Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16456g5.708ON54854829680.0
TDEL0B021205.708ON54854725670.0
YKR097W (PCK1)5.708ON54954825340.0
Smik_11.3615.708ON54954825330.0
Skud_11.3375.708ON54954825070.0
Suva_11.3345.708ON54854825020.0
NCAS0A031605.708ON55255225000.0
KNAG0C066405.708ON54754424860.0
SAKL0E15048g5.708ON54254824800.0
KLLA0A00484g5.708ON54354924570.0
NDAI0E050805.708ON55155124510.0
CAGL0H06633g5.708ON54453324460.0
AFR292W5.708ON54154824170.0
Ecym_40135.708ON54254824090.0
KAFR0H001605.708ON54954924000.0
KLTH0E00902g5.708ON54454623680.0
Kwal_55.196635.708ON54454623480.0
TBLA0E017005.708ON57654022750.0
TPHA0E001705.708ON57853522460.0
Kpol_1043.755.708ON55851822380.0
Suva_7.275singletonON961131538e-12
SAKL0B05126g8.762ON706119790.50
NDAI0A005601.67ON71482751.8
TDEL0C063501.67ON69399698.2
TBLA0B001002.1ON171766699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16456g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...  1147   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   993   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   980   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   980   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   970   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   968   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   967   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   962   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   959   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   951   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   948   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   946   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   935   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   932   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   929   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   916   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   909   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   880   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   869   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   866   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    64   8e-12
SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} simila...    35   0.50 
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...    33   1.8  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    31   8.2  
TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YN...    31   9.6  

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score = 1147 bits (2968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/548 (100%), Positives = 548/548 (100%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
           AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/547 (84%), Positives = 500/547 (91%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK+   +TD +EVE++IR EL+L +EV+TIR NAPAA LYED L EKKT + SSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRIIEEETSK+ +WWGPVNKP  EKTWSINRERAADYLRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDPRYRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+GM+SKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           ++ DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI LTAEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EIYNAIKFGS+LENVV+D   R+VDY D+SITENTRCAYPI++IPSAKIPCLAD HP N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P+RYATMLAKKM +H ANAWL+NTGWTGSSY AGGKRCPLKYTRAILD+IHDGSL+K  Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP FNLH P KVNGVP  LLNP+K+WVEG  KYN+AV  LA  F ENFKIYQD+ATP+
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 541 VLAAGPQ 547
           VLAAGPQ
Sbjct: 541 VLAAGPQ 547

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/548 (82%), Positives = 497/548 (90%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK+   +  T+EVE++IR+ELAL  EV TIR NAPAA LYEDGLKE KT + SSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI++AIKFGSVLENV++D  +  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P+RYATMLA KM QH ANA+L+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+   Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLPIFNL  P KVNGVP  LLNPAK+W +G +KY  AV  LA  F +NFKIYQD+ATPD
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/548 (83%), Positives = 498/548 (90%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK+   +  T+EVE++IR+ELAL  EV TIR NAPAA LYEDGLKEKKT + SSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI++AIKFG+VLENV +D  +  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P+RYATMLA KM QH ANA+L+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+   Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           E+LPIFNL  P KV GVP  LLNPAK+W +G TKY  AV +LAT F ENFKIYQD+ATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/548 (81%), Positives = 493/548 (89%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK+      T+EVE++IR+ELAL  EV TIR NAPAA LYEDGLKEKKT + SSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI++AIKFG+VLENV +D  +  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P+RYATMLA KM  H +NA+L+NTGW+GSSY +GGKRCPLKYTRAILDSIHDGSL+   Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           E+LPIFNL  P KV GVP  LLNPAK+W +G  KY  +V  LA  F ENFKIYQD+ATPD
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/548 (82%), Positives = 495/548 (90%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK+      T+ VE++IR+ELAL  EV TIR NAPAA LYEDGLKEKKT + SSGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI+EE TSK+E+WWGPVNKP SE+TWSINRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ EELA+FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+ M+SK+T+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           + GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI+L+AEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI++AI+FG+VLENV +D ++  VDY D+SITENTRCAYPIDYIPSAKIPCLAD HP NI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P+RYATMLA KM QH ANA+L+NTGWTGSSY +GG RC LKYTRAILDSIHDGSL+KA Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           E+LPIFNL  P KVNGVP  LLNPAK+W +G  KY  AV  LA  F ENFKIYQD+ATPD
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 541 VLAAGPQF 548
           VLAAGPQF
Sbjct: 541 VLAAGPQF 548

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/552 (80%), Positives = 495/552 (89%), Gaps = 4/552 (0%)

Query: 1   MSPSKV----PVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVS 56
           MSP KV    P+ I+D+  VE+ IRKEL L  +V TIR NAPAA LYED L E+KT + S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 57  SGALAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRD 116
           SGAL AYSGSKTGRSP+DKRI+EEETSK+ VWWGPVNKP SEKTW+INRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 117 HLYIIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQF 176
           HLYI+DA+AGWDP+YRIKVRV+CARAYHA+FMTNMLIRP+ EELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 177 PANRNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSA 236
           PAN+NT+ M+SKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 237 NQGIERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTA 296
           NQGI+ GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+A
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 297 EKEPEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKH 356
           EKEPEI+NAIK+GS+LENV++D + R VDY D SITENTRCAYPI+YIPSAKIPCLAD H
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 357 PSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPF 416
           P NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 417 LALHPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLS 476
           LALHP+RYATMLA+K+  H+A+AWL+NTGWTGSSY  GGKRCPLKYTRAILDSIHDGSL+
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 477 KADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQ 536
           K  YETLPIFNL  P  VNGVP  +LNPAK+W EG  KY++AV  L + F ENFK YQD+
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 537 ATPDVLAAGPQF 548
           ATPDVLAAGPQ 
Sbjct: 541 ATPDVLAAGPQI 552

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/544 (81%), Positives = 489/544 (89%)

Query: 3   PSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAA 62
           PSK     TD   VE++IR+EL L  EV+TIR NAPAA LYED L E+KT + SSGAL A
Sbjct: 2   PSKSNSAATDAISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIA 61

Query: 63  YSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIID 122
           YSG KTGRSPKDKRI+EEETSK+ VWWGPVNKP SE+TW INRERAADYLRTRDHLYI+D
Sbjct: 62  YSGEKTGRSPKDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVD 121

Query: 123 AYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNT 182
           A+AGWDP+YRIKVRV+CARAYHALFMTNMLIRPS EELANFGEPDFTVWNAGQFPAN +T
Sbjct: 122 AFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHT 181

Query: 183 EGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIER 242
           + M+SK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI+ 
Sbjct: 182 QDMSSKSTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKN 241

Query: 243 GDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEI 302
           GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+AEKEPEI
Sbjct: 242 GDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEI 301

Query: 303 YNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVL 362
           ++AI+FGSVLENV +D  + EVDY D++ITENTRCAYPI+YIPSAKIPCLAD HP NI+L
Sbjct: 302 FDAIRFGSVLENVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIIL 361

Query: 363 LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPM 422
           LTCDASGVLPPV+KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP+
Sbjct: 362 LTCDASGVLPPVAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPI 421

Query: 423 RYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYET 482
           RYA MLA KM +H ANA+L+NTGWTGSSY +GGKRCPLKYTRAILD+IHDGSL++A+YE+
Sbjct: 422 RYAKMLAAKMSEHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYES 481

Query: 483 LPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVL 542
           LPIFNL  P  VNGVP  LLNPAK+W +G  KYN AV  LA+ F ENFKIYQD+ATPDVL
Sbjct: 482 LPIFNLEVPTAVNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVL 541

Query: 543 AAGP 546
           AAGP
Sbjct: 542 AAGP 545

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/548 (82%), Positives = 483/548 (88%), Gaps = 6/548 (1%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK        A  E++IR EL L  EVVTIR NAPAA LYED LKE+KT + SSGAL
Sbjct: 1   MSPSKT------YASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSP+DKRI++E TS + VWWGPVNK  SE+TW INRERAADYLRTRDHLYI
Sbjct: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DAYAGWDPRYRIKVRV+CARAYHALFMTNMLIRP+ +ELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T GMTSKTTVEINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
              DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EIYNAIKFGSVLENV+++   REVDY D+SITENTRCAYPIDYIPSAKIPCLAD HPSNI
Sbjct: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           PM+YATMLA+KM +HNANAWL+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+K  Y
Sbjct: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP FNL  P +VN VP  LLNPAK+W+EG  KY SAV+ LA  F ENFK YQD+AT  
Sbjct: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534

Query: 541 VLAAGPQF 548
           VL+AGPQ 
Sbjct: 535 VLSAGPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/549 (81%), Positives = 486/549 (88%), Gaps = 7/549 (1%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSP+K           EE IR EL L +EVVTIR NAPAA LYED LKE+ TA+ ++GAL
Sbjct: 1   MSPTKT------QNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGAL 54

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSP+DKRI+EEETSK+ VWWGPVNKP SE+TW INRERAADYLRTRDH+YI
Sbjct: 55  IAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYI 114

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DAYAGWDPRYRIKVRV+CARAYHALFMTNMLIRPS EEL NFGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANT 174

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T GMTSKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 175 HTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
           +  DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKC+ L+AEKEP
Sbjct: 235 QDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEP 294

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI+NAIKFGSVLEN+++D + REVDY D++ITENTRCAYPI+YIPSAKIPCLAD HP NI
Sbjct: 295 EIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNI 354

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LH
Sbjct: 355 VLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLH 414

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           PM+YATMLA+KM +HNANAWL+NTGWTGSSY AGGKRCPLKYTRAILD+IHDGSL+K +Y
Sbjct: 415 PMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEY 474

Query: 481 ETLPIFNLHTPAKV-NGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATP 539
           E LPIFNL  P  V + VP SLLNP+K+W EG  KY S VK+LA  F ENFK YQD+AT 
Sbjct: 475 EVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATE 534

Query: 540 DVLAAGPQF 548
            VLAAGPQ 
Sbjct: 535 QVLAAGPQL 543

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/551 (78%), Positives = 491/551 (89%), Gaps = 3/551 (0%)

Query: 1   MSP---SKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSS 57
           MSP   S  P+  TD+ +VE++IR+EL L  +V TIR NAPAA LYED L E+ T + S+
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 58  GALAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDH 117
           GAL AYSG KTGRSP+DKRI+EEETSK+++WWGPVNKP SE+TWSINRERAADYLRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 118 LYIIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFP 177
           LYI+DA+AGWDP YRIKVRV+CARAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 178 ANRNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSAN 237
           AN +T+ M+SKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 238 QGIERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAE 297
           QGI  GDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 298 KEPEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHP 357
           KEPEI+ AIK+GS+LENV++D   R V Y D+++TENTRCAYPI++IPSAKIPCLAD HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 358 SNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFL 417
           SNI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 418 ALHPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSK 477
           ALHP+RYATMLAKK+ +H+ANAWL+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+K
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 478 ADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQA 537
            ++ETLP+FNL  P  VN VP  LLNPAK+W +G  KYN+AV  LA+ F ENFKIYQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 538 TPDVLAAGPQF 548
           TP+VLAA P+ 
Sbjct: 541 TPEVLAAAPRI 551

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/533 (81%), Positives = 480/533 (90%)

Query: 16  VEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRSPKDK 75
           VEE+IR EL L  EV  IR NAPAA LY+D LKEKKT + S+GAL AYSG KTGRSPKDK
Sbjct: 12  VEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDK 71

Query: 76  RIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYRIKV 135
           RI+EEETS++ VWWGPVNKP SE+TW+INRERAADYLRTR+ LY++DA+AGWDP+YRIKV
Sbjct: 72  RIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKV 131

Query: 136 RVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVEINF 195
           RV+CARAYHALFMTNMLIRP+ EELANFGEPDFTVWNAGQFPAN  T+ MTSKTT+EINF
Sbjct: 132 RVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINF 191

Query: 196 KAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLSGTG 255
           KAMEM+ILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSS NQGI+ GDVTLFFGLSGTG
Sbjct: 192 KAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTG 251

Query: 256 KTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVLENV 315
           KTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ EKEPEI++AI+FGSVLENV
Sbjct: 252 KTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENV 311

Query: 316 VFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLPPVS 375
           ++D+ + EVDY D+SITENTRCAYPID+IPSAKIPCLA  HP NI+LLTCDASGVLPPVS
Sbjct: 312 IYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVS 371

Query: 376 KLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQH 435
           KLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPMRYATMLA+KMH+H
Sbjct: 372 KLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEH 431

Query: 436 NANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPAKVN 495
           +ANAWL+NTGWTGSSY +GGKRC LKYTRAILD+IHDGSL+KA++E+LPIFNL  P  V 
Sbjct: 432 SANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVE 491

Query: 496 GVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGPQF 548
           GVP  LLNPA++W EG  KY SAV  LA  F ENFK YQD+AT DVLAAGPQ 
Sbjct: 492 GVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 486/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSKV          EE+IR EL L S V+TIR NAPAA LYED L E+KTA+ S+GAL
Sbjct: 1   MSPSKV------YQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI++E TS + +WWGPVN+ ASEKTW INRERAAD+LRTR+HLYI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DAYAGWDPRYRIK+R++C RAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +TEGM+SKTTVEINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
              DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEP
Sbjct: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI+NAIK+GSVLENVV+D   R VDY D+SITENTRCAYPI+YIPSA+IPCL++ HPSNI
Sbjct: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           PM+YATMLA+KM QHNA+AWL+NTGWTGSSYTAGGKRCPLKYTRAILDSIHDG+L++A+Y
Sbjct: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP+F L  P  V GVP  LLNPAK+WVEG  KY SAV  LA+KFTENFKIYQDQAT +
Sbjct: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533

Query: 541 VLAAGPQF 548
           V+ AGPQ 
Sbjct: 534 VVRAGPQI 541

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/548 (79%), Positives = 483/548 (88%), Gaps = 6/548 (1%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSKV          EE+IR EL L S V+ IR NAPAA LYED L E+ TA+ S+GAL
Sbjct: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            AYSG KTGRSPKDKRI++E TS N+VWWGPVN+  SE+TW INRERA DYLRTR+HLYI
Sbjct: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DA+AGWDPRYRIK+R++C RAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFPAN 
Sbjct: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +TEGM+SKTTVEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
            +GDVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI L+AEKEP
Sbjct: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI+NAI++GSVLENVV++  +R VDY D+SITENTRCAYPI+YIPSAKIPCL++ HPSNI
Sbjct: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           PM+YATMLA+KM QHNANAWL+NTGWTG+SY +GGKRCPLKYTRAILD+IH GSL+ ADY
Sbjct: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP+F L  P  V GVP  LLNP+++WVEG  KY+ AV +LA  F +NFKIYQDQAT +
Sbjct: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534

Query: 541 VLAAGPQF 548
           VL AGPQ 
Sbjct: 535 VLYAGPQL 542

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/549 (77%), Positives = 484/549 (88%), Gaps = 1/549 (0%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSS-GA 59
           MSPSKV  P+ D   VE++IR+EL L S V TIR NAP + LYED LK++K  ++SS GA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 60  LAAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLY 119
           L AYSG KTGR PKDKRI+EE  SK ++WWGPVNKP SE+TW INRERAADYLRTR+H+Y
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 120 IIDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPAN 179
           I+DA+AGWDP+YRIKVRV+CARAYHALFMTNMLIRP+ +EL NFG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 180 RNTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQG 239
            +TE M+SKTT+EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHNVLTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 240 IERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKE 299
           IE+ DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSD GVFNIEGGCYAKCI+L+ EKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 300 PEIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSN 359
           PEI+N+IKFGS+LENVV+D  +REVDY D+SITENTRCAYPI++IPSAKIPC+A+ HP N
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 360 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLAL 419
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 420 HPMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKAD 479
           HPM+YATMLA+KM +H ANAWL+NTGWTGSSY AGGKRCPL YTRAILD+IHDGSL K  
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 480 YETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATP 539
           +ETLPIFNL  P  VN VP  LLNP+K+W EG  KY+ AVK L+  F ENFK Y+D+AT 
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 540 DVLAAGPQF 548
           +VLAAGP+ 
Sbjct: 541 EVLAAGPRL 549

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/546 (78%), Positives = 473/546 (86%), Gaps = 4/546 (0%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSP+K      +    ++ IR+ELALG EVVTIR NAPAA LYED LKE KT + SSGAL
Sbjct: 1   MSPTKT----RNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            A+SGSKTGRSPKDKRI++E TS + +WWGPVNK  SEKTW +NRERAADYLRTRDHLYI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DAYAGWDPRYRIK+RV+CARAYHALFMTNMLIRP+ EEL NFGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+GMTSKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
              DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI LT  KEP
Sbjct: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI+NAIKFGSVLENV +D   R VDY D  ITENTRCAYPI+YIPSAKIPCLA+ HP NI
Sbjct: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P++YATMLA+KM QH ANAWL+NTGWTG+S+  GG RCPLKYTRAILD++HDGSL++ D+
Sbjct: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP F LH P  VN VP+ +LNPAK+W EG TKY   V  LA  FTENFK YQD+A+ D
Sbjct: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536

Query: 541 VLAAGP 546
           V++AGP
Sbjct: 537 VISAGP 542

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/546 (76%), Positives = 474/546 (86%), Gaps = 4/546 (0%)

Query: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60
           MSPSK    I +   V+++IRKELALG EVVTIR NAPAA LYED LKE KT + +SGAL
Sbjct: 1   MSPSK----IRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGAL 56

Query: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120
            A+SGSKTGRSPKDKRI++E TS   +WWGPVNK  SEKTW +NRERAAD+LRTRDHLYI
Sbjct: 57  IAFSGSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYI 116

Query: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180
           +DAYAGWDPRYRIK+RV+CARAYHALFMTNMLI+P+P+EL  FGEPDFTVWNAGQFPAN 
Sbjct: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANT 176

Query: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240
           +T+GMTSKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++H VLTLHSSANQGI
Sbjct: 177 HTDGMTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGI 236

Query: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300
              DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI LT  KEP
Sbjct: 237 RDNDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296

Query: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360
           EI+NAI+FGSVLENV +D+  REVD+ +  ITENTRCAYPI+YIPSAKIPCLAD+HP NI
Sbjct: 297 EIFNAIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNI 356

Query: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420
           VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 357 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416

Query: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480
           P++YATMLA KM  H A+AWL+NTGWTG S+  GG RCPLKYTRAILD+IHDG+L+K +Y
Sbjct: 417 PLKYATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEY 476

Query: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540
           ETLP FNLH P  VN VP ++LNPA+SWV G  KY + V+TLA  F ENFK Y+  A+ +
Sbjct: 477 ETLPTFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTE 536

Query: 541 VLAAGP 546
           ++ AGP
Sbjct: 537 IMCAGP 542

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/540 (76%), Positives = 460/540 (85%), Gaps = 8/540 (1%)

Query: 16  VEEQIRKEL----ALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRS 71
           +E+Q+  +L    +  S ++ I+HN  AA LYED LKE KT + SSGAL AYSG+KTGRS
Sbjct: 36  MEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRS 95

Query: 72  PKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRY 131
           PKDKRI+ E+ SK+ VWWGPVNKP SEKTW INRER  DYL TR +LY+IDAY GWDPRY
Sbjct: 96  PKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRY 155

Query: 132 RIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTV 191
           R+KVRV+CARAYHALFMTNMLIRP+ EEL NF EPDFTVWNAG F AN  T  MTSKT+V
Sbjct: 156 RLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSV 215

Query: 192 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGL 251
           EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMP+HHN+LTLHSSAN+GIE+ DVT+FFGL
Sbjct: 216 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGL 275

Query: 252 SGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSV 311
           SGTGKTTLSADP+R LIGDDEHCWSDHGVFNIEGGCYAKCI LT EKEPEI++AI+FGSV
Sbjct: 276 SGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSV 335

Query: 312 LENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVL 371
           LENV ++  N +VDY D +ITENTRCAYPIDYI SAKIPCLA+ HP N++LLTCDASGVL
Sbjct: 336 LENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVL 395

Query: 372 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKK 431
           PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP+ YATMLAKK
Sbjct: 396 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKK 455

Query: 432 MHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTP 491
           M Q+ +NAWL+NTGWTGSSY+AGG RCPLKYTRAILD+IHDG+L+  +YETLP+FNL  P
Sbjct: 456 MDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIP 515

Query: 492 AKVNGVPDSLLNPAKSWVEGPTK----YNSAVKTLATKFTENFKIYQDQATPDVLAAGPQ 547
             VNGVP+ +LNP  SW     K    YN AV  LA  F ENFKIYQD+AT DVLAAGPQ
Sbjct: 516 THVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQ 575

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/535 (74%), Positives = 453/535 (84%)

Query: 12  DTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRS 71
           DT ++ E+   +     +++ I+ N P ATLYEDGLKE KT + S+GAL AYSG KTGRS
Sbjct: 42  DTIKLLEEFISDNLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRS 101

Query: 72  PKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRY 131
           PKDKRI+EEE SK+ +WWGPVNK  SE+TW+INRERA DYL TRD LY+IDA+ GWDPRY
Sbjct: 102 PKDKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRY 161

Query: 132 RIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTV 191
           RIK+RV+CARAYHALFM NMLIRP+ EEL NFG+PDFTVWNAGQF AN  T  M+SKT+V
Sbjct: 162 RIKIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSV 221

Query: 192 EINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGL 251
           EINFK MEM ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQ    GDVTLFFGL
Sbjct: 222 EINFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGL 281

Query: 252 SGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSV 311
           SGTGKTTLSADPHR LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEP+I+NAIKFGSV
Sbjct: 282 SGTGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSV 341

Query: 312 LENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVL 371
           LEN ++D    EVDY +++ITENTRCAYPIDYI +AKIPCLADKHP+N++LLTCDASGVL
Sbjct: 342 LENCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVL 401

Query: 372 PPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKK 431
           PPVSKLTPEQVMYHFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPM+YA+MLA+K
Sbjct: 402 PPVSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEK 461

Query: 432 MHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTP 491
           M +H ANAWL+NTGWTGSSY +GG RCPLKYTRAILD+IHDGSL   +YETLPIFNL  P
Sbjct: 462 MDKHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIP 521

Query: 492 AKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGP 546
              NGVP  LLNPA SW +    Y +AV+ L   F ENFK Y+D+AT +V+ AGP
Sbjct: 522 KNANGVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/518 (77%), Positives = 446/518 (86%)

Query: 31  VTIRHNAPAATLYEDGLKEKKTAVVSSGALAAYSGSKTGRSPKDKRIIEEETSKNEVWWG 90
           +TI+ N P A LYEDGLKE  T + S+GAL AYSG KTGRSPKDKRI+EE +SK+ +WWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 91  PVNKPASEKTWSINRERAADYLRTRDHLYIIDAYAGWDPRYRIKVRVICARAYHALFMTN 150
           PVNKP SE TWSINRERA DYL TR  LY+IDAYAGWD  YRIK+RV+CAR YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 151 MLIRPSPEELANFGEPDFTVWNAGQFPANRNTEGMTSKTTVEINFKAMEMIILGTEYAGE 210
           MLIRP+ EEL NFGEPDFT+WNAG F AN  T+ MTSKT++EINFK+MEM+ILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 211 MKKGIFTVMFYLMPVHHNVLTLHSSANQGIERGDVTLFFGLSGTGKTTLSADPHRALIGD 270
           MKKGIFTVMFYLMPV+HNVLTLHSSANQG+  GDVTLFFGLSGTGKTTLSADPHR LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 271 DEHCWSDHGVFNIEGGCYAKCIDLTAEKEPEIYNAIKFGSVLENVVFDASNREVDYTDNS 330
           DEHCWSDHGVFNIEGGCYAKCI LT EKEPEI+NAIKFGSVLEN V+D +   VDY D+ 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 331 ITENTRCAYPIDYIPSAKIPCLADKHPSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGY 390
           ITENTRCAYPID+I SAKIPCL DKHP+N++LLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 391 TSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQHNANAWLVNTGWTGSS 450
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPM+YA MLA KM+ H A+AWL+NTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 451 YTAGGKRCPLKYTRAILDSIHDGSLSKADYETLPIFNLHTPAKVNGVPDSLLNPAKSWVE 510
           YTAGGKRCPLKYTRAILD+IH+GSL+  +YETLP+FNL  P  V  VP  LLNP+K+W +
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 511 GPTKYNSAVKTLATKFTENFKIYQDQATPDVLAAGPQF 548
               Y+ AVK L + F +NF IYQDQAT DV+AAGP  
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 63.5 bits (153), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 58/113 (51%), Gaps = 22/113 (19%)

Query: 377 LTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALHPMRYATMLAKKMHQHN 436
           LT E+VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 437 ANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKA-----DYETLP 484
            +A+L+NTG+             LK TR   DSIHD SL+K       Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>SAKL0B05126g Chr2 (442475..444595) [2121 bp, 706 aa] {ON} similar
           to uniprot|Q05670 Saccharomyces cerevisiae YMR232W FUS2
           Cytoplasmic protein localized to the shmoo tip required
           for the alignment of parental nuclei before nuclear
           fusion during mating
          Length = 706

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 15/119 (12%)

Query: 64  SGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWS-INRERAADYL---------R 113
           + SK GR  +DK II+++     + W   N+P+ +KT+S ++  +  DY+         +
Sbjct: 100 NASKRGRDEEDKEIIQKKPPSLNLVWDAFNEPSQKKTYSPLDLHKFKDYMTLESPRIDPK 159

Query: 114 TRDHLYIIDAYAGWDPRYRIKVRV---ICARAYHA--LFMTNMLIRPSPEELANFGEPD 167
             + L  I      + +Y   + +   +  R  H    F   +L + S EEL  FG  D
Sbjct: 160 LSNLLQTIQNLVETEEKYARVLEISNAVYRRELHENRKFKNKLLNKNSNEELLLFGNID 218

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query: 237 NQGIERGDVTLFFGLSGTGKTTLSADPHRAL-IGDDEHCWSDHGVFNIEGGCYAKCIDLT 295
           N  I  G+     G SG+GK+T+++   R   + +      D+ + N     Y + I  T
Sbjct: 467 NLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIG-T 525

Query: 296 AEKEPEIYNAIKFGSVLENVVF 317
            ++EP ++N    GS+L+N+++
Sbjct: 526 VQQEPSLFN----GSILDNIIY 543

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 24/99 (24%)

Query: 240 IERGDVTLFFGLSGTGKTTLSA--------DPHRALIGDDEHCWSDHGV--FNIEGGCYA 289
           +E G+     G SG+GK+T+++        +  R +IG       DH +  FN+    Y 
Sbjct: 463 VEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIG-------DHNINSFNVRK--YR 513

Query: 290 KCIDLTAEKEPEIYNAIKFGSVLENVVFDASNREVDYTD 328
           + + +  ++EP+++N    G++L+N+++       D  D
Sbjct: 514 RLLGI-VQQEPQLFN----GTILDNILYTVPPERADNDD 547

>TBLA0B00100 Chr2 (2396..7549) [5154 bp, 1717 aa] {ON} Anc_2.1 YNL242W
          Length = 1717

 Score = 31.2 bits (69), Expect = 9.6,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 334  NTRCAYPIDYI------PSAKIPCLADKHPSNIVLLTCDASGVLPPVSKLTPEQVMYHFI 387
            +T  A  +DY+       S K+ CL     S  +LLT +AS    P S     +++YH+I
Sbjct: 952  HTALALILDYLIINGSLSSLKVKCLLK---SGTILLTDNASTSSKPPSNKQSNRMLYHYI 1008

Query: 388  S-GYTS 392
            S GYT+
Sbjct: 1009 SQGYTT 1014

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,596,266
Number of extensions: 2638342
Number of successful extensions: 7020
Number of sequences better than 10.0: 30
Number of HSP's gapped: 7165
Number of HSP's successfully gapped: 30
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)