Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16412g5.706ON137295849140.0
TDEL0B021405.706ON114796031560.0
KAFR0H001805.706ON124198829550.0
SAKL0E15004g5.706ON119697429290.0
KNAG0C066305.706ON1281101129230.0
NCAS0A031705.706ON1319103829080.0
Smik_11.3605.706ON118097228350.0
Suva_11.3335.706ON118797228080.0
CAGL0G02541g5.706ON129596128000.0
Skud_11.3365.706ON118897227740.0
Kwal_55.196785.706ON117896627570.0
Kpol_1043.735.706ON126096727550.0
KLTH0E00968g5.706ON114897827390.0
YKR096W5.706ON119597427070.0
TPHA0E001905.706ON136199226440.0
AFR290W5.706ON121796926020.0
Suva_9.375.706ON111796925750.0
Ecym_40155.706ON125797625650.0
YIL151C5.706ON111896925630.0
Skud_9.175.706ON111896825620.0
Smik_9.185.706ON111896725210.0
CAGL0H06611g5.706ON1282101625040.0
KLLA0A00528g5.706ON122997423970.0
NDAI0E050705.706ON155637613901e-166
TBLA0E017105.706ON152640911261e-129
TPHA0D046405.706ON9628613252e-29
Skud_3.781.429ON57950754.2
NCAS0A105703.269ON22557734.4
Suva_3.391.429ON58352738.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16412g
         (1372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1897   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1220   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1142   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1132   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1130   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...  1124   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1096   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1086   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1083   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1073   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1066   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1065   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1059   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1047   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...  1023   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1006   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   996   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   992   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   991   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   991   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   975   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   969   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   927   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   540   e-166
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   438   e-129
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   129   2e-29
Skud_3.78 Chr3 complement(121467..123206) [1740 bp, 579 aa] {ON}...    33   4.2  
NCAS0A10570 Chr1 complement(2105372..2106049) [678 bp, 225 aa] {...    33   4.4  
Suva_3.39 Chr3 complement(52950..54701) [1752 bp, 583 aa] {ON} Y...    33   8.2  

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1897 bits (4914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/958 (94%), Positives = 908/958 (94%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA
Sbjct: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQTEQDIL              LWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS
Sbjct: 475  LLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY
Sbjct: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI
Sbjct: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR
Sbjct: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HAPAFAESHILQLVGFGDPKNPFALLFELPRFL                       MAID
Sbjct: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTMAID 774

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
            DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK
Sbjct: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
            GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM
Sbjct: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
            LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED
Sbjct: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
            LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP
Sbjct: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
            VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE
Sbjct: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV 1134
            NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV
Sbjct: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV 1134

Query: 1135 IPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSSTTYFVLD 1194
            IPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSSTTYFVLD
Sbjct: 1135 IPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSSTTYFVLD 1194

Query: 1195 TTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSE 1254
            TTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSE
Sbjct: 1195 TTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSE 1254

Query: 1255 GKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNXXXXXXXXX 1314
            GKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMN         
Sbjct: 1255 GKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQ 1314

Query: 1315 XXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372
                RAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN
Sbjct: 1315 QHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

 Score =  406 bits (1043), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 223/332 (67%)

Query: 1   MIETFNHAKRRQTDKNTNDSSMIGMTPSFTNEINNSTGGVGDASAAAQSVFGTITGDLTR 60
           MIETFNHAKRRQTDKNTNDSSMIGMTPSFTNEINNSTGGVGDASAAAQSVFGTITGDLTR
Sbjct: 1   MIETFNHAKRRQTDKNTNDSSMIGMTPSFTNEINNSTGGVGDASAAAQSVFGTITGDLTR 60

Query: 61  EDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLKRSSSNTYNYVSANFVKRR 120
           ED                                     RLKRSSSNTYNYVSANFVKRR
Sbjct: 61  EDSDNNNSNNNGEMNNSNNMSSSINPNVNPSINASNINPRLKRSSSNTYNYVSANFVKRR 120

Query: 121 LPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAPTSRRPSLPKKAIDTXXXXXXXXX 180
           LPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAPTSRRPSLPKKAIDT         
Sbjct: 121 LPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAPTSRRPSLPKKAIDTSSASNYGGA 180

Query: 181 XXXXXXXXXXXXCSLPNVSTFVSNVDLASKAAIENSVQKLPCLERNSSNYLQTTPSRLDT 240
                       CSLPNVSTFVSNVDLASKAAIENSVQKLPCLERNSSNYLQTTPSRLDT
Sbjct: 181 GGGGTYALGSPYCSLPNVSTFVSNVDLASKAAIENSVQKLPCLERNSSNYLQTTPSRLDT 240

Query: 241 PYLSQDQNSNKYYHHGISAYPPVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
           PYLSQDQNSNKYYHHGISAYPPV                                     
Sbjct: 241 PYLSQDQNSNKYYHHGISAYPPVNSGDNSNHHNNMNTNSNTTNNDNDNNNNNTNYYNNHN 300

Query: 301 XRRQNETSKIADIQXXXXXXXXXXXXXFDIKE 332
            RRQNETSKIADIQ             FDIKE
Sbjct: 301 NRRQNETSKIADIQNSVSVANTNNNNNFDIKE 332

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1220 bits (3156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/960 (63%), Positives = 700/960 (72%), Gaps = 52/960 (5%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIYKVIVKQEIELQERCSQLT SQTTELK LW IYK+NSDLINNYVTF+TTA
Sbjct: 238  QALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTA 297

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLP Q++QD+               LWVYGTITFLD+ KNFSNFMDPEVC QFITHVFIS
Sbjct: 298  LLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFIS 357

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNML DIP +Y IPW QRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMK+ Y HGKLY
Sbjct: 358  ISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLY 417

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQRAFVERNNGNHRN+QLI
Sbjct: 418  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLI 477

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLLPSFLES DLQQVVLIYF+ KFG D+N  NIFDTR+MF QNPD L+YFFR
Sbjct: 478  EYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFR 537

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HAPAFAESHILQLVGFGDPKNPFALLFELPR L                       MAID
Sbjct: 538  HAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSAMAID 597

Query: 775  DLE--DEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKF 832
            + E  D      +  + FF NI++L  PY  P +LE+WN SL Y+N+TSL CSM+VL+KF
Sbjct: 598  EEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKF 657

Query: 833  LKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIA 892
            L+GP+VVALPH +PW YFII++  K++ +   +SR+FW+E V+RIFPWNTIV+FLNVLIA
Sbjct: 658  LEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIA 717

Query: 893  YMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHV 952
            Y LDN   S  +D LC + S+MGL+ L+++FNNNE LPEVWKCWG LWFD IC+K++  +
Sbjct: 718  YTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQM 777

Query: 953  EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPV 1012
            +  ES GIK+HMFLD PIDGI FD +DESG  FWKRACR+IFLFK +AENF   + +S  
Sbjct: 778  DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQ 837

Query: 1013 APVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEAS 1072
            A V+CRR D    H+LKSF FKLR                T       L+NT+E+FEE S
Sbjct: 838  AQVHCRRTD-PMNHVLKSFCFKLR---------------DTFYNSNSVLQNTIEVFEEGS 881

Query: 1073 WENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNT 1132
              N  M   P LSV+E ESIF Y GY+RL  D   YD+ GEF+S SLYTSW    N  + 
Sbjct: 882  DANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSW---GNETSK 938

Query: 1133 GVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSSTTYFV 1192
              IP       S+    Q+  E  +F + +            F  D      +   T+FV
Sbjct: 939  NEIP------QSEPTQQQTANEADLFIEGINTSLTE------FNIDFPECKMNGKDTFFV 986

Query: 1193 LDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLY 1252
            LD T+WLRHF H+YKLAS+ VL+FAICLTTF ELRFLRK KDENVVEAATRA+ITVRQLY
Sbjct: 987  LDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLY 1046

Query: 1253 SEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNXXXXXXX 1312
            +E ++LPLRFTGNVATHIEEHLEFEE+ITWRSHVDEFV EA+ KAQ++  + N       
Sbjct: 1047 TENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQEN------- 1099

Query: 1313 XXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372
                             VVLVTDD+NMR+KAQ   + T ST+FVF+ CN++G R KICTN
Sbjct: 1100 ------------RDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 13/72 (18%)

Query: 100 RLKRSSSNTYNYVSANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-T 158
           R KR SSN YN   +  VKRR+ N ++     +QFLD    GAI      PNTP K P +
Sbjct: 45  RQKRHSSNPYNSAESTGVKRRVANHDDGI---TQFLD---NGAI------PNTPCKEPVS 92

Query: 159 SRRPSLPKKAID 170
           SRRPS  ++ ++
Sbjct: 93  SRRPSATRRTVN 104

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/988 (58%), Positives = 702/988 (71%), Gaps = 58/988 (5%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            + L++KLQ+IYK+IVKQE+ELQ+RCSQLTTSQTTELKNLW+IYK+N+DLINNY+TF+TTA
Sbjct: 282  RVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITFITTA 341

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ+ QDI               LWVYGTITFLD+ KNFSNFMDPEVC QFITHVFIS
Sbjct: 342  LLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 401

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +S ML D+PPK+ IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY
Sbjct: 402  LSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 461

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERN-NGNHRNTQL 653
            YHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR FV+RN NGN RN+ L
Sbjct: 462  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVRNSDL 521

Query: 654  IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFF 713
            I+YLKHSEVMLLPSFLE+ DLQQVVL YF  +FG D N+ NIF+T+ MF Q P  LR++F
Sbjct: 522  IDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASLRFYF 581

Query: 714  RHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAI 773
            RHAPAFAESHILQLVGFG+PKNPFALLF+LP FL                       M+I
Sbjct: 582  RHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEIST---MSI 638

Query: 774  DDLEDEQSDRMSTP----EG-----FFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKC 824
            D   D +   ++T     EG     +F NI++LR P   P N+ +W +SL ++NMTSLKC
Sbjct: 639  D-TNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKC 696

Query: 825  SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIV 884
            S++VL+KFL+GPL++ALPH +PWTYFII+   K +   + SS KFW   + RI PWNT+ 
Sbjct: 697  SVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLT 756

Query: 885  SFLNVLIAYMLDNSWKSSLVDSLCGQYSSM-GLEDLLDYFNNNEVLPEVWKCWGTLWFDT 943
            SFLNVL+AY+LDN +++  +  LC  YS+     +LLDYFN NE LPE+WKCWGTLWFD 
Sbjct: 757  SFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDV 816

Query: 944  ICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENF 1003
            I NK   + +    +GI++HMFLD P+DGI FD  DE+GENFW RA RI+FLFKG+AEN 
Sbjct: 817  ISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENL 876

Query: 1004 PIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKN 1063
              G+ +S  APV+CRR+D+ P HILKSFSFK+    +S        QP +T      +  
Sbjct: 877  QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSY----SGQPFST------INK 926

Query: 1064 TLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSW 1123
             L +FE     N+  D  PMLSV++GE+IF+Y GY++L  +  S+D+NGE +S+S+YT+W
Sbjct: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 1124 YANNNT---NNTG---------------VIPAHGSDVDSQRDAV-QSVQEMHIFNQIMEP 1164
              +N+    N+ G               ++P    +   +  A  +  ++   F   M P
Sbjct: 987  VIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNP 1046

Query: 1165 GYCGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFH 1224
                   D   +        + + TYFV D T+WLRHF HIYKL+++ VL FA+CLTTF 
Sbjct: 1047 EKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQ 1106

Query: 1225 ELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRS 1284
            ELRFLRK KDENVV AA RAIIT+RQLYSEGKLLPLRFTGNVAT IEEHLEFEE+ITWRS
Sbjct: 1107 ELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRS 1166

Query: 1285 HVDEFVIEAVYKAQSKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQ 1344
            HVDEFVIEAV KAQ+KF   N                  R G   VVLVTDD NM++KAQ
Sbjct: 1167 HVDEFVIEAVVKAQNKFISANESVTL-------------RKGFNHVVLVTDDINMKRKAQ 1213

Query: 1345 DQDVRTFSTKFVFSLCNSIGLRSKICTN 1372
            +Q ++TF+T F+FS+C  +G++  +CTN
Sbjct: 1214 EQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/974 (57%), Positives = 705/974 (72%), Gaps = 37/974 (3%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIY+ IVKQEIELQERCSQLT SQTT++KNLW IYK+N++LINNY++F+TTA
Sbjct: 244  QALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTA 303

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ EQD+L              LWVYGTITFLD+ KNFSNFMDPEVCCQFI+HVF+S
Sbjct: 304  LLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMS 363

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNMLGD+PP+Y IPWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +TY HGKLY
Sbjct: 364  ISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLY 423

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAF ER+ G+ RN  ++
Sbjct: 424  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIV 483

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLLPSFLES +LQ+VVL +F+ +FG   NNV+ FD +++F Q+ + LRYFF 
Sbjct: 484  EYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFS 543

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HAPAFAESHILQLVGFGDP+NPFA+LFELP+FL                           
Sbjct: 544  HAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPT------- 596

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
            +L+D       + + +F NI++ R PYS P +++IW +SL+Y+N+TS++CSM VL+KFL 
Sbjct: 597  NLDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLH 656

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
             PL+ ALPH +PW +F++S+A +I  L+ ++ +KFW+ F+ RIFPWN++VSFLN L+A++
Sbjct: 657  APLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFL 716

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
            LDNS   S V+ LC +Y+ M L  L+++F N+E LPEVWKCWGTLWFDTI NK +     
Sbjct: 717  LDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASS 776

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
            ++S GI++H+FLDAPIDGI FD +DESG  FWKRACR+IF+FKG+A+ F  GI +S   P
Sbjct: 777  VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDT-P 835

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
            +  RR DV+  H LK FSFK       EL     PQ     + L    N +++FE  S  
Sbjct: 836  ISTRR-DVTTLHALKRFSFKFE-----EL-----PQEWDNEVFLQS-DNFIKVFEPISPI 883

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTS------------ 1122
            N + + +P LS+I+GESIF++ GYRR++PDY+ ++KNG+ ++ SLYTS            
Sbjct: 884  NSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGD 943

Query: 1123 -WYANNNTNNTGVIPAHGSDVDSQRDAVQSV---QEMHIFNQIMEPGYCGGFADDLFLRD 1178
             +    +  N  ++ AH S VD      +++    E    N  M+P +     D  F   
Sbjct: 944  DFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHG 1003

Query: 1179 ALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVV 1238
             L   A S+ TYFVLD T+WLRHF H+YKLA++ VLKFAICLTTF ELRFLRK KDE+VV
Sbjct: 1004 DLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVV 1063

Query: 1239 EAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQ 1298
            EAATRA+IT RQLY E KLLPLRFTGN+ATH+EEHLEFEE+ITWRSHVDEFVIEAVYK+Q
Sbjct: 1064 EAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQ 1123

Query: 1299 SKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFS 1358
             KF+ +N                DD     FVVLVTDD NMR KA+  D+  FS++F+F+
Sbjct: 1124 RKFKGLNLQARDQGQEYIPTDPKDD-DKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFA 1182

Query: 1359 LCNSIGLRSKICTN 1372
             CN +G   K+C N
Sbjct: 1183 FCNQLGYNQKVCIN 1196

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1011 (57%), Positives = 695/1011 (68%), Gaps = 71/1011 (7%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKIN+DLINNY TF+TTA
Sbjct: 289  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTFITTA 348

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ  QDIL              LWVYGTITFLD+ KNFSNFMDPEVC QFITHVFIS
Sbjct: 349  LLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITHVFIS 408

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +S +L DIPPK+ IPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY
Sbjct: 409  LSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 468

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERN-NGNHRNTQL 653
            YHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR FV+RN  GN+RN  L
Sbjct: 469  YHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYRNPDL 528

Query: 654  IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFF 713
            I+YLKHSEVMLLPSFL S DLQQVVL YF+ +FG D +  NIFDT+ MF Q P  LR+FF
Sbjct: 529  IDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFF 588

Query: 714  RHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXX--- 770
            RHAPAFAESHILQLVGFG+PKNPFALLFELP++L                          
Sbjct: 589  RHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSSTAPK 648

Query: 771  ----MAIDDLEDEQSD------RMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMT 820
                 A D++ +  +D       +S PE +  NIETL++    P ++  W +SL++INMT
Sbjct: 649  TVDDQATDNVNEGTNDDHELTATLSGPE-YLDNIETLKYAIETP-DICTWIKSLDFINMT 706

Query: 821  SLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPW 880
            SLKCSM+VL+KFL GPL++ALPHF+PWT FII+   K+ +L +E + KFW   + RIFPW
Sbjct: 707  SLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPW 766

Query: 881  NTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLW 940
            +TI SFLNVL+AY+LDN   +++++ LC QYS M L+D+L +FN +E LPEVWKCWGTLW
Sbjct: 767  DTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLW 826

Query: 941  FDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLA 1000
            +D ICNK     +     GI +HMFLD PIDGI FDA DE+G  FWKRA R+IFLFKG++
Sbjct: 827  YDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGIS 886

Query: 1001 ENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH 1060
            + F  G+ +S  A VYCR N+ +    L+ F+FKL           +  +P+++  +   
Sbjct: 887  KKFDFGLKISHEAGVYCR-NEKAADSPLRRFTFKLE----------SYDEPTSSKFN--- 932

Query: 1061 LKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLY 1120
                + + EE S  N      P LSV++GE+IF+Y GYR L  D  S+DKNGE +S+S+Y
Sbjct: 933  --EFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIY 990

Query: 1121 TSWY-------------ANNN--TNNTGVIPAHGSDVDSQRDAVQSVQEMHI-------- 1157
            TSW               +NN  +   G + A+G+ + +   A       H+        
Sbjct: 991  TSWMIDTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGL 1050

Query: 1158 -----FNQIMEPG-------YCGGFADDLFLRDALYQTAHSS----TTYFVLDTTTWLRH 1201
                 F + M  G       Y        +L   L++++        T+F+ D T+WLRH
Sbjct: 1051 NENDLFKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRH 1110

Query: 1202 FGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLR 1261
            F HIYK+A++GVLKF +CLTTF ELRFLRK KDENVVEAA RAIIT+RQLY E +LLPLR
Sbjct: 1111 FAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLR 1170

Query: 1262 FTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNXXXXXXXXXXXXXRAH 1321
            FTGNVA  IEEHLEFEE+ITWRSHVDEFVIEAV KAQ KF                 R  
Sbjct: 1171 FTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVP 1230

Query: 1322 DDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372
                   +V LVT+D NM++KAQDQ ++TFST FVFSLC+ +G+   +CTN
Sbjct: 1231 LGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1038 (56%), Positives = 710/1038 (68%), Gaps = 96/1038 (9%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            +ALV+KLQDIYKVIVKQEIELQERCSQLTTSQTT+LKNLWTIYK+N DLINNYVTF+TTA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL SQ++QD+               LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVFIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +S ML DIP KY IPWLQRLGDLSRMAIALYPSGFIDWKLSAE WYMEAMKFTY+HGKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAFVERNNGN+RN QLI
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI 537

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGC-------------------DSNNVNI 695
            EYLKHSEVMLLP+FLE+++LQQVVL+YF+ KFG                    ++  +++
Sbjct: 538  EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM 597

Query: 696  FDTRKMFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXX- 754
            F +R MF QNP+ L+YFFRHAPAFAESHILQLVGFGDPKNPFALLFELP++L        
Sbjct: 598  FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDKKE 657

Query: 755  ---------------XXXXXXXXXXXXXXXXMAIDDLEDEQSDRMS---TPEGFFGNIET 796
                                           M  DD+ +  SD +    T E FF NIE 
Sbjct: 658  KKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ 717

Query: 797  LRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAY 856
            LRF Y +P++LEIW  SLN+IN+ SLKCSM+VL+KFL GPL++ALPH +PW YFIIS+  
Sbjct: 718  LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL 777

Query: 857  KIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLDN---SWKSSLVDS------- 906
            K + L HE S+ FW+  +  IFPWN I++FLNVL+ Y LDN      S++ D+       
Sbjct: 778  KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV 837

Query: 907  ----LCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVEDLESVGIKN 962
                LC +YS+MG  DLL +FN NE LPEVWKCWGTLWFDTI NK     +  E++GIK+
Sbjct: 838  FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD 897

Query: 963  HMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENF-PIGITLSPVAPVYCRRND 1021
            HMFLD PIDGI +   DE+GENFWKR  RIIFLFKG+AENF  +G+ +S  A    R N+
Sbjct: 898  HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN 957

Query: 1022 VSPYHILKSFSFKLRRGSDSELVPMNPPQPST--TAIDLDHLKNTLEIFEEASWENIHMD 1079
            V   +ILK FSFK   GS+++ V  N        T   ++ +   ++I E     N++ +
Sbjct: 958  VPMDNILKMFSFKWA-GSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNLNFE 1016

Query: 1080 TIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGVIPAHG 1139
              P+ S+I  E IFDY GY++L P+  S+DKNGEF S S+YT+W  + +     +I A  
Sbjct: 1017 IPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQ----LILAQN 1072

Query: 1140 SD-----VDSQRD---AVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSST--- 1188
            ++      D   D      S+ E+  F Q+  P +          RD     + +ST   
Sbjct: 1073 NNNNTNATDEMTDLFTGTLSIDELS-FRQLKRPEF----------RDKSTLLSSTSTEPF 1121

Query: 1189 ----TYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRA 1244
                TYFV D T+WLRHF HIYKLAS+ VLKFA+CLTTF ELRFLRK KD NVVEA+TRA
Sbjct: 1122 NRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRA 1181

Query: 1245 IITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEM 1304
            IIT+RQLYS+G LLPLRFTGNVAT IEEHLEFEE+ITWRSHVDEFVIEAV KAQ KF + 
Sbjct: 1182 IITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKS 1241

Query: 1305 NXXXXXX---------XXXXXXXRAHDDRSGL-KFVVLVTDDSNMRKKAQDQDVRTFSTK 1354
                                      +++S L K+VVL+TDD +MR KAQ + + TF T+
Sbjct: 1242 KTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQ 1301

Query: 1355 FVFSLCNSIGLRSKICTN 1372
             VFS+C+ +G+   +CTN
Sbjct: 1302 VVFSVCSMMGIDEGVCTN 1319

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 10/78 (12%)

Query: 100 RLKRSSSNTYNYVSAN-FVKRRLPNQEEIFPQQSQFLD-----TSLTGAINQSISVPNTP 153
           R KR SSN+Y+    N  VKRR+   EE+     +++D     T+ TG  N  I    TP
Sbjct: 53  RQKRHSSNSYSNAKNNPAVKRRIAKPEEV---SLKYIDNMEYGTATTGN-NSIICQQQTP 108

Query: 154 SKAPTSRRPSLPKKAIDT 171
           SK   SRRPSL KK +++
Sbjct: 109 SKGTLSRRPSLIKKQMNS 126

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/972 (55%), Positives = 677/972 (69%), Gaps = 61/972 (6%)

Query: 416  ALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTAL 475
            AL+QKLQ++Y+VIVKQEIELQERCSQLT SQTTELK+LWTIYKIN++L+NNYVTF+TTAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 476  LPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISI 535
            LPSQ   D++              LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVFIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 536  SNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYY 595
            S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+HGKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 596  HMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIE 655
            HMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN RN+ LIE
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494

Query: 656  YLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRH 715
            YLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ +YFFRH
Sbjct: 495  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRH 554

Query: 716  APAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAIDD 775
             P+FA+SHILQ+VGFG+PKNPFA+LFELP++L                            
Sbjct: 555  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSR 614

Query: 776  LEDEQSDR-------MSTPE---GFFGNIETLRFPYSVPSNL--EIWNESLNYINMTSLK 823
              +E  D        MS P+    FF +I+TLR P  +PS L  E W E+L ++NMTSLK
Sbjct: 615  NGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 673

Query: 824  CSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTI 883
            C M+VL+KFL GPL VALPH +PW YFIIS+  K   LN   S++FW+  + R+FPW+T+
Sbjct: 674  CGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTM 733

Query: 884  VSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDT 943
            V+F+NVLIAY+LDN   +S++  LC +YS + L +LL+ FN NE LPE+W CWGTLWFD 
Sbjct: 734  VTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWFDA 793

Query: 944  ICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLA 1000
            IC K    +   ++ + +GI+++M LD+P DGI FD  DE+GE FWKRACRIIFLF+ ++
Sbjct: 794  ICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVS 853

Query: 1001 ENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH 1060
             +FP+G+ +     V C  + +   +IL+   +KL         P+   + S     L  
Sbjct: 854  RSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLE--------PLTNIRSSVPV--LST 901

Query: 1061 LKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLY 1120
            L++  +I E  S  N  +  +P LSVI G++IF Y GY++L PDY  +DKNGEFLSASLY
Sbjct: 902  LESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLY 961

Query: 1121 TSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDAL 1180
            TSWY  N  NN     ++ ++ +++   ++ ++ +H                     +  
Sbjct: 962  TSWYVPNCNNNLETNISYANERENEALFLECMKSVH--------------------PEIA 1001

Query: 1181 YQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEA 1240
            Y      TTYFV D T+WLRH   I+KLA + +L+FAICLTTF ELRFLRK KDENV+EA
Sbjct: 1002 YPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEA 1061

Query: 1241 ATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK 1300
            ATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++ KAQ K
Sbjct: 1062 ATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK 1121

Query: 1301 FQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLC 1360
             +                + +       +VVL++DD  M+KKA+++ +RT ST+FVFSLC
Sbjct: 1122 LEN-------------AKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLC 1168

Query: 1361 NSIGLRSKICTN 1372
              +G +  +CT+
Sbjct: 1169 TKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1086 bits (2808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/972 (56%), Positives = 682/972 (70%), Gaps = 66/972 (6%)

Query: 416  ALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTAL 475
            AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+IN++L+NNYVTF+TTAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 476  LPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISI 535
            LPSQ + D++              LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVF+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 536  SNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYY 595
            S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 596  HMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIE 655
            HMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN RN+ LIE
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 506

Query: 656  YLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRH 715
            YLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ +YFFRH
Sbjct: 507  YLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRH 566

Query: 716  APAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAIDD 775
            AP+FA+SHILQ+VGFG+PKNPFA+LFELP+ L                        +   
Sbjct: 567  APSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESSTSNSR 626

Query: 776  LEDEQSDR-MSTPEG---------FFGNIETLRFPYSVPSNL--EIWNESLNYINMTSLK 823
             E++ +D  MS+            FF +I+TLR P  V S L  E W ESL ++NMTSLK
Sbjct: 627  NENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPI-VSSMLTNEAWLESLKFLNMTSLK 685

Query: 824  CSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTI 883
            C M+VL+KFL GPL +ALPHF+PW YFIIS+  K   L+   S++FW+  V RIFPW+T+
Sbjct: 686  CGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFPWDTM 745

Query: 884  VSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDT 943
            V+F+N+LIA +LDN   S ++ SLC +YS + L +LLD F   E LPE+W CWGTLWFDT
Sbjct: 746  VTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTLWFDT 805

Query: 944  ICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLA 1000
            IC K  + +   +D E VGIK++M LD+PIDGI FD NDE+GE FWKRACR IFLF+ L+
Sbjct: 806  ICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLFRELS 865

Query: 1001 ENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH 1060
             +F IG+ ++  + +   R+ +   +IL + S+KL       L  +    P+     L+ 
Sbjct: 866  RSFQIGVIINNESSI--NRSSLQSNNILGNLSYKLE-----PLSTLGSSIPT-----LNT 913

Query: 1061 LKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLY 1120
            L+  +++FE  S  NI +  +P LSVI+G SIF+Y GY++L P+Y  +DKNGEFLSASLY
Sbjct: 914  LEGIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLY 973

Query: 1121 TSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDAL 1180
            TSWY  N +NN                      E +I N   E    G F + L   D  
Sbjct: 974  TSWYVPNGSNNP---------------------ETNI-NSNCEKENEGQFLECLKSDD-- 1009

Query: 1181 YQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEA 1240
             +    +TTYFV D T+WLRH   I+KLA + +LKFAICLTTF ELRFLRK KDENV+EA
Sbjct: 1010 -REIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEA 1068

Query: 1241 ATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK 1300
            ATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++ KAQ K
Sbjct: 1069 ATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK 1128

Query: 1301 FQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLC 1360
             +  N                       +V+L++DD  M+KKA+++ ++T ST+FVFSLC
Sbjct: 1129 LENANQLPVSS-------------CRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLC 1175

Query: 1361 NSIGLRSKICTN 1372
              +G +  +CT+
Sbjct: 1176 TKLGEQRHLCTD 1187

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/961 (56%), Positives = 698/961 (72%), Gaps = 36/961 (3%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIYK IV+QE+ELQE+C+QLT+SQTT+L ++W+IY+IN +L+ NYVTF++TA
Sbjct: 368  QALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTA 427

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL SQ++ D++              LWVYGTITFLD+ KNFS+FMDPEVC QFITHVFIS
Sbjct: 428  LLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFIS 487

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            IS ML DIP KY IPW+QRLGDLSRMAIALYPSGFIDWKLS+E+WY +A+K+TY +GKLY
Sbjct: 488  ISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLY 547

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMST+QQNTLEAFVNLGKSVFCQDTFIPS QYMQLVIDNIYQRAF+ER + N RN+QLI
Sbjct: 548  YHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLI 607

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLLP+F+ + +LQ+VV+ YF+ KFG D +++NIF  R +F QNP+ L+YFFR
Sbjct: 608  EYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFR 667

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXX-XXXXXXMAI 773
            HAPAFAESHILQ VGFGD KNPFALLF+LP+FL                        M++
Sbjct: 668  HAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMSL 727

Query: 774  DDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFL 833
            D++    +D + + + +F N+E+++ PY  P   +IW +SL+Y+N+T+++C ++VL+KFL
Sbjct: 728  DNI---STDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFL 784

Query: 834  KGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAY 893
             GP VVALPH M WTYFIIS+  K + L  E SR FW  F+ R+ P N+IVSFLNVLIAY
Sbjct: 785  HGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAY 844

Query: 894  MLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVE 953
             LDNS+ S+L+ S+  +  SM L++LL  FNNNE LPEVWKCWGTLWFD I +K  +   
Sbjct: 845  ALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTN 904

Query: 954  DLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVA 1013
              E +G+ +H+F D+PIDGI FD+ DE+GE FWKRA RIIFLFK +AE F IGITLS  A
Sbjct: 905  SYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTA 964

Query: 1014 PVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH-LKNTLEIFEEAS 1072
            PVYCRR+DV   HIL SFSFK+ +     L+  N     T  +++++ L   +E+ E  +
Sbjct: 965  PVYCRRDDVELNHILGSFSFKIEQ----HLLNGN-----TVQVEIENCLGAIIEMTEMPN 1015

Query: 1073 WENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNT 1132
              NI MD  P +S+ E E+IF+Y GY+R+ P+  ++DKNGE  SA+ YTSWY+       
Sbjct: 1016 EVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQE---- 1071

Query: 1133 GVIPAHGSDVDSQRDAVQSVQEMHIF-NQIMEPGYCGGFADDLFLRDALYQTAHSSTTYF 1191
             ++P   +   S  ++V        F +Q +E      F ++     +L    +  TT F
Sbjct: 1072 -IVPKSAA---SPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSF 1127

Query: 1192 VLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQL 1251
            VLD T+WLRH  HIYKLAS+  L F+ICLTTF ELRFLRK KDENV+EAA RAII +RQL
Sbjct: 1128 VLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQL 1187

Query: 1252 YSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNXXXXXX 1311
            YS+GK++PLRFTGN+ATHIEEHLEFEE+ITWRSHVDEFVIE++ KAQ KF +        
Sbjct: 1188 YSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQ-------- 1239

Query: 1312 XXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICT 1371
                      D+ S  +F VLV+DD NM++KA ++++RTF+T+FVF+LC+ +G    ICT
Sbjct: 1240 ---PFVQNPVDNDS--RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICT 1294

Query: 1372 N 1372
            N
Sbjct: 1295 N 1295

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/972 (56%), Positives = 676/972 (69%), Gaps = 66/972 (6%)

Query: 416  ALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTAL 475
            AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIY+IN++LINNYVTF+TTAL
Sbjct: 268  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTFITTAL 327

Query: 476  LPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISI 535
            LPSQ   D+L              LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVF+S+
Sbjct: 328  LPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 387

Query: 536  SNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYY 595
            S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 388  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 447

Query: 596  HMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIE 655
            HMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN RN+ LIE
Sbjct: 448  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 507

Query: 656  YLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRH 715
            YLKHSE MLLPSFLES DLQ VV+ YF  KFG D+N  NIF+   MF QNPD+ +YFFRH
Sbjct: 508  YLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKYFFRH 567

Query: 716  APAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAIDD 775
            AP+FA+SHILQ+VGFG+PKNPFA+LFELP++L                            
Sbjct: 568  APSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 627

Query: 776  LEDEQSDRMSTPEG----------FFGNIETLRFPYSVPSNL--EIWNESLNYINMTSLK 823
             ++   D + +             FF +I+TLR P  +PS L  E W E+L ++NMTSLK
Sbjct: 628  NDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLNMTSLK 686

Query: 824  CSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTI 883
            C M+VL+KFL GPL +ALPH +PW YFII+   K   L+  +S+ FW+  V R+FPW+TI
Sbjct: 687  CGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVFPWDTI 746

Query: 884  VSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDT 943
            V+F+NVLIAY+LDN   + ++  LC +Y ++ L  LL+ FN +E LPE+W CWGTLWFDT
Sbjct: 747  VTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGTLWFDT 806

Query: 944  ICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLA 1000
            IC K    +   ++ + +GIK++M LDAP DGI FD  DESGE FWKRACRIIFLF+ L+
Sbjct: 807  ICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFLFRELS 866

Query: 1001 ENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH 1060
              FPIG+ +S    + C  +  S   IL++  +KL   S+           S T I L  
Sbjct: 867  RTFPIGVIVSNDPLIKCSSSQSSI--ILRNLVYKLEPLSNIR---------SNTPI-LTA 914

Query: 1061 LKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLY 1120
            L+N+++I E  S  NI +  +P LSV  G++IF Y GY++L PDY  +D+NGEFLSASLY
Sbjct: 915  LENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLY 974

Query: 1121 TSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDAL 1180
            T WY  N  N +  +    SD++   +         +F + M+P  C G   +       
Sbjct: 975  TRWYLPNGNNISEALV--NSDIEKGDE--------DLFLECMKPD-CPGIDFE------- 1016

Query: 1181 YQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEA 1240
                   TTYFV D T+WLRH   I+KLA + +LKFAICLTTF ELRFLRK KDENV+EA
Sbjct: 1017 -------TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEA 1069

Query: 1241 ATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK 1300
            ATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++ KAQ K
Sbjct: 1070 ATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEK 1129

Query: 1301 FQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLC 1360
             +                + H       +VVL++DD  M+KKA++++++T STKFVFSLC
Sbjct: 1130 LENAG-------------QPHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSLC 1176

Query: 1361 NSIGLRSKICTN 1372
              +G +  +CT+
Sbjct: 1177 TKLGEKRHLCTD 1188

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/966 (55%), Positives = 674/966 (69%), Gaps = 37/966 (3%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIY+ IVKQE+ELQERC+QLTTSQTT+LKNLW IYKIN +LINNYV F+TTA
Sbjct: 242  QALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTA 301

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ EQD+L              LWV+GTITFLD+ KNFSNFMDPEVCCQFITHVFIS
Sbjct: 302  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 361

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            IS MLGD+P K+  PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLY
Sbjct: 362  ISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLY 421

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ERN GNHRN+ ++
Sbjct: 422  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMV 481

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLL SFLES +LQ+VVL +F+ KFG  ++N + F+ R MF Q+ + ++YFFR
Sbjct: 482  EYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFR 541

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HAPAFAESHILQ VGFGDPKNPFALLFELP+FL                           
Sbjct: 542  HAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSI------ 595

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
                E +  +S P  +  N+++ R+ Y  P +L IW ESL++IN+TS +CS +V QKFL+
Sbjct: 596  ----ETTSHLS-PSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLR 650

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
            GPLVVA+ H +PW+YF++SLA KI  L     + FW+  V +IFPWN+IV FLN+L+A++
Sbjct: 651  GPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFV 710

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
            LDN+WK+S +D+LC Q  S+    L+++F+ +E LPE+W+CWG LWFD I +K      D
Sbjct: 711  LDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGD 770

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
            + + G K+H F D P DGI FD +DE GE FWKRACR+IF+FKG+A+ F +G+TLS  AP
Sbjct: 771  VINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAP 830

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
                R  ++  H L++FSF                 P+ + I    ++N + +FEE +  
Sbjct: 831  Q--SRRPMTAGHPLQNFSFNFEE------------IPAQSQIQ-SFVRNQIPLFEEIATG 875

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTG- 1133
            N+  +  P  S++EGESIFD+ GYR+++ DY  ++K+G  +S SLYTS          G 
Sbjct: 876  NLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGD 935

Query: 1134 --VIPAHGSDVDSQRDAVQSVQEMH-----IFNQIMEPGYCGGFADDLFLRDALYQTAHS 1186
                  +G   DS +     + E+        +  M P +     +  F    L     S
Sbjct: 936  DFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDS 995

Query: 1187 STTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAII 1246
              +YFVLD T+WLRHF H++KLA++ VL+F ICLTTF ELRFLRK KDE+VVEAATRA+I
Sbjct: 996  GVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVI 1055

Query: 1247 TVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNX 1306
            TVRQLYS+ KLLPLRFTGNVATH+EEHLEFEE+ITWRSHVDEFVIEAVYKAQ KF+ +N 
Sbjct: 1056 TVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINA 1115

Query: 1307 XXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLR 1366
                         A  D     FV LV+DD+NMR KA  Q ++TFST+F+F++CN IGL 
Sbjct: 1116 QAKEAGHDFI---ATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLA 1172

Query: 1367 SKICTN 1372
             + CTN
Sbjct: 1173 HQACTN 1178

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/967 (55%), Positives = 677/967 (70%), Gaps = 57/967 (5%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIYK+I+KQE+ELQERCSQLT SQTTE+KNLW IYK+N+DLINNYVTF+TTA
Sbjct: 316  QALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTA 375

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            L PSQ++ D+L              LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVFIS
Sbjct: 376  LFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 435

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            IS+ML DIP KY IPWLQ+LGDLSRMA+AL+PSGFIDWKLSAE WYM AM+++Y +GKLY
Sbjct: 436  ISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLY 495

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNG-NHRNTQL 653
            YHMSTVQQNTLEAFVNLGKSVFCQ+TF+PSQQY+QLVIDNIYQRAF +RN+  N RN QL
Sbjct: 496  YHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQL 555

Query: 654  -IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCD--SNNVNIFDTRKMFCQNPDYLR 710
             ++YLKHSEVMLLP+F+ES DLQQVVL+YF  KFG D  +NNV +F  R+MF QN D L+
Sbjct: 556  LVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLK 615

Query: 711  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXX------XX 764
            ++FRHA AFAE+ ILQLVG+G+PKNPFALLF LP++L                       
Sbjct: 616  FYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGEDGSS 675

Query: 765  XXXXXXMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKC 824
                    ++ + + +++     E FF NI+ L     +P+++ +WN+SL Y N T+ KC
Sbjct: 676  TTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKC 735

Query: 825  SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIV 884
            SM+VLQKFL GPL+VALPH +PW YF+IS+A +I+     +  +FW  F+ RIFPWN++V
Sbjct: 736  SMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMV 795

Query: 885  SFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTI 944
             FLNVL+AYM+DN W +S ++ LC QY S+ LE+LL  FN NE LPEVWKC G+LWFD I
Sbjct: 796  RFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDII 855

Query: 945  CNKEQS-HVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENF 1003
              K  S + +     GIK++ FLD P+DGI FD NDE G  FWKR+ R+IFLF+G+ E F
Sbjct: 856  DEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVRVIFLFRGIVERF 915

Query: 1004 P--IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHL 1061
                 + +S  APV  RR      H++  +SFKL   SD               I  D +
Sbjct: 916  NGFGNLAISYNAPVINRRGLGVNSHLV-GYSFKLMAKSDD--------------IMFDDM 960

Query: 1062 KNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYT 1121
               +  FEE    N   + IP+LS+I GE+IF+Y GY+R+H DY+S+DKNG+ +S S Y 
Sbjct: 961  --LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYN 1018

Query: 1122 SWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALY 1181
            +W  N +T   G  P   +   S   +   + E  +FN+  +P Y    + D F    +Y
Sbjct: 1019 TWSINQDTGVNGG-PLSNNSSSSNAASSDPMNEKELFNKCFDPEYD---SVDEFWNKEIY 1074

Query: 1182 QTAHSS-------TTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKD 1234
                          TYF+LD T+WLRHF H+YK+A++ +LKF+ICLTTF ELRFLRK KD
Sbjct: 1075 DDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLRKSKD 1134

Query: 1235 ENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAV 1294
            ENVVEAATRAIIT+RQL+SEGKLLPLRFTGNVATHIEEHLEFEE+ITWRSHVDEFVIEAV
Sbjct: 1135 ENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAV 1194

Query: 1295 YKAQSKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354
             KA++K +E               +   +  G + +VLVTDDSNM+ KA ++  +TFST+
Sbjct: 1195 IKAETKRKE---------------QEMHNMKGFQ-IVLVTDDSNMKNKALEKGSKTFSTR 1238

Query: 1355 FVFSLCN 1361
            FVF++ N
Sbjct: 1239 FVFAISN 1245

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/978 (54%), Positives = 677/978 (69%), Gaps = 61/978 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+N++LINNYV F+TTA
Sbjct: 212  QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ EQD+L              LWV+GTITFLD+ KNFSNFMDPEVCCQFITHVFIS
Sbjct: 272  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNMLGD+P K+  PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + HGKLY
Sbjct: 332  ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF ERN GN RN+ ++
Sbjct: 392  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMV 451

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKHSEVMLL SFLES +LQ+VVL +F+ KFG  SNN + F  + +F Q+ +  +YFFR
Sbjct: 452  EYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFR 511

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HAPAFAESHILQ+VGFG+PKNPFALLFELP+FL                        + +
Sbjct: 512  HAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS-----------KSSN 560

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
                 ++   ++P  +  ++++ RF Y  P++L IW +SL++IN TS+KCS VVLQKFL 
Sbjct: 561  SFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLH 620

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
            GPLV A  H +PW YF++SLA +I +L     + FW+    ++FPWN+IV+FLN++IA+ 
Sbjct: 621  GPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFA 680

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
            LDN+WK+S +D+LC Q+ S+ +  L+D+F+ NE LPEVWKCWG LWFD I +K     E 
Sbjct: 681  LDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEG 740

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
                 +++HMF D P+DGI FD +DE+G  FWKRACR++F+FKG+A+ F +G+TL+ V P
Sbjct: 741  ATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASV-P 799

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
            +  RR+ ++  H L++F FK            +PP  S +      +   +  FE  S  
Sbjct: 800  LQSRRS-LAAGHPLQNFCFKFE----------DPPVDSES---YALISTQMPAFENISER 845

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV 1134
            N+  +  P  S++EG+S+F+  GYR+LH D+  ++K G  ++ SLYTS            
Sbjct: 846  NLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKG------ 899

Query: 1135 IPAHGSD-----VDSQRDAVQSVQEMHI----------FNQIMEPGYCGGFADDLFLRDA 1179
             P HG D       S+ D +       I           +  M P +     D  F    
Sbjct: 900  -PIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGD 958

Query: 1180 LYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVE 1239
            L     S  +YFV D T+WLRHF H+YKLA++GVL+FAICLTTF ELRFLRK KDE+VVE
Sbjct: 959  LSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVE 1018

Query: 1240 AATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQS 1299
            AATRA+ITVRQLYSE +LLPLRFTGNVATH+EEHLEFEE+ITWRSHVDEFVIEAVYKAQ+
Sbjct: 1019 AATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQN 1078

Query: 1300 KFQEMNXXXXXXXXXXXXXRAHD-----DRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354
            KF+ +N               HD     +     F+ LV+DD+NMR KA  Q +RTFS++
Sbjct: 1079 KFEALNAQAKEG--------GHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSR 1130

Query: 1355 FVFSLCNSIGLRSKICTN 1372
            F+F++CN IGL    CTN
Sbjct: 1131 FMFAVCNQIGLAHHACTN 1148

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/974 (55%), Positives = 672/974 (68%), Gaps = 69/974 (7%)

Query: 416  ALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTAL 475
            AL+QKLQ++YKVIVKQEIELQERCSQLT SQTTELK+LWTIYKIN+DL+NNYVTF+TTAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 476  LPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISI 535
            LPSQ   D++              LWVYGTITFLD+ KNFSNFMDPEVCCQFITHVF+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 536  SNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYY 595
            S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+ Y+HGKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 596  HMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIE 655
            HMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN RN+ LIE
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 513

Query: 656  YLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRH 715
            YLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ +YFFRH
Sbjct: 514  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRH 573

Query: 716  APAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAIDD 775
             P+FA+SHILQ+VGFG+PKNPFA+LFELP++L                            
Sbjct: 574  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSR 633

Query: 776  LEDEQSDR-MSTPEG---------FFGNIETLRFPYSVPSNL--EIWNESLNYINMTSLK 823
             ++E  D  MS+            FF +I+TLR P  +PS L  E W E+L ++NMTSLK
Sbjct: 634  NDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 692

Query: 824  CSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTI 883
            C ++VL+KFL GPL +ALPH +PW YFIIS+  K   L+   S++FW+  V R FPW+T+
Sbjct: 693  CGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTM 752

Query: 884  VSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDT 943
            V+F+NVLI Y+LDN   +S++  LC  Y  + L +LL+ FN  E LPE+  CWGTLWFDT
Sbjct: 753  VTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDT 812

Query: 944  ICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLA 1000
            IC K    +   ++ + +GIK++M LD+P DGI FD  DE+GE FWKRACR IFLF+ L+
Sbjct: 813  ICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELS 872

Query: 1001 ENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDH 1060
             +FPIG+ +     +Y  R+     +IL S  FKL    +   +  N P        L  
Sbjct: 873  RSFPIGVIIRNDPLIY--RSSFQNTNILGSLVFKLEPLCN---IHNNIPV-------LGA 920

Query: 1061 LKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLY 1120
            L++ ++I E  S  N  +  +P LSV EG++IF Y GY++L  DY  +DKNGEFLSASLY
Sbjct: 921  LESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLY 980

Query: 1121 TSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLR--D 1178
            T+WY   N+NNT +      + +S+++                        + LFL    
Sbjct: 981  TTWYV-PNSNNTNI--EDNINYNSEKE-----------------------NEGLFLECIK 1014

Query: 1179 ALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVV 1238
            + Y      TTYFV D T+WLRH   I+KLA + +L+FAICLTTF ELRFLRK KDENV+
Sbjct: 1015 SDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVM 1074

Query: 1239 EAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQ 1298
            EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE+V KAQ
Sbjct: 1075 EAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQ 1134

Query: 1299 SKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFS 1358
             K +  +             R    R    +VVL++DD  M+KKA++++++T ST+FVFS
Sbjct: 1135 EKLESAS-----------EPRLSPRR--FNYVVLISDDDAMKKKAEEKEIKTLSTRFVFS 1181

Query: 1359 LCNSIGLRSKICTN 1372
            LC  +G +  +CT+
Sbjct: 1182 LCTKLGEQRHLCTD 1195

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/992 (52%), Positives = 661/992 (66%), Gaps = 68/992 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q LVQKLQDIYK IVKQEIELQERC +LT SQTTELKNLWTIY++NS+L++NY+TF+TTA
Sbjct: 382  QVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTA 441

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            + P+Q E D                LWVYGTITFLD+ KNFSNFMDPEVCCQFI HVFIS
Sbjct: 442  IHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFIS 501

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNML DIP KY + W Q+LGDLSRMAIALYPS FIDWKLSAE WYM AM+FTY HGKLY
Sbjct: 502  ISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLY 561

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNH-RNTQL 653
            YHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+ + NN N+ RN QL
Sbjct: 562  YHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQL 621

Query: 654  -IEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNV--NIFDTRKMFCQNPDYLR 710
             ++Y+KH EV LLP+F ES +LQQVVL+YF  KFG D NN   N+F +RKMF QN D  +
Sbjct: 622  LVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFK 681

Query: 711  YFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXX 770
             F+R++ AFAES ILQ+VG+G+ K+PF+LLFELP++L                       
Sbjct: 682  CFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQP 741

Query: 771  MAIDDLEDEQSDRMS------TPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKC 824
                         M       T E FF NI+T+ +P  +P++++IWN SL Y N  S+KC
Sbjct: 742  RLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSIKC 801

Query: 825  SMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIV 884
            SM+V +KFL  P ++ALPH +PW YFIIS+  ++    + +  +FWVEFV RIFPWN+IV
Sbjct: 802  SMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNSIV 861

Query: 885  SFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTI 944
             FLNVL+AYM+DN W+ S+++ LC  Y+SM L++LL YFN NE LPEVWKC G+LWFDTI
Sbjct: 862  KFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFDTI 921

Query: 945  -----CNKEQS---------HVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRAC 990
                  NK+++         ++ D +  G+K++ F D PIDG  FD +DE GE FWKRA 
Sbjct: 922  MEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKRAA 981

Query: 991  RIIFLFKGLAENFP--IGITLSPVAPVYCRRNDVSPYHI----LKSFSFKLRRGSDSELV 1044
            R+IFLFK LAE++    G+ LS  APV+ RR D    +     L  FSFKL   SD  + 
Sbjct: 982  RVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNASSDGVM- 1040

Query: 1045 PMNPPQPSTTAIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPD 1104
                            L + +E FE     N      PMLS+++G+SIFDY GY+R+ P+
Sbjct: 1041 ----------------LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPN 1084

Query: 1105 YFSYDKNGEFLSASLYTSWYANNNTN-----------NTGVIPAHGSDVDSQRDAVQSVQ 1153
            ++S+DKNG+F+S S + SW   N TN           +  +    G+D  +       + 
Sbjct: 1085 FYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMN 1144

Query: 1154 EMHIFNQIMEPGY--CGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASS 1211
            E+ +FN+  +P Y     F       D+    +    TYF+LD T+WLRHF HIYK+A+S
Sbjct: 1145 ELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATS 1204

Query: 1212 GVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIE 1271
             +LKFAICLTTF ELR+LRK KD NVVEAATRAIIT+RQLY E  LLPLRFTGNVATHIE
Sbjct: 1205 KILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHIE 1264

Query: 1272 EHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVV 1331
            EHLEFEE+ITWRSHVDEFVIEAV KA+ K  +                  +    +  ++
Sbjct: 1265 EHLEFEEQITWRSHVDEFVIEAVLKAEEKRTD--------RLNDINMDTDEKEKSIFGII 1316

Query: 1332 LVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSI 1363
            LVTDD  M+ KA D+ ++TFST+F+FS+ N I
Sbjct: 1317 LVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/969 (53%), Positives = 657/969 (67%), Gaps = 45/969 (4%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QAL++KLQ+IY+ IV+QE ELQ+RCSQLTTSQTT+LKNLW IYK+N++LI+NY  F+TTA
Sbjct: 283  QALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTA 342

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLP+Q E D+L              LWVYGTITFLD+ KNFSNFMDPEVCCQFI +VFIS
Sbjct: 343  LLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFIS 402

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNMLGDIPPK+ I WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+T+ HGKLY
Sbjct: 403  ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLY 462

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF ERN+G+HRN  L+
Sbjct: 463  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLV 522

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKH+EVMLLPSFLES++LQ VVL +F+ KFG  S NV+ FD R +F Q+ + L++FFR
Sbjct: 523  EYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTS-NVDFFDPRLVFVQDSERLKHFFR 581

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HA  +AESH+LQLVGFGDP+NPFALLFELP+ L                        +ID
Sbjct: 582  HASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQYDT--SID 639

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
            D         + P  FF  I++ ++ Y  P ++ IW ESL+Y N+T++KCSM+VL+KFL 
Sbjct: 640  D-----DCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLH 694

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
            GPL+ ALPH +PW YF+ +   ++  +  +  R+FWV  V ++FP+NTI++FLNVL+ YM
Sbjct: 695  GPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYM 754

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
             + +  +   D    Q+  M L DL+ YF  NE LPEVW+CWGTLWFD +  K  +++ D
Sbjct: 755  NNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTD 814

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
            + S G+K+HMF+D+PIDGI+FD NDESGE FWKR  R+I LF+ LA   P+G+       
Sbjct: 815  INSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL------- 867

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
                  ++S     +S  FK              P      + L+      + FE+ S  
Sbjct: 868  -----REISGGRNWRSLVFKFEE-----------PPSEWCDMYLEPFTLVFDTFEQISPV 911

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYT------SWYANNN 1128
            N+     P   +     I    GYR L PDY+ +++NG+ ++ SLYT      S     +
Sbjct: 912  NLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGD 971

Query: 1129 TNNTGVIPAHGSDVDSQRDAVQSV---QEMHIFNQIMEPGYCGGFA--DDLFLRDALYQT 1183
              N   +  +G  V ++R    S+   +E  I ++ +   +C      + +  R  L+  
Sbjct: 972  DFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCF 1031

Query: 1184 AHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATR 1243
            A +  TYFVLD TTWLRHFGH+YKLA++ +LKFAICLTTF ELRFLRK KDE+V+EAATR
Sbjct: 1032 ADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATR 1091

Query: 1244 AIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQE 1303
            A+ITVRQLY E KLLPLRFTGNVA H+EEHLE EE++TWRSHVDEFVIEA++KAQ KF  
Sbjct: 1092 AVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNA 1151

Query: 1304 MNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSI 1363
            +N              A D R    F+ LVTDD NMR KA  Q+++ FST+F+FS+CN +
Sbjct: 1152 LNDDAKAASRDCIPTGA-DQR--FNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNEL 1208

Query: 1364 GLRSKICTN 1372
            G    +CTN
Sbjct: 1209 GHAKNVCTN 1217

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/969 (52%), Positives = 658/969 (67%), Gaps = 66/969 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IYK+N++LI NY+ F+ TA
Sbjct: 204  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITA 263

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL +Q   D++              LWVYG ITFLD+ K+FSNFMDPEVCCQFIT+ FI 
Sbjct: 264  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFIC 323

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 324  ISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 383

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGN------- 647
            YH++T+QQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R++GN       
Sbjct: 384  YHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETA 443

Query: 648  HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPD 707
            HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  ++F T+ MFCQNP+
Sbjct: 444  HRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPE 503

Query: 708  YLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXX 767
             LRY+FRHAPAFAES ILQL+GFG+PKNPFALLF+LP+ L                    
Sbjct: 504  SLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAA----- 558

Query: 768  XXXMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYS-VPSNLEIWNESLNYINMTSLKCSM 826
                 I    D   D+ S+ E +F NI+TL   ++  P+N+ IW +SLNYINMTS++CS+
Sbjct: 559  ----EIPHYRDPFDDQGSS-ESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCSI 613

Query: 827  VVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSF 886
             VL KFL  PL VALPHF+ W +FII++  K++ +N E    FW+ F+ R  PWN++V+F
Sbjct: 614  QVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVTF 673

Query: 887  LNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICN 946
             NVL+ YMLDN      ++    ++ S+ L+DL++YFN NE LPEVWKCWG+LWFD +  
Sbjct: 674  SNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV-- 729

Query: 947  KEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP-I 1005
                  + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R I   KG+A+ FP +
Sbjct: 730  ---KKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPDL 786

Query: 1006 GITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTL 1065
            G+ ++  A V+CRRND+SP + LK+ +FKL    +      N         +LD L +T+
Sbjct: 787  GLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNN---------ELDELYDTI 837

Query: 1066 EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA 1125
            EI E     NI +   P LSV+ GESIF+Y GY RL  DY  +DKNG F SA +YT W  
Sbjct: 838  EINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW-- 895

Query: 1126 NNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAH 1185
            +N  N   +  +  S  DS  + +       +F+++      G   DD            
Sbjct: 896  SNVGNGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFT---IGKNTDD----------DG 942

Query: 1186 SSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAI 1245
            S + YFV+D T+WLRHF HI+KLA + +LKFAICLTTF ELR+LR  KD+NVVEAATR++
Sbjct: 943  SCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSV 1002

Query: 1246 ITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMN 1305
            IT+RQLY E K++P+RFTGN+ATHIEE+LEFEE+ITW++HVDEFVI+A+ K    FQ   
Sbjct: 1003 ITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQ--- 1059

Query: 1306 XXXXXXXXXXXXXRAHDDRSGL--KFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSI 1363
                         R  D   G   +F VLVTDD NM +KA+D+ ++T +TK++FSL + +
Sbjct: 1060 -----------TERTIDKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKL 1108

Query: 1364 GLRSKICTN 1372
            G+ S +CTN
Sbjct: 1109 GINSGLCTN 1117

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 102 KRSSSNTYNYV-SANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-TS 159
           KR SS+++N    ++F KRR+P   E  P    F+D    G     IS+ N P KA   S
Sbjct: 43  KRHSSSSHNDTPESSFAKRRVPGVVE--PVGKGFID----GITTSQISMQNIPFKAEDIS 96

Query: 160 RRPSLPKKAIDT 171
           RRPS+ +KA++T
Sbjct: 97  RRPSISRKAMET 108

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/976 (52%), Positives = 648/976 (66%), Gaps = 57/976 (5%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q LV+KLQ+IYK IVKQE ELQERCSQLTTSQTT+LKNLW IYK+N++LI+NY TF+TTA
Sbjct: 321  QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTA 380

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLP+Q + D+L              LW+YGTITFLD+ KNFSNFMDPEVCCQFI +VFIS
Sbjct: 381  LLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFIS 440

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            ISN+LG+IPP + + WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + HGKLY
Sbjct: 441  ISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLY 500

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF ERN+G+HR + ++
Sbjct: 501  YHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIV 560

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            EYLKH+EVMLLPSFLE+ + Q VVL +F  KFG  + + N FD   +F Q+ + L++FFR
Sbjct: 561  EYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSANFFDPSLIFVQDCERLKHFFR 619

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            HA  +AESHILQLVGFGDP+NPFALLFELP+ +                       M+ID
Sbjct: 620  HASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSD--MSID 677

Query: 775  DLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLK 834
            D        +  P  FF  + + +  Y    +L IW ESLNY+N TS++CSMVVL+KFL 
Sbjct: 678  DT------FLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLN 731

Query: 835  GPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYM 894
              L+ ALPH +PW YF++++  ++  + +E S++FW+ F+ +IFPW +I +FLNVL+ Y+
Sbjct: 732  SSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYI 791

Query: 895  LDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVED 954
             D       +D     Y +M L +LL+YF  NE LPEVW CWGTLWFD I +K  S++ D
Sbjct: 792  NDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVD 851

Query: 955  LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVAP 1014
            + S G+K+HMFLDAP+DGI+FD +DESGE FWKR  R+I LF+G+A  FP G T      
Sbjct: 852  IHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT------ 905

Query: 1015 VYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEASWE 1074
                  + +     KS  FK            N P        L         FE  S+ 
Sbjct: 906  ------EFNGSDDWKSLVFKF-----------NEPPAEWKEQYLGSFSKEYGEFESISFV 948

Query: 1075 NIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNTGV 1134
            N  + + P   ++ G  I    GY++L PDY  ++KNG+ ++ SLYTS  +   +     
Sbjct: 949  NTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSG---- 1004

Query: 1135 IPAHGSDVDSQRDAVQS----------------VQEMHIFNQIMEPGYCGGFA--DDLFL 1176
            +P    D  S +  +++                 +E  I ++ ++  Y    +  +    
Sbjct: 1005 VPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLP 1064

Query: 1177 RDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDEN 1236
            R  L     +  TYFVLD TTWLRHFGH+YKLA+S +LKFAICLTTF ELRFLRK KDE+
Sbjct: 1065 RGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDES 1124

Query: 1237 VVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYK 1296
            V+EAATRA+ITVRQLY E KLLPLRFTGNVA H+EEHLE EE++TWRSHVDEFVIEA+ K
Sbjct: 1125 VLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDK 1184

Query: 1297 AQSKFQEMNXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFV 1356
            AQSKF ++N                 D     F+ LVTDD NMR KA+ Q +R FSTKF+
Sbjct: 1185 AQSKFNQLNKDAKASGRESITTI---DDGKFNFIALVTDDINMRNKARAQSIRAFSTKFM 1241

Query: 1357 FSLCNSIGLRSKICTN 1372
            F++C+ IGL  K+CT+
Sbjct: 1242 FAICHEIGLSKKVCTD 1257

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/969 (51%), Positives = 657/969 (67%), Gaps = 66/969 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY+ F+ TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL +Q   D++              LWVYG ITFLD+ KNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +SNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGN------- 647
            YH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R++G+       
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIA 444

Query: 648  HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPD 707
            HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  ++FDT+ MFCQNP+
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPE 504

Query: 708  YLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXX 767
             LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP++L                    
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATETSSY 564

Query: 768  XXXMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYS-VPSNLEIWNESLNYINMTSLKCSM 826
                       +  D   + E +F NI+ L   ++ +P+NL IW +SLN+INMTS++CS+
Sbjct: 565  T----------DPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSI 614

Query: 827  VVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSF 886
             VL KFL  PLVVALPHF+ W +FI+++  K++ +N +    FW+ F+ R  PWN+IV+ 
Sbjct: 615  HVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTL 674

Query: 887  LNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICN 946
             NVL+ YMLDN      +     ++ S+ L+DL++Y+N NE LPE+WKCWGTLWFD I  
Sbjct: 675  GNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-- 730

Query: 947  KEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP-I 1005
                  + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R + L KG+A+ FP +
Sbjct: 731  ---KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL 787

Query: 1006 GITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTL 1065
            G+ +S  A V+CRRND+ P + LK+ +FKL    +      N         +LD L +T+
Sbjct: 788  GLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNN---------ELDDLYDTI 838

Query: 1066 EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA 1125
            EI EE    N+     P LSV+ GESIF+Y GY RL PDY  +DKNG F SA +Y+ W  
Sbjct: 839  EINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-- 896

Query: 1126 NNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAH 1185
                +N G    +G  +D   +++  V      N  +   +   F D +          +
Sbjct: 897  ----SNVG----NGVTLDVSGESIYDVA-----NNNLSLHWEKIFFDKIAAASKGSDENY 943

Query: 1186 SSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAI 1245
            + T YFV+D T+WLRHF HI+KLA +  LKFAICLTTF ELR+LR  KD+ VVEAATR++
Sbjct: 944  NCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSV 1003

Query: 1246 ITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMN 1305
            IT+RQLY E K++P+RFTGN+ATH+EE+LEFEE+ITW++HVDEFVI+A+ K   +FQ   
Sbjct: 1004 ITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQ--- 1060

Query: 1306 XXXXXXXXXXXXXRAHDD--RSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSI 1363
                         R  D+    G +F VLVTDD NM +KA+D+ ++T +TK++FSL + +
Sbjct: 1061 -----------AERLTDENKNKGKEFAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKL 1109

Query: 1364 GLRSKICTN 1372
            G+ S +CTN
Sbjct: 1110 GINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/968 (50%), Positives = 660/968 (68%), Gaps = 64/968 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q  ++KLQ+IY++IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY+ F+ TA
Sbjct: 205  QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL +Q   D++              LWVYG ITFLD+ KNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +S+ML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325  VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVER-------NNGN 647
            YH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444

Query: 648  HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPD 707
            HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  +IFDT+ MFCQNP+
Sbjct: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPE 504

Query: 708  YLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXX 767
             LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP++L                    
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGAT----- 559

Query: 768  XXXMAIDDLEDEQSDRMSTPEGFFGNIETLRFPY-SVPSNLEIWNESLNYINMTSLKCSM 826
                 +    D   D++S+ E +F NI++L   +  +P+NL IW +SLN+INMTS++CS+
Sbjct: 560  ----EVPQYRDPFDDQISS-ESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSI 614

Query: 827  VVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSF 886
             VL KFL  PLVVALPHF+ W +FI+++  K++ +N ++   FW+ F+ R  PWN++V+ 
Sbjct: 615  HVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNL 674

Query: 887  LNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICN 946
             NVL+ YMLDN      ++    ++ S+ L+DL++YFN NE LPE+WKCWG+LWFD I  
Sbjct: 675  ANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI-- 730

Query: 947  KEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP-I 1005
                  + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R I + KG+A+ FP +
Sbjct: 731  ---KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDL 787

Query: 1006 GITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTL 1065
            G+ ++  APV+CRRND+SP + LK+F+FKL    +++    N         +LD L +T+
Sbjct: 788  GLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNN---------ELDELYDTI 838

Query: 1066 EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA 1125
            EI E+    N  +   P LSV+ GE+IF+Y GY RL PDY  +DKNG F SA +Y+ W  
Sbjct: 839  EINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW-- 896

Query: 1126 NNNTNNTGVIPAHGSDV-DSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTA 1184
             +N  N  V+      + D+  + +    E   F++I   G+ G                
Sbjct: 897  -SNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNG-------------DKN 942

Query: 1185 HSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRA 1244
             + + YFV+D T+WLRHF HI+KLA + +LKFAICLTTF ELR+LR  KD+NVVEAATR+
Sbjct: 943  GNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRS 1002

Query: 1245 IITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEM 1304
            +IT+RQLY E K++PLRFTGN+AT++EE+LEFEE+ITW +HVDEFVI+A+ K    FQ  
Sbjct: 1003 VITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTE 1062

Query: 1305 NXXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIG 1364
                             +      + VLVTDD NM  KA+D+ ++T +TK++FSL + IG
Sbjct: 1063 RLID------------KNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIG 1110

Query: 1365 LRSKICTN 1372
            + S +CTN
Sbjct: 1111 INSGLCTN 1118

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 102 KRSSSNTYNYV-SANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-TS 159
           KR SS+++N    ++FVKRR+P   E  P    F+D    G  +  +SV NTPSK    S
Sbjct: 43  KRHSSSSHNDTPESSFVKRRVPGVVE--PVGKGFID----GIASGQVSVQNTPSKTDDIS 96

Query: 160 RRPSLPKKAIDT 171
           RRPS+ +KA++T
Sbjct: 97  RRPSISRKAMET 108

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/967 (50%), Positives = 647/967 (66%), Gaps = 62/967 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            Q  ++KLQ+IYK+IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY+ F+ TA
Sbjct: 205  QTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LL +Q   D++              LWVYG ITFLD+ KNFSNFMDPEVCCQFI + FIS
Sbjct: 265  LLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            +SNML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 325  VSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVER-------NNGN 647
            YH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 385  YHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETA 444

Query: 648  HRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPD 707
            H+N+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  ++FDT+ MFCQNP+
Sbjct: 445  HKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPE 504

Query: 708  YLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXX 767
             LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP++L                    
Sbjct: 505  SLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATETPQY 564

Query: 768  XXXMAIDDLEDEQSDRMSTPEGFFGNIETLRFPY-SVPSNLEIWNESLNYINMTSLKCSM 826
                  D   D++S     PE +F NI+ L   +  +P+NL IW ESLN+INMTS++CS+
Sbjct: 565  R-----DPFHDKKS-----PESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSI 614

Query: 827  VVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSF 886
             VL KFL  P V+ALPHF+ W YF++++  +++ +N +    FW+ F+ R  PWN++VS 
Sbjct: 615  HVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSL 674

Query: 887  LNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICN 946
             NVL+ YMLDN      +      + S  L+DL+++FN NE LPE+WKCWG+LWFD I  
Sbjct: 675  ANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAI-- 730

Query: 947  KEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP-I 1005
                  + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R I L KG+A+ FP +
Sbjct: 731  ---KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDL 787

Query: 1006 GITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTL 1065
            G+ ++  APV+CRRND+   + L+ F+FKL    +           +    +LD L  T+
Sbjct: 788  GLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGN---------NNDNNELDELYETI 838

Query: 1066 EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA 1125
            EI E+    N+ +   P LSV+ GESIF+Y GY RL PDY  +DKNG F SA +Y+ W  
Sbjct: 839  EINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-- 896

Query: 1126 NNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAH 1185
             +N  N   I      +    D   S+    IF   +   Y     +D            
Sbjct: 897  -SNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDEND------------ 943

Query: 1186 SSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAI 1245
            + T YFV+D T+WLRHF HI+KLA + +L FAICLTTF ELR+LR  KD+NVVEAATR++
Sbjct: 944  NCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSV 1003

Query: 1246 ITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQEMN 1305
            IT+RQLY E K++P+RFTGN+ATH+EE+LEFEE+ITW++HVDEFVI+A+ K    FQ   
Sbjct: 1004 ITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTER 1063

Query: 1306 XXXXXXXXXXXXXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGL 1365
                          A +     +F VLVTDD NM KKA+D+ ++T +TK++FSL + +G+
Sbjct: 1064 MI------------AENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGI 1111

Query: 1366 RSKICTN 1372
             S +CTN
Sbjct: 1112 NSGLCTN 1118

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1016 (47%), Positives = 656/1016 (64%), Gaps = 65/1016 (6%)

Query: 415  QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
            QAL+ KLQDIYK I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN +L+NNYV F+TTA
Sbjct: 274  QALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTA 333

Query: 475  LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
            LLPSQ++ D+L              LWVYGTITFLD+ K+FSNFMDPE+CCQFI HVFIS
Sbjct: 334  LLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFIS 393

Query: 535  ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
            I+NM   IP K+ IPW  RLGDLSRMA ALYP G  DWKLSAE+WY EAMK+TY  GKLY
Sbjct: 394  IANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLY 453

Query: 595  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
            YHM+TVQQN+L AF+NLGKSVFC+D F+P+QQY+QLVIDNIYQRA++ R   +  N Q++
Sbjct: 454  YHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQIL 513

Query: 655  EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFR 714
            +YLKH+E+M+LP+F+E+ +LQ++  +YF  KFG D    N FDTR MF QN + ++++FR
Sbjct: 514  DYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFYFR 573

Query: 715  HAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAID 774
            H+P FA++HILQ+VG+G+  N FALL+ELP+F+                       M+ID
Sbjct: 574  HSPLFAQAHILQVVGYGNIGNAFALLYELPKFI-----KDNEISRQRKKSKTGVDNMSID 628

Query: 775  DLEDEQSDRMSTPEG-FFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFL 833
             L  + S       G +F ++E +   +++P N++IW +SL Y N T + C M+VLQKFL
Sbjct: 629  TLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFL 688

Query: 834  KGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAY 893
            +GP V ALPH +PW YF+IS+A+KI+ L   +S+ FW  F+ RIFPWNTI++FLNVLIA+
Sbjct: 689  QGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAF 748

Query: 894  MLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVE 953
            + DNS   SLV+ LC  YS + L+++L  F+ NE LPEVW CWG+LWFDTI NK ++   
Sbjct: 749  LKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYS 808

Query: 954  DLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFPIGITLSPVA 1013
             L++ GIK+  FLDAP DGI FD  D++G  FWKRACRI+FLFKG AE F  G+ L+ + 
Sbjct: 809  GLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNIN 868

Query: 1014 PVYCRRNDV-SPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLEIFEEAS 1072
             +     ++ +     ++  F  +     +L+P++        +        L  FE  S
Sbjct: 869  SLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQV-YSLFTEKLPAFESIS 927

Query: 1073 WENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNTNNT 1132
              NI +D +P LSVI+GESIFDY GY++L P Y+ YDKNG     ++Y++W A N   N 
Sbjct: 928  ENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGN- 986

Query: 1133 GVIP--AHGSD--VDSQRDAVQ-SVQEMHIFNQIMEPGYCGGFADDLFL----------- 1176
            G+ P   +GS   +D   D+    ++E  +F + +E       +D L             
Sbjct: 987  GLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETEDE 1046

Query: 1177 ------------------RDALYQTAHSS--------TTYFVLDTTTWLRHFGHIYKLAS 1210
                               D +++T   +        +TYF+ D TTWLRHF HIYK+A 
Sbjct: 1047 TEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLRHFAHIYKIAY 1106

Query: 1211 SGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHI 1270
            SG+L F ICLTTF ELRFLR+ +DENV+EAATRA+I +R LY   K++PLRF G +A+HI
Sbjct: 1107 SGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHI 1166

Query: 1271 EEHLEFEEKITWRSHVDEFVIEAVYKAQ--------------SKFQEMNXXXXXXXXXXX 1316
            EEHLEFEE+ITWRSHV+EFVIEAV K+Q              + F   N           
Sbjct: 1167 EEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQ 1226

Query: 1317 XXRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372
               ++   +     VLVTDD NM  KA+++ +RT ST+F+FS+C+ +G++  ICTN
Sbjct: 1227 RGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/974 (50%), Positives = 639/974 (65%), Gaps = 46/974 (4%)

Query: 417  LVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTALL 476
            LV+KLQ+IYK IVKQE ELQERCS LTT QTT+LKNLW  YKIN++LI+NY+ F+TTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 477  PSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFISIS 536
            PSQ+E  +               LWVYGTITFLD+ KNFSNFMDPEVCCQFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 537  NMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYH 596
            NML D+PPKY IPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 597  MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLIEY 656
            MSTVQQNTLEAFVNLGKSVFC+D F+PS QYMQLVIDNIYQRAF ER++  +R   +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 657  LKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYFFRHA 716
            LKH+EVMLLPSFLES++LQ VV+ YF+ KFG  S+  N FD   +F Q+ + L++FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 717  PAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAIDDL 776
              F++SHILQL GFGDPKNPFA+LFEL + L                        ++D +
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG-----SLDPV 637

Query: 777  EDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGP 836
            E     + ST E FF  I++ + PY  P +L +W  SL+YIN+TS+KC M+VL++FL GP
Sbjct: 638  EFSSQQQAST-EDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP 696

Query: 837  LVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD 896
            +V ALPH +PW  FIIS+  ++  +N  + +KFW+ F+ RIFPW+++++F+N LI Y + 
Sbjct: 697  IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV 756

Query: 897  NSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHVEDLE 956
               K+  +D+    Y  M  E+LL     NE LPE W CWG+LWF+TI  K    V  LE
Sbjct: 757  TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE 816

Query: 957  SVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAE-----NFPIGI-TLS 1010
            S G+ + +FLD+P +GI FD +DE G  +W+R CR + LF  + E      +  G   L+
Sbjct: 817  STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLN 876

Query: 1011 PVAPVYCRRNDVSPYHILKSFSFKLRRGSDSEL-VPMNPPQPSTTAIDLDHLKNTLEIFE 1069
            P A  +            K+  F+    ++ +L V + P +  +   +        EI  
Sbjct: 877  PEATSW------------KNLVFRFNDDTNDQLSVELYPEENESFPFE------KFEIIS 918

Query: 1070 EASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNNT 1129
              +  +   D     S+I G SI +  G++ ++PDYF ++KNG+ ++ASLYT        
Sbjct: 919  NLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN 976

Query: 1130 NNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFAD-DLFLRDALYQT----- 1183
               G        +D+ R  VQ   E       +E  +   F + D   R+ L ++     
Sbjct: 977  IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL 1036

Query: 1184 ---AHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEA 1240
               A ++ T+FVLD TTWLRHF HIYKLA+S VLKFAICLTTF ELRFLRK KDE+V+EA
Sbjct: 1037 NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA 1096

Query: 1241 ATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSK 1300
            ATRA+I VRQLY E KLL LRFTGNVA H+EEHLE EE++TW+SHVDEFVI+A+ KAQ K
Sbjct: 1097 ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK 1156

Query: 1301 FQEMNXXXXXXXXXXXXXRAHDDRSGLK--FVVLVTDDSNMRKKAQDQDVRTFSTKFVFS 1358
            F  +N              + D +S  +  FV LVTDD NMR KAQ   +RTFST+FVF+
Sbjct: 1157 FNVLNNDAIEKGKDCIPL-SEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFA 1215

Query: 1359 LCNSIGLRSKICTN 1372
            +C  +G  + +CTN
Sbjct: 1216 ICRELGRETGVCTN 1229

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  540 bits (1390), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 264/376 (70%), Positives = 293/376 (77%), Gaps = 43/376 (11%)

Query: 415 QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
           QAL+QKLQDIYK+IVKQEI+LQ+RCSQLTTSQTT+LKNLWTIYKIN DLINNY+ F+T A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 475 LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
           LLP+Q++ D+               LWVYGTITFLD+ K+FSNFMDPEVCCQFI+HVFI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 535 ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
           IS +L DIP KY I WLQRLGDLSRMAIALYPSGFIDWKLSAEHWY EAMKFTYSHGKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 595 YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQLI 654
           YHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAFVERNNGNHRN QLI
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRNLQLI 635

Query: 655 EYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGC-DS----------------------- 690
           EYLKH+EVMLLP+FLES DLQ VVL+YF+ KFG  DS                       
Sbjct: 636 EYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVNIPYS 695

Query: 691 -------------------NNVNIFDTRKMFCQNPDYLRYFFRHAPAFAESHILQLVGFG 731
                                ++IF  + MF QNPD+L+YFFRH+  FA+SHILQLVGFG
Sbjct: 696 SSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQLVGFG 755

Query: 732 DPKNPFALLFELPRFL 747
           DPKNPFALLFELP+FL
Sbjct: 756 DPKNPFALLFELPKFL 771

 Score =  462 bits (1188), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 260/581 (44%), Positives = 352/581 (60%), Gaps = 68/581 (11%)

Query: 788  EGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGPLVVALPHFMPW 847
            E FF NI+ L+FPY +P  +EIW ESL  IN+ SLKCS++VL+KFL GP+++ALPH + W
Sbjct: 866  EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW 925

Query: 848  TYFIISLAYKIKD-LNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD--NSWKSSLV 904
             +FIIS+  KI++ +    S+ FW  F+  I PWN+IV+FLNVL+ Y+LD  N     L+
Sbjct: 926  IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI 985

Query: 905  DSLCGQYSSM---GLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKE------------- 948
             SL  +Y+SM    L ++L +FN NE LPE+WKCWGTLWFD ICNK              
Sbjct: 986  ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN 1045

Query: 949  ------QSHVED-----------LESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACR 991
                  +++ ED           L ++GI++H  LD P+DGI F ANDE G NF+KR+ R
Sbjct: 1046 NTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIR 1105

Query: 992  IIFLFKGLAENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQ 1050
            +IFL K + E FP +G+ +S     YCR   +    IL +F+FKL    D  L+ +  PQ
Sbjct: 1106 LIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIII--PQ 1163

Query: 1051 PSTTAI--------DLDH----LKNTLEIF---EEASWENIHMDTIPMLSVIEG-ESIFD 1094
                          DL+     L N +E F   E     N+++   P LS++ G E+IF+
Sbjct: 1164 TEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223

Query: 1095 YAGYRRLHPDYFSYDKNGEFLSASLYTSWYANNN----TNNTGVIPAHGSDVDSQRDAVQ 1150
            Y GY+RL+ +  S+ +NGE +S S+Y+SW  + N             H  +  + ++   
Sbjct: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENV 1283

Query: 1151 SVQEMHIFNQIMEPGYCGGFADDLFLRDALYQTAHSST---------TYFVLDTTTWLRH 1201
            +V ++   +   +      F   L  R    QT ++           T+FV D T+WLRH
Sbjct: 1284 TVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRH 1343

Query: 1202 FGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLR 1261
            F HIYKL+ +G LKFA+CLTTF ELRFLRK KD NVVEA+TRAIIT+RQLY EGKLLPLR
Sbjct: 1344 FAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLR 1403

Query: 1262 FTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKAQSKFQ 1302
            FTGNVAT IEEHLEFEE+ITWRSHVDEFVIEA+ ++Q +F+
Sbjct: 1404 FTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  438 bits (1126), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/409 (55%), Positives = 275/409 (67%), Gaps = 76/409 (18%)

Query: 415 QALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLTTA 474
           Q L+QKLQ+IYK+IV QE+ELQ++C++L+TSQ+T+LK LW+IYK+N DLINNY+ F+ T+
Sbjct: 267 QNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFILTS 326

Query: 475 LLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVFIS 534
           L PSQ+  D L              LW+YGTITFLDI KNF+NFMDPE+  QFITHVF S
Sbjct: 327 LSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHVFES 386

Query: 535 ISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGKLY 594
           ISNM+ D+P  +  PW QRLGDLSRMAIALYPS FIDWKLS+E+WY+E+MKFT+SHGKLY
Sbjct: 387 ISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHGKLY 446

Query: 595 YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNN--------- 645
           YH+STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF+ERN+         
Sbjct: 447 YHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSNNAG 506

Query: 646 --------------GNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGC--- 688
                          N +   LIEYLKHSEVMLLP+FLE+  L+ VVL YF   FG    
Sbjct: 507 SSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGKIAI 566

Query: 689 --------------------------------------DSNNV-----------NIFDTR 699
                                                  S+NV           N+F+ R
Sbjct: 567 QSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLFNFR 626

Query: 700 KMFCQ-NPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFL 747
            +F Q N D L+YFF+++  FAESHILQL+GFGDPKNPFALLF+LP++L
Sbjct: 627 NIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  291 bits (745), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 207/332 (62%), Gaps = 40/332 (12%)

Query: 1068 FEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWY--- 1124
            FE+ S +N  ++  P LS+IE ES+F+Y GY+R  PD+ ++DKNGE +S SLYTS     
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 1125 ----------------ANNNTNNTGVIPAHGSDVDSQRDAVQSVQ-------EMHIFNQI 1161
                            AN+ +NN     A  +      ++  ++        E  IFN+I
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1162 MEPGYCGGFADDLFLRDALYQTA-HSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICL 1220
            ++P Y     D+++  +  + T+   S TYFVLD T+WLRHF H+YKLA++G+LKFAICL
Sbjct: 1270 LDPDYKN--IDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICL 1327

Query: 1221 TTFHELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKI 1280
            TTF ELRFLRK KDENV+EAATRAIIT+RQLYSE +LLPLRFTGN+ATHIEEHLEFEE+I
Sbjct: 1328 TTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQI 1387

Query: 1281 TWRSHVDEFVIEAVYKAQSKFQEMNXXXXXXXXXXXXXRAHDDRSGLK-------FVVLV 1333
            TWRSHVDEFVIEA+ +AQ K ++                  ++              VLV
Sbjct: 1388 TWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLV 1447

Query: 1334 TDDSNMRKKAQ----DQDVRTFSTKFVFSLCN 1361
            TDD +M KK Q    D D+ TFSTKFVFSLCN
Sbjct: 1448 TDDISMIKKRQEEKSDNDIITFSTKFVFSLCN 1479

 Score =  289 bits (739), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 194/269 (72%), Gaps = 5/269 (1%)

Query: 777  EDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFLKGP 836
            EDE  D +S P+ FF N+E+L+  + +P++LEIWNESL YIN+ SL CS++VL+KFL GP
Sbjct: 779  EDEMLDNLS-PQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837

Query: 837  LVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAYMLD 896
            L V+LPH +PW+YFIISLA +I+ L +  SR FW++F+ +IFPWN+IVS+LNV+I+ +LD
Sbjct: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897

Query: 897  NSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEV-LPEVWKCWGTLWFDTICNKEQSHVEDL 955
            N +++S++  L   YS+  L++LL  FN NE  LPEVWKC+G+LWFD I    Q +  D 
Sbjct: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957

Query: 956  -ESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP--IGITLSPV 1012
             +++ +K+   L+ PIDG+ FD  +E+G NFWKR+CR+IFLFK +   F    G+T+S  
Sbjct: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017

Query: 1013 APVYCRRNDVSPYHILKSFSFKLRRGSDS 1041
              VYC R+D+   HIL++F+FKL    D+
Sbjct: 1018 TSVYCNRSDIPNNHILRTFAFKLLPDDDN 1046

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 179/861 (20%), Positives = 349/861 (40%), Gaps = 181/861 (21%)

Query: 453  LWTIYKINSDLINNYVTFLTTALLPSQTEQDILXXXXXXXXXXXXXXLWVYGTITFLDIF 512
            L  ++K+++ +++ Y  F+  AL  + T++D++              L  +     L+I 
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 513  KNFSNFM----------DPEVCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAI 562
            +N+ N M          + +   +FI    I I++ML +IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 563  ALYPSGFIDWKLSAEHWY-----MEAMKFTYSHGK----------LYYHMSTVQQNTLEA 607
             L       ++L++ H Y     + A+ ++ ++GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 608  FVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR---NTQLIEYLKHSEVML 664
             V L K +  ++T +  +   QL ID I  +   ++ N        T L++Y       L
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYFT-----L 378

Query: 665  LPSFLES------ADLQQVVLIYFKAKFGCDSNNVNIFDTRK-MFCQ----NPDYLRYFF 713
            L  F  S      + +++  L YF  +F  +  ++N    RK + C+      +Y  ++F
Sbjct: 379  LSLFFGSTSSSQLSGMERSSLHYFWNEFA-NEYHLNYSSLRKPVNCKYRQKEINYSMFYF 437

Query: 714  RHAPAFAESHILQLVGFGDPKNPFALLFELPRFLXXXXXXXXXXXXXXXXXXXXXXXMAI 773
             +AP F+   I++ +      NPF  +++                             + 
Sbjct: 438  NNAPLFSLISIVETIIMNKKLNPFFCVYK-----------------------------SS 468

Query: 774  DDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKFL 833
            DD E                I+++        +L  W   +  ++ T L  + ++ +KFL
Sbjct: 469  DDFE----------------IKSV--------SLSNWKILIEQMDDTLLHSNKLLFKKFL 504

Query: 834  KGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIAY 893
               + ++ P  +PW  F IS+A ++ ++        W + +  + PW+ IV++LN  I  
Sbjct: 505  MLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDM 564

Query: 894  MLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNK-EQSHV 952
            +  +S  S  + +L     S  L DLL Y        E+  C G +WFD++ +K +Q+ +
Sbjct: 565  VNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASI 624

Query: 953  EDLESV-GIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAENFP----IGI 1007
               ES+   K++   +A  D + +D +D+     W RA  II L K +  ++P    + I
Sbjct: 625  TTNESLMKFKSY---NASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPELIDVSI 681

Query: 1008 TLSPVAPVYCRRN-DVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLKNTLE 1066
                +    C +N D      L  + F+L                +   ID D L     
Sbjct: 682  RGQSLTNSSCIKNSDSLTNDYLFDWGFELNNN-------------NAVIID-DTLHGRNR 727

Query: 1067 IFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGE----FLSASLYTS 1122
            IF+                       F Y       PD+  +DKNG+    +   S Y  
Sbjct: 728  IFK-----------------------FSYI------PDFQDFDKNGDITWGYSLISNYDY 758

Query: 1123 WYANN-NTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLRDALY 1181
             Y+N+ N+   G           QR + + +   + +++     Y     ++ F+ D L 
Sbjct: 759  IYSNDFNSEEDGNF--------FQRYSRRLLSAHNDYSEDKSKKYLPKLENNYFMVDTL- 809

Query: 1182 QTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRK-PKDENVVEA 1240
                            WL+H   + +  +   +K  + ++  ++L  L+   + E+V  +
Sbjct: 810  ---------------AWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSS 854

Query: 1241 ATRAIITVRQLYSEGKLLPLR 1261
            A+R +I +  LY+  ++  L+
Sbjct: 855  ASRVMIVINYLYAMNQINILK 875

>Skud_3.78 Chr3 complement(121467..123206) [1740 bp, 579 aa] {ON}
           YCR014C (REAL)
          Length = 579

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 907 LCGQYSSMGLEDLLDYFNNN-EVLPEVWKCWGTLWFDTICNKEQSHVEDL 955
           L G   S+GLED L YF N   + PE+ K W  L F++ C+  ++  E+ 
Sbjct: 254 LPGLNDSIGLEDSLKYFKNCYGIGPEIAKRWNLLNFESFCSAAKNDPEEF 303

>NCAS0A10570 Chr1 complement(2105372..2106049) [678 bp, 225 aa] {ON}
            Anc_3.269 YBR057C
          Length = 225

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1011 PVAPVYCRRNDVSPYHILKSFSFKLR-RGSDSELVPMNPPQPSTTAIDLDHLKNTLE 1066
            P+     + N V+P  IL   SF    RGS ++++ +   Q S+  I++DHLK+ L+
Sbjct: 35   PMNMYQYQHNQVNPDAILGDISFNSNARGSKNDVLSIKETQLSSLQIEMDHLKSILK 91

>Suva_3.39 Chr3 complement(52950..54701) [1752 bp, 583 aa] {ON}
           YCR014C (REAL)
          Length = 583

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 907 LCGQYSSMGLEDLLDYFNNN-EVLPEVWKCWGTLWFDTICNKEQSHVEDLES 957
           L G   SM LED L+YF N   + PE+ K W  L +++ C   +   ED  S
Sbjct: 259 LPGLNDSMALEDKLNYFKNCYGIGPEIAKRWNLLNYESFCIASKKDPEDFIS 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,877,979
Number of extensions: 5376080
Number of successful extensions: 15574
Number of sequences better than 10.0: 36
Number of HSP's gapped: 15702
Number of HSP's successfully gapped: 64
Length of query: 1372
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1250
Effective length of database: 39,492,147
Effective search space: 49365183750
Effective search space used: 49365183750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 72 (32.3 bits)