Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16434g5.707ON23723712451e-176
TPHA0E001805.707ON1651141404e-10
TDEL0B021305.707ON2082071408e-10
KNAG0L021605.707ON2091101195e-07
KAFR0D022005.707ON1821751114e-06
KLTH0E00946g5.707ON2152171082e-05
YIL152W5.707ON2351181082e-05
TBLA0I016905.707ON3201261057e-05
NCAS0G002105.707ON2881121048e-05
SAKL0E15026g5.707ON2901541039e-05
Suva_9.365.707ON2241071021e-04
Skud_9.165.707ON2261181002e-04
Smik_9.175.707ON251119930.002
Cgla_YGOB_Anc_5.7075.707ON13086850.007
Kpol_1043.745.707ON17796740.30
KLLA0E14191g8.94ON860155721.2
NDAI0F002705.707ON29834692.1
KNAG0B035705.550ON48493692.5
YDL162CsingletonOFF11844626.9
SAKL0D03883g3.252ON68655658.2
Kwal_55.196755.707ON23234639.9
NOTE: 1 genes in the same pillar as ZYRO0B16434g were not hit in these BLAST results
LIST: KLLA0A00506g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16434g
         (237 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...   484   e-176
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    59   4e-10
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    59   8e-10
KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...    50   5e-07
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    47   4e-06
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    46   2e-05
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    46   2e-05
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    45   7e-05
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    45   8e-05
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    44   9e-05
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     44   1e-04
Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)     43   2e-04
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     40   0.002
Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130...    37   0.007
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    33   0.30 
KLLA0E14191g Chr5 complement(1254213..1256795) [2583 bp, 860 aa]...    32   1.2  
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    31   2.1  
KNAG0B03570 Chr2 (689446..690900) [1455 bp, 484 aa] {ON} Anc_5.5...    31   2.5  
YDL162C Chr4 complement(167359..167715) [357 bp, 118 aa] {OFF} D...    28   6.9  
SAKL0D03883g Chr4 (317434..319494) [2061 bp, 686 aa] {ON} some s...    30   8.2  
Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 1...    29   9.9  

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score =  484 bits (1245), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/237 (100%), Positives = 237/237 (100%)

Query: 1   MDRKGSDLYRDARSKNPGALRLSQLAYKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHA 60
           MDRKGSDLYRDARSKNPGALRLSQLAYKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHA
Sbjct: 1   MDRKGSDLYRDARSKNPGALRLSQLAYKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHA 60

Query: 61  SFKRKPLSSINQKSYVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGEDIRDSYT 120
           SFKRKPLSSINQKSYVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGEDIRDSYT
Sbjct: 61  SFKRKPLSSINQKSYVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGEDIRDSYT 120

Query: 121 LRRRIRDDNEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLS 180
           LRRRIRDDNEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLS
Sbjct: 121 LRRRIRDDNEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLS 180

Query: 181 PFEIMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
           PFEIMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL
Sbjct: 181 PFEIMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 63/114 (55%), Gaps = 19/114 (16%)

Query: 129 NEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVIS 188
           N KC+S++       V+ L  ++N FN+++K S     YD + DI     LS  E +V +
Sbjct: 51  NFKCSSAS-------VSDLRLSINKFNMLLKASSNK--YDEIHDINSIEKLSQNEFIVTT 101

Query: 189 DDPRVKRAILHSHKAIPKFVNSPS------RLAICSKCCLTLYNDMNWYLKWKF 236
            D   K  ILHS++     VNS +      ++AI SK  L+LYND+NWYL WKF
Sbjct: 102 IDS--KTLILHSNE--KNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKF 151

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 93/207 (44%), Gaps = 24/207 (11%)

Query: 40  PLESKNVNV----TSLCGSKKIEHASFKRKPLSSINQKSYVVASQESNNAKPLDSILQNS 95
           P+  K  NV    +S     K+     K++ L   +     V ++ S    P   +++ +
Sbjct: 17  PIMGKRCNVLPDRSSRMPIGKLGSVVTKKRALRPTDVNVSAVFNRSSTCKIPDTGLMKAT 76

Query: 96  KVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDNEKCASSADKKKTNLVTQLICALNDFN 155
            +  + +  TT+ +ARG  ++      RR RD  +   +S DK   +L T +  AL+  N
Sbjct: 77  ALGGVLEEATTSRVARGRRVKPHL---RRSRD--QGLETSRDK---SLSTAVSVALSHLN 128

Query: 156 LMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILHSHKAIPKFVNSPSR-- 213
             ++    +   D L+     + LS  E++V++     +R I   H  IP      SR  
Sbjct: 129 TRIQV--LSGELDQLMAFERLVLLSQHELLVVT-----QRKIFVLHSVIPLTREGVSRFG 181

Query: 214 ---LAICSKCCLTLYNDMNWYLKWKFL 237
              LA+ S+C   LYND+ W+++WKF 
Sbjct: 182 ALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 133 ASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPR 192
           A  + +    LV QL  +L   N +V T+  +++YD LV +   + LS  E+M+ +    
Sbjct: 97  ALGSQQGTPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSS 156

Query: 193 VKRAILHSHKAIPKFV-----NSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
            KR +LHS+  +  F+     +    +A+ SK  + +  D+ W L+WK +
Sbjct: 157 -KRYVLHSNGPVHGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 78/175 (44%), Gaps = 26/175 (14%)

Query: 68  SSINQKSYVVASQESNNAKPLDSILQNSKVSKLSQPITTTNIARGEDIRDSYTLRRRIRD 127
           SS+N    +  S+E+     + +IL NS+V K++        AR  + R    L      
Sbjct: 28  SSMNSTHCLKNSKETQGRTQVITILNNSEVKKMT-------FARHWNERPHLNLL----- 75

Query: 128 DNEKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVI 187
             ++C      K  +L   L  +L D N +V  S+ N+ YD+L+ +  A  LS  E+++I
Sbjct: 76  --DEC-----NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTEMLII 128

Query: 188 SDDPRVKRAILHSHKAIPKFVNS-----PSRLAICSKCCLTLYNDMNWYLKWKFL 237
                  R IL  HK +    NS      + LA+ SK    L + + W L WK L
Sbjct: 129 PSTDEAMRYIL--HKPLTFRTNSVDNFTGAHLALNSKISFRLDDTLIWCLNWKLL 181

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 96/217 (44%), Gaps = 22/217 (10%)

Query: 27  YKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHASFKRKPLSSINQKSYVVASQESNNAK 86
           +++ S L++++  PL+ + VN++ L  S+K+   S    P S+ +  S +  +   +  K
Sbjct: 15  FRNLSTLASKERKPLQPRPVNISQLVASQKLR--SPPNTPASAKSPASLLSNAISRSRPK 72

Query: 87  PLDSILQN-SKVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDNEKCASSADKKKTNLVT 145
             D  L++ ++V      +T T        +  Y  R + R D    A  A K   N + 
Sbjct: 73  SHDGSLRSVAQVIGSDYHLTPT--------KPHYRARAKKRYD---LAFPAGKALVNRLL 121

Query: 146 QLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRA-ILH----S 200
           + + A      + +       YD  + +++   LSP E++ ++  P  +   ILH    +
Sbjct: 122 KCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLPST 181

Query: 201 HKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
             A PK   S S+L + S     LY  + WY +W+ +
Sbjct: 182 KDAEPK---SGSQLLLSSNASALLYPGLRWYFEWRVI 215

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMVIS 188
           EK   +     + LV+QL  ++ D + +++T      +D ++ D   A  LS  E+++  
Sbjct: 124 EKQPQTFYNTDSKLVSQLHSSVKDLDAIIQT--HKPKFDTIIRDFSQATILSSNELLI-- 179

Query: 189 DDPRVKRAILHSHKAIPKF--------VNSPS-RLAICSKCCLTLYNDMNWYLKWKFL 237
             P+ +  ILHS    PK         VN PS  L I S+  LTL N++ WYL WKF+
Sbjct: 180 KLPKDQTIILHS--RAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 119 YTLRRRIRDDNEKCASSA---DKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRH 175
           YT  + I+ +  K A S    +  KT LV  L   L++ N  + +S+ N  +D +  I  
Sbjct: 198 YTKHKSIKQNFLKVAYSKSYNEYLKTPLVNGLHTILSNLNTRIHSSR-NLKFDKIFQISK 256

Query: 176 AIWLSPFEIMVISDDPRVKRAILHSHKAIPK--FVNSP--SRLAICSKCCLTLYNDMNWY 231
              LS  E++VI++       +LHS   I +  F N     ++A  S   L +  D+NWY
Sbjct: 257 LTKLSDTELLVITNTN--SSLLLHSDSTIGQSEFNNYTLKEKVATNSISILKITEDLNWY 314

Query: 232 LKWKFL 237
           LKWKF+
Sbjct: 315 LKWKFI 320

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 20/112 (17%)

Query: 143 LVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISD-DPRVKRAILHSH 201
            VT L   L D + M+KTS++  +YD +  I     LS FE+ V +   P++   ILH+ 
Sbjct: 177 FVTSLQKYLCDLDTMMKTSKK-FSYDSVWTINSITKLSDFELQVTTQMSPQL--IILHNK 233

Query: 202 KAI---P--KFVNSPS-----------RLAICSKCCLTLYNDMNWYLKWKFL 237
            +I   P  KF++  S           +LAI SK  + + +D+NWY+ WKF+
Sbjct: 234 TSINNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 88  LDSILQNSKVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDNEKCASSADKKKTNLVTQL 147
            D+ILQ+S     S   +T     G     S  ++R +  +      SA   K +++ +L
Sbjct: 140 FDAILQSSIAGGNS--TSTDGRTGGTKFTGSSNVQRYLHPEF-----SASLSKDSMLFRL 192

Query: 148 ICALNDFNLMVKTSQQ--NQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILH--SHKA 203
             +L DFN + K S      NYDI++ +     LSP E++VIS +      +LH   +KA
Sbjct: 193 QKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSE-CAHAIVLHRFKNKA 251

Query: 204 IPKFV-NSPSRLAICSKCCLTLYNDMNWYLKWKF 236
            P+   +   +L + S+  + LY  + WY  W F
Sbjct: 252 FPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYF 285

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 16/107 (14%)

Query: 141 TNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMV--ISDDPRVKRAI 197
           + LV+QL  ++ D + +V+T      +D ++ D+ H   LSP E+++   ++D      I
Sbjct: 124 SRLVSQLHSSVKDLDTIVQT--HKPRFDTIIHDLSHTTILSPNELLIKLHTED----TII 177

Query: 198 LHSHKAIP-------KFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
           LHS   I        K  N+ + L I S+  L L +++ WYL WKF+
Sbjct: 178 LHSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMVIS 188
           EK + +  +  + LV+QL  ++ D + +V+T      +D ++ D+ H   LS  E+++  
Sbjct: 115 EKQSLTFYRTDSKLVSQLHTSVKDLDTIVQT--HKPRFDTIIHDLSHTAILSSNELLI-- 170

Query: 189 DDPRVKRAILHSHKAIPKF--------VNSPS-RLAICSKCCLTLYNDMNWYLKWKFL 237
             P     ILHS   IPK          + PS  L I S+  L L N++ WYL WKF+
Sbjct: 171 KLPMNDTIILHS--RIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 18/119 (15%)

Query: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLS-------- 180
           EK         + LV+QL  ++ D + +++T      +D ++ D+     LS        
Sbjct: 140 EKIPQGFYSSDSKLVSQLHSSVKDLDAIIQT--HKPKFDTIIHDLSRTTILSSNELLIKL 197

Query: 181 PFE--IMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
           P E  I++ S  P +    LH+     K  N  + L I S+  L L N++ WYL WKF+
Sbjct: 198 PMEETIILHSRTPTINEEWLHN-----KVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Cgla_YGOB_Anc_5.707 Chr8 complement(657571..657963) [393 bp, 130
           aa] {ON} ANNOTATED BY YGOB -
          Length = 130

 Score = 37.4 bits (85), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 2/86 (2%)

Query: 151 LNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILHSHKAIPKFVNS 210
           L+ F  +++  Q+ +   I V +   I LSP EIMV ++   V+  ILHS+  +      
Sbjct: 46  LHSFKTVLR--QRAEGATISVPVCRCIQLSPNEIMVWTNANGVEPLILHSNTKLQIATTK 103

Query: 211 PSRLAICSKCCLTLYNDMNWYLKWKF 236
            +R+  C      L   ++WY +W+ 
Sbjct: 104 YTRIQYCPSNKFQLTRRISWYFQWEL 129

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 14/96 (14%)

Query: 150 ALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEI--MVISDDPRVKRAILHSHK----- 202
           +L  FN +V++    + +D +  I H   LS F+I  +V+  +   K  IL+ +      
Sbjct: 84  SLYVFNTIVRSGSLLK-FDHVWHILHFQLLSQFQIYCLVVDHNEMTKNIILYKNNNNNNN 142

Query: 203 ---AIPKFVNSPSRLAICSKCCLTLYNDMNWYLKWK 235
               +P    + +++AI S   + LY ++NWYL W+
Sbjct: 143 ANITLPT---TFAKIAINSNSFVHLYGNVNWYLHWR 175

>KLLA0E14191g Chr5 complement(1254213..1256795) [2583 bp, 860 aa]
           {ON} similar to uniprot|P34077 Saccharomyces cerevisiae
           YFR002W NIC96 Component of the nuclear pore complex
           required for nuclear pore formation forms a subcomplex
           with Nsp1p Nup57p and Nup49p
          Length = 860

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 67/155 (43%), Gaps = 19/155 (12%)

Query: 30  SSLLSTRKNLPLESKNVNVTSLCGSKKIEHASFKRK--PLSSINQKSYVVASQESNNAKP 87
           + LL T KNLP  S ++    L  ++  + A   RK  P  S + K++ + +        
Sbjct: 35  NELLETSKNLPSTSSDLGAILLSVNEMKKRAQEMRKTIPHDSNHTKAHYLLAGSGLEFHE 94

Query: 88  LDSILQNSKVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDN-----EKCASSADKKKTN 142
           ++S L+N K S+L   +T   +A+G +  D  T     +D+N     E+  S A K   N
Sbjct: 95  IESSLKNLKSSEL---LTEQRVAQGYNDGDLDTYLHIKKDENILSSIEQSLSLAAKDFDN 151

Query: 143 LVTQLIC---------ALNDFNLMVKTSQQNQNYD 168
            + Q                F ++VK  Q + NYD
Sbjct: 152 FINQNFNLDWKQRKDEVRESFGILVKKRQDSSNYD 186

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 204 IPKFVNSPSRLAICSKCCLTLYNDMNWYLKWKFL 237
           +P  ++   +LA+ SK  L L  ++ WYL WKF+
Sbjct: 265 LPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>KNAG0B03570 Chr2 (689446..690900) [1455 bp, 484 aa] {ON} Anc_5.550
           YML017W
          Length = 484

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 44  KNVNVTSLCGSKKIEHASFKRKP---LSSINQKSYVVASQESNNAKPLDSILQNSKVSKL 100
           K+VN +    +  + H+ F   P   +  +NQ+ +  ++++     P  S ++N+     
Sbjct: 282 KSVNDSKKSTAHPLTHSHFSPSPPQTMPHLNQRGF--SARDHGTDGPTKSFVENTAGVDE 339

Query: 101 SQPITTTNIARGEDIRDSYTLRRRIRDDNEKCA 133
           + P  TT+    ++  DS+T +   R+D+++  
Sbjct: 340 NDPQVTTSTRERDNTGDSFTFKNGNREDSQRNG 372

>YDL162C Chr4 complement(167359..167715) [357 bp, 118 aa] {OFF}
           Dubious open reading frame unlikely to encode a protein,
           based on available experimental and comparative sequence
           data; partially overlaps ENT1/YDL161W, a verified gene
           involved in endocytosis and actin cortical patch
           assembly
          Length = 118

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 3/44 (6%)

Query: 184 IMVISDDPRVKRAILHSHKAIPKFVNSPSRLAICSK---CCLTL 224
           +  ISD+   K      HKA P F  + +R + CS+   CCLTL
Sbjct: 45  VATISDNHTSKIKYFEQHKAPPTFRKTCNRNSYCSRWFYCCLTL 88

>SAKL0D03883g Chr4 (317434..319494) [2061 bp, 686 aa] {ON} some
           similarities with uniprot|P38229 Saccharomyces
           cerevisiae YBR045C GIP1 Meiosis-specific regulatory
           subunit of the Glc7p protein phosphatase
          Length = 686

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 3/55 (5%)

Query: 155 NLMVKTSQQNQNYDILVDIRHAIWLSP---FEIMVISDDPRVKRAILHSHKAIPK 206
           NL       N+N D+ VD    +   P   FEI  + +DP   R  LH  K   K
Sbjct: 60  NLKPTRDSSNENEDVTVDENDDLLFIPKFTFEIKTVQEDPVSPRQALHKLKEFMK 114

>Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig
          159] FULL
          Length = 232

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 25/34 (73%)

Query: 27 YKSSSLLSTRKNLPLESKNVNVTSLCGSKKIEHA 60
          +K+ + LS+R+  PL+ K+VN++ L  S+K ++A
Sbjct: 15 FKNITALSSRERKPLQPKSVNISQLVASQKQDNA 48

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,541,735
Number of extensions: 1073478
Number of successful extensions: 4461
Number of sequences better than 10.0: 103
Number of HSP's gapped: 4633
Number of HSP's successfully gapped: 105
Length of query: 237
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 131
Effective length of database: 41,326,803
Effective search space: 5413811193
Effective search space used: 5413811193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)