: 59  LDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAY 118

Query: 127 LGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKLIL 185
              S+G   R+DYG+GHEL+F+  +  +   GLF       + +L +   Y  ++R L  
Sbjct: 119 FVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLET 178

Query: 186 TYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQ 245
           TY LEPAGSHGVWGLDD+  L ++FG++Q A +K   L+P+ I N+ LV  +A   LY  
Sbjct: 179 TYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKH--LKPKSIHNNELVDMFASRYLYFG 236

Query: 246 TIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGT 304
            I FI +VK     R HS ML D+ +   +W+K+  G++KMY  EVL K P++QHF FG+
Sbjct: 237 CIDFINRVKTTASLRWHSPMLDDI-SGAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGS 295

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  147 bits (372), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 149/288 (51%), Gaps = 14/288 (4%)

Query: 87  RYGNLACRDWHAKIDEQMPSLWRKVL-----PDRFHHCIVELVHYLGNSFGSATRLDYGT 141
           R+G +  RD++  I E    L  K+      PD     + ++  Y  NS+G  +R+DYG+
Sbjct: 78  RFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGK--LDDICTYFINSWGDRSRIDYGS 135

Query: 142 GHELSFLAVVGAIDMLGLFTDEFQGEDFLLIM-NAYYAVVRKLILTYTLEPAGSHGVWGL 200
           GHEL+F+  +  +    +F  E    + +L++   Y  ++R L L Y LEPAGSHGVWGL
Sbjct: 136 GHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHGVWGL 195

Query: 201 DDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGFIYQVKR-GPFR 259
           DD+  L ++FG+ Q + +K   L+P+ I N  +V+ +    LY   I FI +VK     R
Sbjct: 196 DDYHFLPFLFGAFQLSTHKH--LKPKSIHNPEVVEMFQDRYLYFGCIAFINKVKTTASLR 253

Query: 260 EHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYPWVDNQTGKQLL 319
            HS ML D+ + V  W+K+  G++KMY  EVL K P++QHF+FG  F    +  +     
Sbjct: 254 WHSPMLDDI-SGVKRWSKVAEGMVKMYKAEVLQKLPIMQHFYFGY-FLKCPEGVSEPSAR 311

Query: 320 IYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAASEARAPP 367
             D  + D   T  + G ++ +       VP   A S  A  + R  P
Sbjct: 312 AQDHHEDDSCCTDGSHG-HSTWADCCGIAVPSAIAASQMANKDVRLFP 358

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  147 bits (370), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 157/298 (52%), Gaps = 14/298 (4%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISV-VNEFVGVLNHM 72
           P KR+   +    +++S     L +FI++ A  +      Q    IS  V   +G+L  +
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQQV 65

Query: 73  SLLVDQTP--PLEGP-RRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGN 129
             ++++ P    + P  R+G +  RD++ ++  +  SL     P    + + +L  YL  
Sbjct: 66  RGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTYLEE 125

Query: 130 SFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGED----FLLIMNAYYAVVRKLIL 185
           S+G   R+DYG+GHEL+F+  +  +    +F  +  G D     L     Y  ++R L  
Sbjct: 126 SWGDKRRIDYGSGHELNFMCFLYGLTAYKVF--DLGGTDRANLVLKPFIEYLKIMRVLET 183

Query: 186 TYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQ 245
            Y LEPAGSHGVWGLDD+  L ++FG+ Q + +K   L+P  I N  +V+ +A   LY  
Sbjct: 184 EYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKH--LKPLSIHNEEVVELFADKYLYFG 241

Query: 246 TIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWF 302
            I FI  VK     R HS ML D+ + V  W+K+  G++KMY  EVL+K P++QHF+F
Sbjct: 242 CIHFINSVKTTATLRWHSPMLDDI-SGVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYF 298

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  144 bits (362), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 131/232 (56%), Gaps = 8/232 (3%)

Query: 81  PLE--GPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHYLGNSFGSATRLD 138
           P+E  GP R+G    RD +  I  +   L ++         + +L  Y   S+G  +R+D
Sbjct: 71  PVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNESWGDKSRID 130

Query: 139 YGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILT-YTLEPAGSHGV 197
           YG+GHEL+FL  +  +   G+F       + +LI+   Y    ++I T Y LEPAGSHGV
Sbjct: 131 YGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVYWLEPAGSHGV 190

Query: 198 WGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQTIGFIYQVKR-G 256
           WGLDD+  L ++FG++Q + ++   L+P+ I N  +V+ ++   LY   I FI  VK   
Sbjct: 191 WGLDDYHFLPFLFGASQLSTHRH--LKPKSIHNPEVVEMFSEKYLYFGCIDFINSVKTTA 248

Query: 257 PFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGFYP 308
             R HS ML D+ + V  WAK+  G++KMY  EVL K P++QHF+F + F P
Sbjct: 249 SLRWHSPMLDDI-SGVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF-SEFLP 298

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 179/362 (49%), Gaps = 29/362 (8%)

Query: 14  PVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKII-----NRVNIPQGPSRISVVNEFVGV 68
           P KR+  SQ    +  S     L  FI+  A  I     +++++P   S    +N    +
Sbjct: 2   PEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDS----INNAFSL 57

Query: 69  LNHMSLLVDQTP---PLEGPR-RYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELV 124
           L  +  ++++ P    +E  + R+G +  + ++  I++    L +        + I EL 
Sbjct: 58  LQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELS 117

Query: 125 HYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLL-IMNAYYAVVRKL 183
            YL  S+G+  R+DYG+GHEL+F+  +  +    +F       + +L I   Y  ++R +
Sbjct: 118 IYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRII 177

Query: 184 ILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLY 243
              Y LEPAGSHGVWGLDD+  L ++FG+ Q + +K   L+P  I N  +V+ +    +Y
Sbjct: 178 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKH--LKPISIHNEEMVEMFKDKYMY 235

Query: 244 CQTIGFIYQVKR-GPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWF 302
              I FI  +K     R HS ML D++  V  W+K+  G++KMY+ EVL K P++QHF+F
Sbjct: 236 FGCIDFINSIKTTATLRWHSPMLDDISG-VKKWSKVSEGMIKMYSAEVLGKLPIMQHFYF 294

Query: 303 GTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGK---------YAAFVSSINSPVPHFP 353
            + F P     +   +   D  + +  +  ST G           AA V+S +SP  H P
Sbjct: 295 -SDFLPCPQGVSLPHIHGKD-GNIEETHVHSTWGDCCGIQIPSAIAASVASKSSPKIHKP 352

Query: 354 AP 355
            P
Sbjct: 353 IP 354

>KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {ON}
           some similarities with uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 206

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 55  GPSRISVVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRD 95
            PS+   +NE V  L+ +  ++DQ PPL+ P  + NL C+D
Sbjct: 111 APSK-EALNEHVLELHLIHEILDQNPPLQTPPHWDNLQCQD 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,849,438
Number of extensions: 1879347
Number of successful extensions: 4703
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4715
Number of HSP's successfully gapped: 46
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)