Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B16368g5.705ON85854328e-57
TBLA0G010305.705ON89812922e-35
Kpol_YGOB_1043.725.705ON88802852e-34
NCAS0A031805.705ON88802801e-33
KAFR0H001905.705ON82802694e-32
YKR095W-A (PCC1)5.705ON88812696e-32
Kwal_YGOB_Anc_5.7055.705ON88802634e-31
KLTH0E00990g5.705ON89812635e-31
TDEL0B021505.705ON91792611e-30
NDAI0E050605.705ON86862573e-30
Smik_11.3595.705ON88792565e-30
Skud_11.3355.705ON94862567e-30
KLLA0A00539g5.705ON87792541e-29
SAKL0E14982g5.705ON89792522e-29
KNAG0C066205.705ON101802505e-29
TPHA0E002005.705ON85742471e-28
Suva_11.3325.705ON111742447e-28
AFR289W5.705ON81812262e-25
Ecym_40165.705ON125762128e-23
CAGL0G02535g5.705ON140541772e-17
KLTH0D03212g1.262ON24823640.97
Kwal_33.149892.610ON121423641.1
Kpol_387.77.275ON55247621.8
TBLA0J003708.642ON47150622.0
TDEL0A040905.546ON33440603.8
Ecym_12751.374ON45128595.1
KAFR0G007807.494ON110455595.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B16368g
         (85 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   171   8e-57
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   117   2e-35
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   114   2e-34
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   112   1e-33
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   108   4e-32
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   108   6e-32
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   105   4e-31
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   105   5e-31
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   105   1e-30
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   103   3e-30
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   103   5e-30
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   103   7e-30
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   102   1e-29
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   101   2e-29
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   100   5e-29
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...   100   1e-28
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...    99   7e-28
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    92   2e-25
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    86   8e-23
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    73   2e-17
KLTH0D03212g Chr4 (308786..309532) [747 bp, 248 aa] {ON} similar...    29   0.97 
Kwal_33.14989 s33 (904037..907681) [3645 bp, 1214 aa] {ON} YMR04...    29   1.1  
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    28   1.8  
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    28   2.0  
TDEL0A04090 Chr1 (729571..730575) [1005 bp, 334 aa] {ON} Anc_5.5...    28   3.8  
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    27   5.1  
KAFR0G00780 Chr7 complement(196611..199925) [3315 bp, 1104 aa] {...    27   5.3  

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  171 bits (432), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRV 60
          MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRV
Sbjct: 1  MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRV 60

Query: 61 LRVGVSSVIDSVKTIVETIDELDYM 85
          LRVGVSSVIDSVKTIVETIDELDYM
Sbjct: 61 LRVGVSSVIDSVKTIVETIDELDYM 85

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (83%)

Query: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62
           ++H L L IPF   + +++A +VLRPDPILRP+DFQV+Y SKGN L ++F+S+DDRVLR
Sbjct: 9  QMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLR 68

Query: 63 VGVSSVIDSVKTIVETIDELD 83
          VGVSSVIDSVKTI+ET DEL+
Sbjct: 69 VGVSSVIDSVKTIIETFDELE 89

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/80 (67%), Positives = 65/80 (81%)

Query: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62
           +DH L   IPF   R +E+AV+VL+PDPIL+P+DFQV Y S  NLL + FKS+DDRVLR
Sbjct: 8  EMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLR 67

Query: 63 VGVSSVIDSVKTIVETIDEL 82
          VGVSSVIDSVKTI+ET+DEL
Sbjct: 68 VGVSSVIDSVKTIIETMDEL 87

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (83%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          LD+ L+L IPF   R +++A KVL PDPIL+P+DFQVEY S+ N+L + F+ +DDRVLRV
Sbjct: 9  LDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68

Query: 64 GVSSVIDSVKTIVETIDELD 83
          GVSSVIDS+KTI+ETIDELD
Sbjct: 69 GVSSVIDSIKTIIETIDELD 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  108 bits (269), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 67/80 (83%)

Query: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62
          +LDH L L IPF + + + +AV VL+PDPILRP+DFQV YK++ N+   +F+S+DDRVLR
Sbjct: 2  NLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLR 61

Query: 63 VGVSSVIDSVKTIVETIDEL 82
          VGVS+VIDS+KTI+ET+DEL
Sbjct: 62 VGVSNVIDSLKTIIETMDEL 81

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  108 bits (269), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%)

Query: 2  NHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVL 61
            LDH L L IPF  +R + +A KVL PDPIL+P+DFQV+Y S+ N++ + F+S+DDRVL
Sbjct: 7  KSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVL 66

Query: 62 RVGVSSVIDSVKTIVETIDEL 82
          RVGVSS+IDS+KTIVE +D L
Sbjct: 67 RVGVSSIIDSIKTIVEAMDVL 87

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  105 bits (263), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 64/80 (80%)

Query: 3  HLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLR 62
          +L + L+L +PF ND+ +  AV+VL+PDPIL+P+DF VEY S  N L + F+ VDDRVLR
Sbjct: 8  NLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLR 67

Query: 63 VGVSSVIDSVKTIVETIDEL 82
          VGVSSVI+S+KTIVETIDE 
Sbjct: 68 VGVSSVIESIKTIVETIDEF 87

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  105 bits (263), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 64/81 (79%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          L + L+L +PF   + +E AVKVL+PDPIL+P+DF VEY SK + L + F+ VDDRVLRV
Sbjct: 9  LAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRV 68

Query: 64 GVSSVIDSVKTIVETIDELDY 84
          GVSSVI+S+KTI+ETIDE  +
Sbjct: 69 GVSSVIESIKTIIETIDEFSH 89

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  105 bits (261), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          L+H+L L IPF     + +A +VL PDPIL+P+DFQV+Y +  N+L + F+S+DDRVLRV
Sbjct: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62

Query: 64 GVSSVIDSVKTIVETIDEL 82
          GVSSVIDS+KTIVETIDEL
Sbjct: 63 GVSSVIDSIKTIVETIDEL 81

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  103 bits (257), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 66/86 (76%), Gaps = 4/86 (4%)

Query: 1  MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEY----KSKGNLLEIDFKSV 56
          M  LD+ L + IPFP +R + +A +VL PDPIL+PEDFQVEY        N+L + F+S+
Sbjct: 1  MRTLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSI 60

Query: 57 DDRVLRVGVSSVIDSVKTIVETIDEL 82
          D+RVLRVGVSSV+DS+KTI+ET+DEL
Sbjct: 61 DERVLRVGVSSVLDSIKTILETMDEL 86

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  103 bits (256), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 64/79 (81%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          L H L L +PF  ++ + +A +VL PDPIL+P+DFQ++Y S+ N++ + F+S+DDRVLRV
Sbjct: 9  LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRV 68

Query: 64 GVSSVIDSVKTIVETIDEL 82
          GVSSVIDS+KT+VE +DEL
Sbjct: 69 GVSSVIDSIKTVVEAMDEL 87

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  103 bits (256), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (75%), Gaps = 6/86 (6%)

Query: 3  HLDHNL------HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSV 56
           LD+ L       L IPF  +  + +A KVL PDPIL+P+DFQV+Y S+ N++ + F+S+
Sbjct: 8  SLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSI 67

Query: 57 DDRVLRVGVSSVIDSVKTIVETIDEL 82
          DDRVLRVGVSSVIDS+KTIVETIDEL
Sbjct: 68 DDRVLRVGVSSVIDSIKTIVETIDEL 93

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  102 bits (254), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
           +H+LHL IPF + + ++VA KVL PDPI++PEDFQV Y ++   L  DF+SVD+R+LRV
Sbjct: 8  FEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRV 67

Query: 64 GVSSVIDSVKTIVETIDEL 82
          GV+SVI+S+KTIVETIDEL
Sbjct: 68 GVNSVIESIKTIVETIDEL 86

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  101 bits (252), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 62/79 (78%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          LDH+L+L IP      + +A+K L+PDP+L+PEDFQVEY +    L + FKS+DDRVLRV
Sbjct: 9  LDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRV 68

Query: 64 GVSSVIDSVKTIVETIDEL 82
          GVSSVI+SVKTI+ET+DE 
Sbjct: 69 GVSSVIESVKTIIETMDEF 87

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  100 bits (250), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 60/80 (75%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          LDH L L +PF   R + +A +VL+PDPIL+P+DF V Y ++G  LE  F   D RVLRV
Sbjct: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70

Query: 64 GVSSVIDSVKTIVETIDELD 83
          GVSSVIDS+KTI+E++DELD
Sbjct: 71 GVSSVIDSLKTIIESLDELD 90

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 99.8 bits (247), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 62/74 (83%)

Query: 9  HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVSSV 68
           L IPF   + + +A +VL+PDP LRPE+F+V+Y S+G+ L ++F+SVDDRVLRVGVS+V
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 69 IDSVKTIVETIDEL 82
          IDS+KTI+ETIDEL
Sbjct: 69 IDSIKTIIETIDEL 82

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score = 98.6 bits (244), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 60/74 (81%)

Query: 9   HLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVSSV 68
            L IPF  ++ + +A +VL PDPIL+P+DFQ +Y S+ N++   F+S+DDRVLRVGVSSV
Sbjct: 37  ELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSV 96

Query: 69  IDSVKTIVETIDEL 82
           IDS+KTI+ET+DEL
Sbjct: 97  IDSIKTIIETMDEL 110

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 91.7 bits (226), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 57/81 (70%)

Query: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          +DH LHL +PF + R +++A + L PDP+LRPE+  V + S G  L I   ++D RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 64 GVSSVIDSVKTIVETIDELDY 84
            +S+ +++KT+VET DELD+
Sbjct: 61 ATNSIFEALKTVVETADELDF 81

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 86.3 bits (212), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 57/76 (75%)

Query: 7   NLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVS 66
           N  L +PF N + +E+A +VL  DP+LRPEDF+V+Y  +   L ++F S+D R LRVGVS
Sbjct: 48  NRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVS 107

Query: 67  SVIDSVKTIVETIDEL 82
           SVI+S+KT+VET+DE 
Sbjct: 108 SVIESIKTVVETMDEF 123

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 72.8 bits (177), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (79%)

Query: 10 LTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63
          L +PF   R + +A +VL+PDPILRPEDFQVEY++K  +L+I FK++DDRVLR 
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRT 84

>KLTH0D03212g Chr4 (308786..309532) [747 bp, 248 aa] {ON} similar
          to uniprot|P36121 Saccharomyces cerevisiae YKR025W
          RPC37 RNA polymerase III subunit C37
          Length = 248

 Score = 29.3 bits (64), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 30 DPILRPEDFQVEYKSKGNLLEID 52
          DP+L P   QV YKSK +L E+D
Sbjct: 64 DPVLHPPVSQVRYKSKSSLWELD 86

>Kwal_33.14989 s33 (904037..907681) [3645 bp, 1214 aa] {ON} YMR047C
           (NUP116) - Nuclear pore complex protein that is member
           of GLFG repeat-containing family of nucleoporins and is
           highly homologous to Nup100p [contig 98] FULL
          Length = 1214

 Score = 29.3 bits (64), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 52  DFKSVDDRVLRVGVSSVIDSVKT 74
           DFK  DD+VLR+  SS  DSV+T
Sbjct: 970 DFKQDDDQVLRITFSSDGDSVET 992

>Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON}
          (15235..16893) [1659 nt, 553 aa]
          Length = 552

 Score = 28.5 bits (62), Expect = 1.8,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%)

Query: 39 QVEYKSKGNLLEIDFKSVDDRVLRVGVSSVIDSVKTIVETIDELDYM 85
          Q  Y+  GN +  D +   D+ LR G+  + D  K  V +    +Y+
Sbjct: 18 QTNYERSGNYISKDNRRTKDKKLRAGLKRIDDQYKESVSSAAATEYL 64

>TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON}
           Anc_8.642 YPL133C
          Length = 471

 Score = 28.5 bits (62), Expect = 2.0,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 32  ILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVSSVIDSVKTIVETIDE 81
           +L+P D Q+ YK   N L  D ++++D   +  +   I++VK  ++ I E
Sbjct: 283 LLQPYDHQLSYKKFLNYLSEDEEALNDEESKNRIIKAINTVKPALQAITE 332

>TDEL0A04090 Chr1 (729571..730575) [1005 bp, 334 aa] {ON} Anc_5.546
           YML015C
          Length = 334

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 1   MNHLDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQV 40
           +NH+  N    I FP D Y E   KV RP  I + E F++
Sbjct: 89  INHVPRN----ICFPRDFYEEALQKVPRPREISQDEQFKL 124

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 27.3 bits (59), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 58  DRVLRVGVSSVIDSVKTIVETIDELDYM 85
           DR+L+ G  +  D+VK +V+ ++ ++YM
Sbjct: 140 DRILKKGRFTETDAVKIVVQMLEAIEYM 167

>KAFR0G00780 Chr7 complement(196611..199925) [3315 bp, 1104 aa] {ON}
            Anc_7.494 YJR109C
          Length = 1104

 Score = 27.3 bits (59), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 36   EDFQVEYKSKGNLLEIDFKSVDDRVLR-----VGVSSVIDSVKTIVETIDELDYM 85
            E  Q    +KGN+  I+    D+R LR       + SV +  KT  E +DE DY+
Sbjct: 990  EYIQKYISNKGNVQIIELPRSDNRKLRKLFQDFDIKSVFNLTKTKAENVDEEDYI 1044

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.140    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,598,733
Number of extensions: 363859
Number of successful extensions: 978
Number of sequences better than 10.0: 31
Number of HSP's gapped: 977
Number of HSP's successfully gapped: 31
Length of query: 85
Length of database: 53,481,399
Length adjustment: 57
Effective length of query: 28
Effective length of database: 46,945,437
Effective search space: 1314472236
Effective search space used: 1314472236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)