Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B05478g3.138ON23020410901e-152
TDEL0D048603.138ON2222016891e-91
KNAG0K009803.138ON2192016664e-88
KAFR0C011703.138ON2322046631e-87
TBLA0F010103.138ON2252066571e-86
NCAS0C003603.138ON2272056482e-85
Kpol_1053.113.138ON2282086396e-84
TPHA0M005103.138ON2312136372e-83
CAGL0K01265g3.138ON2462126182e-80
SAKL0C08184g3.138ON2502225765e-74
NDAI0A068003.138ON2392125722e-73
AER206C3.138ON2322165623e-72
Ecym_52693.138ON2412215624e-72
KLLA0D03795g3.138ON2342085503e-70
Kwal_56.229033.138ON2602255514e-70
Suva_7.3573.138ON2422125322e-67
Smik_6.1573.138ON2382115303e-67
Skud_7.3713.138ON2362125277e-67
YGR075C (PRP38)3.138ON2422115131e-64
KLTH0C08360g3.138ON2552235053e-63
ZYRO0C13464g3.280ON28696664.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B05478g
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {O...   424   e-152
TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON...   270   1e-91
KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.1...   261   4e-88
KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON...   259   1e-87
TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON...   257   1e-86
NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138 ...   254   2e-85
Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON} (14305.....   250   6e-84
TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}...   249   2e-83
CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} simila...   242   2e-80
SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar...   226   5e-74
NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {...   224   2e-73
AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON} ...   221   3e-72
Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to...   221   4e-72
KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {O...   216   3e-70
Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {O...   216   4e-70
Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}...   209   2e-67
Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}...   208   3e-67
Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}...   207   7e-67
YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}  P...   202   1e-64
KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar...   199   3e-63
ZYRO0C13464g Chr3 complement(1066947..1067807) [861 bp, 286 aa] ...    30   4.1  

>ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 230

 Score =  424 bits (1090), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL
Sbjct: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDENFNNKYIVGLIL 120
           VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDENFNNKYIVGLIL
Sbjct: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDENFNNKYIVGLIL 120

Query: 121 TYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTDEL 180
           TYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTDEL
Sbjct: 121 TYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTDEL 180

Query: 181 VDWLLVKDDIWGIPLGKCQWTEIN 204
           VDWLLVKDDIWGIPLGKCQWTEIN
Sbjct: 181 VDWLLVKDDIWGIPLGKCQWTEIN 204

>TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON}
           Anc_3.138 YGR075C
          Length = 222

 Score =  270 bits (689), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 163/201 (81%), Gaps = 1/201 (0%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M +EF+VES+LS K+LN+QSVS VIPR+ RDRIHN +YY+ NL+T +LRGDTM  L +++
Sbjct: 1   MSREFYVESYLSTKELNNQSVSLVIPRLTRDRIHNVIYYKANLHTVALRGDTMKQLCKVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDE-NFNNKYIVGLI 119
           +RDLG L+  S+N+ NVLGGVEF+C+LMKLVEI+PT+DQL  +L++   ++NNKY++ L+
Sbjct: 61  IRDLGTLQSTSINRKNVLGGVEFKCILMKLVEIRPTWDQLALLLRNPHPSYNNKYVIALV 120

Query: 120 LTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTDE 179
           LTYLR+QY+YL  DD  A+  +  F++Y  DYRK+KSV L+ DCWS SQ + V+I+H DE
Sbjct: 121 LTYLRVQYFYLKNDDILAQNIKGAFKEYICDYRKMKSVSLEMDCWSASQNVTVEIIHMDE 180

Query: 180 LVDWLLVKDDIWGIPLGKCQW 200
           LVDWL  KD+IWGIPLG+CQW
Sbjct: 181 LVDWLTTKDEIWGIPLGRCQW 201

>KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.138
           YGR075C
          Length = 219

 Score =  261 bits (666), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 118/201 (58%), Positives = 157/201 (78%), Gaps = 1/201 (0%)

Query: 4   EFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVRD 63
           EF VES +S KQLNHQSVS VIPR+ RD++H+ +YY+VNL   SLRGDTM  LS++L+RD
Sbjct: 5   EFQVESHISTKQLNHQSVSLVIPRLTRDKVHHVLYYKVNLEVGSLRGDTMLQLSKVLIRD 64

Query: 64  LGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ-DDENFNNKYIVGLILTY 122
           LG +K  ++NQ ++LGGVEF+CLLMKLVEI+PT +QL  +L+  ++ F++KYIV LILTY
Sbjct: 65  LGTIKANTLNQTHILGGVEFKCLLMKLVEIRPTREQLVYILETQNKTFDDKYIVALILTY 124

Query: 123 LRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTDELVD 182
           +RIQY+Y+ + D  AR+ +  F+ Y  D+RKLK+V  +QDCWS+SQ INV + H DEL+D
Sbjct: 125 IRIQYFYVTLHDELARKWRELFKTYMKDFRKLKAVDFEQDCWSQSQKINVKVTHLDELID 184

Query: 183 WLLVKDDIWGIPLGKCQWTEI 203
           WL+ +  IWGIPLG CQW  I
Sbjct: 185 WLVTETQIWGIPLGMCQWCNI 205

>KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON}
           Anc_3.138 YGR075C
          Length = 232

 Score =  259 bits (663), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 155/204 (75%), Gaps = 4/204 (1%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M  EFHVESFLS KQLNHQSVS +IPR+ RDRIHN +YY+VNL   SLRGDT+  LS+++
Sbjct: 1   MSSEFHVESFLSAKQLNHQSVSLIIPRLTRDRIHNNIYYKVNLQPTSLRGDTLLELSKVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTML---QDDENFNNKYIVG 117
           +RDLG LKD SVN+V+VLGG+EF+CLLMKL+EI+PT +QL  ML     + NF +KYI  
Sbjct: 61  IRDLGTLKDLSVNKVHVLGGMEFKCLLMKLIEIRPTINQLFAMLNPANANTNFEDKYITA 120

Query: 118 LILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHT 177
           LI+TYLRIQY+YL  D     R ++ F++   DYRKLKS+ L  DCWS S+ + V ++H 
Sbjct: 121 LIITYLRIQYFYL-TDAQECLRMKNLFKKCIKDYRKLKSLSLQSDCWSPSEELTVAVVHM 179

Query: 178 DELVDWLLVKDDIWGIPLGKCQWT 201
           DEL +WL+ K+ IWGIPLGKCQW 
Sbjct: 180 DELTEWLVSKEQIWGIPLGKCQWA 203

>TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON}
           Anc_3.138 YGR075C
          Length = 225

 Score =  257 bits (657), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 158/206 (76%), Gaps = 3/206 (1%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M +EF VES +S KQLNHQSVS VIPR+ RD+IH+A+YY+VNL   S+RG+T+  L+ ++
Sbjct: 3   MSKEFFVESQVSSKQLNHQSVSLVIPRLTRDKIHSALYYKVNLQDPSMRGNTLLGLNNVI 62

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDE---NFNNKYIVG 117
           +RDLG L + S+N+ NVLGGVEF+C+LMKLVE++PT +QL  +L+  +    FNNKYI+ 
Sbjct: 63  IRDLGTLNNESINKKNVLGGVEFKCILMKLVELRPTIEQLDIILEISDATGEFNNKYIIA 122

Query: 118 LILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHT 177
           LIL YLRIQYYY       A+R ++ F+QY NDYRK+K++ L+ DCWS+SQ I V+++H 
Sbjct: 123 LILVYLRIQYYYANETSDEAKRFKALFQQYINDYRKMKAISLNIDCWSQSQIITVELIHM 182

Query: 178 DELVDWLLVKDDIWGIPLGKCQWTEI 203
           DELV WL  KD+IWGIPLGKC W  I
Sbjct: 183 DELVHWLSAKDNIWGIPLGKCSWCNI 208

>NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138
           YGR075C
          Length = 227

 Score =  254 bits (648), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 158/205 (77%), Gaps = 6/205 (2%)

Query: 3   QEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVR 62
           ++F VES +S K+LN+QSVS VIPR+ RD+IHN +YY+VNL + SLRG+TM  LS+I++R
Sbjct: 4   RDFFVESHISSKELNNQSVSLVIPRLTRDKIHNVLYYKVNLTSTSLRGNTMLQLSKIIIR 63

Query: 63  DLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQD----DENFNNKYIVGL 118
           DLG LKD +  +  ++GGVEF+CLLMKL+EI+PTFDQ+T +L+     D+ F NKYIV L
Sbjct: 64  DLGQLKDSNSLKNYLVGGVEFKCLLMKLIEIRPTFDQITMLLEKKKSPDDTFENKYIVAL 123

Query: 119 ILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILHTD 178
           ILTYLRIQYYYL + D  A    + FR+Y NDYRKLK + +D DCWS SQ + V+I+H D
Sbjct: 124 ILTYLRIQYYYLKLHD--ASHLINLFREYINDYRKLKGIDMDMDCWSMSQQLKVEIIHID 181

Query: 179 ELVDWLLVKDDIWGIPLGKCQWTEI 203
           ELVD L   ++IWGIPLGKCQW+ I
Sbjct: 182 ELVDRLATNNNIWGIPLGKCQWSNI 206

>Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON}
           (14305..14991) [687 nt, 229 aa]
          Length = 228

 Score =  250 bits (639), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 162/208 (77%), Gaps = 5/208 (2%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M  EF VES LS KQLN+QSVS VIPRI RD+IHN++YY+ NL+ +SLRG  M  L  ++
Sbjct: 1   MSNEFLVESHLSNKQLNNQSVSLVIPRITRDKIHNSIYYKANLDNSSLRGLNMLQLIEVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTM--LQDD--ENFNNKYIV 116
           VRDLG LKD SVNQV  LGGVEF+C+LMKL+EI PT++QL T+  +QD+  +NF+NKY+V
Sbjct: 61  VRDLGTLKDKSVNQVCFLGGVEFKCILMKLIEICPTWEQLMTIIQMQDNVIDNFDNKYLV 120

Query: 117 GLILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDILH 176
            L+LTY+RIQYYY   D+  +++ +  F +  +DYRKLKSV +D DCWS SQ+I + I+H
Sbjct: 121 ALVLTYIRIQYYY-DNDEVNSKKYRELFSKCISDYRKLKSVAMDTDCWSMSQSIEIKIIH 179

Query: 177 TDELVDWLLVKDDIWGIPLGKCQWTEIN 204
            DELVDWL  +D+IWGIPLG CQW+++N
Sbjct: 180 LDELVDWLCSEDEIWGIPLGHCQWSDLN 207

>TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}
           Anc_3.138 YGR075C
          Length = 231

 Score =  249 bits (637), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 156/213 (73%), Gaps = 9/213 (4%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M  EF VE++LS KQLN+QSVS VIPR+ RD+IHN+MYY+VNL   SLRG+T+  LS+++
Sbjct: 1   MSHEFAVEAYLSSKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLTDNSLRGNTVLQLSKVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDENFN--------- 111
           VRDLG L +GS  Q+NV+GGVEF+C+LMKLVE++PT++QL ++L  D +FN         
Sbjct: 61  VRDLGTLLNGSSQQLNVIGGVEFKCILMKLVEMRPTWEQLLSLLNIDNDFNSVGTVGEFD 120

Query: 112 NKYIVGLILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTIN 171
           NKYI  L+LTY+RIQY+++  D     +C+  F+ Y NDYRKLKS+    +CWS SQ I+
Sbjct: 121 NKYITALVLTYIRIQYHFINSDHQLFNKCKKLFKLYMNDYRKLKSIAFGTNCWSMSQAID 180

Query: 172 VDILHTDELVDWLLVKDDIWGIPLGKCQWTEIN 204
           V I H DELV+WL  K+DIWG+PL  C W  ++
Sbjct: 181 VGIGHIDELVEWLATKNDIWGLPLAMCSWCNLD 213

>CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} similar
           to uniprot|Q00723 Saccharomyces cerevisiae YGR075c
           Pre-mRNA splicing factor
          Length = 246

 Score =  242 bits (618), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 118/212 (55%), Positives = 157/212 (74%), Gaps = 9/212 (4%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M  EF  ESF+S KQLN+QSVS VIPRI RD+IHN +YYR NL+  S+RGDTM  L+ I+
Sbjct: 1   MSAEFQYESFISEKQLNNQSVSLVIPRITRDKIHNNIYYRCNLHPVSMRGDTMLNLAPII 60

Query: 61  VRDLGALKD---GSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDD---ENFNNKY 114
           +RDLG L++     +N   +LGG EF+CLLMKL+EI+PT++Q+ T++ ++   E+F NKY
Sbjct: 61  IRDLGKLRNPYQKPLNATLLLGGSEFKCLLMKLIEIRPTWEQIMTLINEEMVEESFENKY 120

Query: 115 IVGLILTYLRIQYYYLPVDDPW---ARRCQSFFRQYYNDYRKLKSVQLDQDCWSKSQTIN 171
           IV L+L Y RIQYY+L   D +   A + +  F++Y NDYRKLK++ L+ DCWS SQ  N
Sbjct: 121 IVALVLVYGRIQYYFLTFSDDYYDDAIKWRRLFKKYLNDYRKLKALDLNVDCWSTSQMQN 180

Query: 172 VDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           V+++H DE+VDWL  KDDIWGIPLGKCQW  +
Sbjct: 181 VELIHLDEIVDWLATKDDIWGIPLGKCQWANV 212

>SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 250

 Score =  226 bits (576), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 141/222 (63%), Gaps = 19/222 (8%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M +EF VE+ LS KQLNHQS S VIP++ R R+HN+MYY+VNL+   LRG  M  L++++
Sbjct: 1   MSREFQVEANLSNKQLNHQSTSLVIPQLTRVRVHNSMYYKVNLDAVGLRGVNMCQLAKVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ----DDENFNNKYIV 116
           VRDLG+L  G      V GGVEF+CLL KLV I+PT+ Q+  ML         FNNKYIV
Sbjct: 61  VRDLGSLAHGGTCTAGVCGGVEFKCLLTKLVHIRPTWRQVVAMLGLGKPQHAGFNNKYIV 120

Query: 117 GLILTYLRIQYYYLPVDDPW---------------ARRCQSFFRQYYNDYRKLKSVQLDQ 161
            L+L YLR QYYYLP +                  +R  +  F  + NDYRK+KS  L  
Sbjct: 121 VLVLVYLRAQYYYLPAEGGTMAGGVEQLAKLNRVSSRALRQLFGHFINDYRKVKSFSLAA 180

Query: 162 DCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           DCWS S    V++LH DE+VDWL  K++IWGIPLG CQW +I
Sbjct: 181 DCWSSSVEKRVELLHVDEVVDWLCTKNEIWGIPLGICQWCDI 222

>NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {ON}
           Anc_3.138 YGR075C
          Length = 239

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 112/212 (52%), Positives = 151/212 (71%), Gaps = 13/212 (6%)

Query: 2   PQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILV 61
             EF VESF+S KQLN+ SVS VIPRI RD+IHN++YY+VNL + SLRG+TM  L +++V
Sbjct: 4   SNEFFVESFISNKQLNNSSVSLVIPRITRDKIHNSIYYKVNLTSQSLRGNTMVQLIQVIV 63

Query: 62  RDLGALK--------DGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ--DDENFN 111
           RD G LK        D  V + +++GG EF+CLLMK++E+KPT +Q+  +L+  DD  F+
Sbjct: 64  RDFGKLKSQSHSHSSDTMVVRNHLVGGTEFKCLLMKIIELKPTIEQIWILLEDHDDTEFD 123

Query: 112 NKYIVGLILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLDQDCW---SKSQ 168
           NKYI  LI+TY+RIQY+++  +D  AR+ Q  F++  N+Y KLK  QLD DCW       
Sbjct: 124 NKYITVLIITYIRIQYFFIGKNDSLARKFQDIFQKCLNNYTKLKCFQLDADCWSPSLSLS 183

Query: 169 TINVDILHTDELVDWLLVKDDIWGIPLGKCQW 200
             +V I++ DE+VDWLL KD+IWGIPLGKCQW
Sbjct: 184 EESVRIIYMDEVVDWLLTKDNIWGIPLGKCQW 215

>AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR075C
           (PRP38)
          Length = 232

 Score =  221 bits (562), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 146/216 (67%), Gaps = 16/216 (7%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           MPQEF VES +S KQL++QS S VIP+I R RIHN+MYY++NL    LRG+T+  L R+L
Sbjct: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ-DDE----NFNNKYI 115
           VRDLGA K  S   +++ G  EFQCLLMK++EI+PT+ Q+ T+LQ  DE     FNNKYI
Sbjct: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120

Query: 116 VGLILTYLRIQYYYLPVD-----------DPWARRCQSFFRQYYNDYRKLKSVQLDQDCW 164
             LIL YLRIQYY+L  +           D  A + ++ F  +  DYRK+K + L+ DCW
Sbjct: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180

Query: 165 SKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQW 200
           S +   +V + H DE+VDWL  KD IWGIPLG+C+W
Sbjct: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216

>Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to
           Ashbya gossypii AER206C
          Length = 241

 Score =  221 bits (562), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 142/221 (64%), Gaps = 21/221 (9%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M +EF VES +S KQLNHQS S VIP+I R RIHN+MYY+VNL+ ASLRG+TM  +S+++
Sbjct: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDE------NFNNKY 114
           +R+LG  K+ S       G VEFQCLLMK+VEI+PT+ QL  MLQ D+       FNNKY
Sbjct: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120

Query: 115 IVGLILTYLRIQYYYL---------------PVDDPWARRCQSFFRQYYNDYRKLKSVQL 159
           IV LIL YLRIQYYYL                  D  A + ++ F  +  D RK+KS+ L
Sbjct: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180

Query: 160 DQDCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQW 200
             D WS S    VDI H DE+VDWL   D IWG+PLGKC W
Sbjct: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPW 221

>KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 234

 Score =  216 bits (550), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 101/208 (48%), Positives = 139/208 (66%), Gaps = 5/208 (2%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           MP EF+VE  LS KQLNHQS S V+P+I R+++ + MYY+ NL  ASLRGDT+  L  ++
Sbjct: 1   MPNEFYVEENLSGKQLNHQSASLVVPQIFRNKVSSCMYYKFNLTPASLRGDTIVELIPVI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQDDENFNNKYIVGLIL 120
           VRD G + +     V VLGG+EF+CLLMKL+ ++P ++QL  +L+  E  NNKYI  L+L
Sbjct: 61  VRDFGTMDERKTPHVTVLGGIEFKCLLMKLINLRPPWEQLKVLLEPHEPLNNKYIAALVL 120

Query: 121 TYLRIQYYYLPVDDPWARRC-----QSFFRQYYNDYRKLKSVQLDQDCWSKSQTINVDIL 175
            Y+RI YY+L   +P  +           ++Y  D+RKLKS  LD DCWS S    + ++
Sbjct: 121 CYMRISYYFLTESNPSEQDISFNLLHDLMKKYILDHRKLKSYSLDMDCWSSSIKKEIKLI 180

Query: 176 HTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           H DEL+DWL  +++IWGIPLGKC W +I
Sbjct: 181 HFDELIDWLCDRNEIWGIPLGKCNWCKI 208

>Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {ON}
           YGR075C (PRP38) - RNA splicing factor [contig 184] FULL
          Length = 260

 Score =  216 bits (551), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 114/225 (50%), Positives = 144/225 (64%), Gaps = 24/225 (10%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           MP EFH +  +S KQLNHQS S VIP++ R RIHN+MYY+VNL+ A+LRG  M  L + +
Sbjct: 1   MPLEFHFDESVSEKQLNHQSTSLVIPQLTRARIHNSMYYKVNLHPAALRGINMLQLIKKI 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ----DDENFNNKYIV 116
           V+  G  + GS     V GGVEF+CLLMKLV ++PT+ Q+  +LQ        F+NKY+V
Sbjct: 61  VKQFGTTRGGSHLVSVVCGGVEFKCLLMKLVHLRPTWSQVLLILQRGNEKTSKFDNKYLV 120

Query: 117 GLILTYLRIQYYYLPVDDPWAR------------------RCQSFFRQYYNDYRKLKSVQ 158
            L+L YLR+QYYYLP   P AR                  + Q+ FR Y NDYRK+KS+ 
Sbjct: 121 ILVLVYLRVQYYYLP--KPAARENKTCILDVEKQGDVTSDKLQNLFRIYINDYRKVKSMD 178

Query: 159 LDQDCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           LD DCWS      VD+LH DE+VDWL  +D IWGIPLGK QW +I
Sbjct: 179 LDIDCWSNLTGKKVDVLHIDEIVDWLCTQDHIWGIPLGKSQWIDI 223

>Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}
           YGR075C (REAL)
          Length = 242

 Score =  209 bits (532), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 110/212 (51%), Positives = 146/212 (68%), Gaps = 12/212 (5%)

Query: 3   QEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVR 62
           +EF VES +S KQLN+QSVS +IPR+ RD+IHN+MYY+VNL++ SLRG+TM  L +++V 
Sbjct: 4   KEFQVESHISLKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSSESLRGNTMVELLKVIVG 63

Query: 63  DLGALK--DGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ--DDENFNNKYIVGL 118
            LGALK  DG +N + VLGGVEF+C+LMKLVEI+PT  QLT +L   D   F++KYI  L
Sbjct: 64  KLGALKNQDGHLN-MTVLGGVEFKCILMKLVEIRPTLQQLTFLLNVTDPSTFSSKYITAL 122

Query: 119 ILTYLRIQYYYLPVDDPWARRCQSFFR-------QYYNDYRKLKSVQLDQDCWSKSQTIN 171
           IL Y R+QYYYL   +       +  +       +Y   + KLKS  L  DC++ S    
Sbjct: 123 ILVYARLQYYYLNDKNNNDTNDDNLIKLFKVQLYKYSQQFSKLKSFPLQVDCFAHSNNEE 182

Query: 172 VDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           + I+  DELVDWL+ +D IWGIPLGKCQW++I
Sbjct: 183 LCIIRIDELVDWLVTEDHIWGIPLGKCQWSKI 214

>Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}
           YGR075C (REAL)
          Length = 238

 Score =  208 bits (530), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 106/211 (50%), Positives = 146/211 (69%), Gaps = 12/211 (5%)

Query: 4   EFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVRD 63
           EF VES +S KQLN+QSVS ++PR+ RD+IHN+MYY+VNL+  SLRG+TM  L +++V  
Sbjct: 5   EFQVESHISSKQLNNQSVSLIVPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVIVGT 64

Query: 64  LGALK--DGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTML--QDDENFNNKYIVGLI 119
           LG  +  DG ++ V VLGGVEF+C+LMKL+EI+P F+QL  +L  ++  NFN+KYI+ LI
Sbjct: 65  LGTSRGQDGHLHMV-VLGGVEFKCILMKLIEIRPNFEQLNFLLNVKNANNFNSKYIIALI 123

Query: 120 LTYLRIQYYYLPVDDPWARRCQSFFR-------QYYNDYRKLKSVQLDQDCWSKSQTINV 172
           L Y R+QYYYL   +       +  +       +Y   Y KLKS  L +DC++ S    +
Sbjct: 124 LVYARLQYYYLNDKNNNDNDEDNLIKLFKVQLYKYSQQYFKLKSFPLQKDCFAHSYNQEL 183

Query: 173 DILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
            I+H DELVDWL+ +D IWG+PLGKCQW +I
Sbjct: 184 CIIHVDELVDWLVTQDHIWGMPLGKCQWNKI 214

>Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}
           YGR075C (REAL)
          Length = 236

 Score =  207 bits (527), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 148/212 (69%), Gaps = 12/212 (5%)

Query: 3   QEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVR 62
            EF VES +S KQLN+QSVS +IPR+ RD+IHN+MYY+VNL+  SLRG+TM  L ++++ 
Sbjct: 4   HEFQVESHISSKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSNESLRGNTMLELLKVIID 63

Query: 63  DLGALK--DGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTML--QDDENFNNKYIVGL 118
            LG L+  DG +N   VLGGVEF+C+LMKLVEI+P   QL  +L  ++ ++FN+KYI+ L
Sbjct: 64  ALGTLRGQDGHLNMA-VLGGVEFKCILMKLVEIRPNLKQLAFLLDVKNVKDFNSKYIIAL 122

Query: 119 ILTYLRIQYYYL---PVDDPWARRCQSFFR----QYYNDYRKLKSVQLDQDCWSKSQTIN 171
           +L Y R+QYYYL     ++ +       F+    +Y   + KLKS  L  DC++ SQ   
Sbjct: 123 VLVYARLQYYYLNDQNKNNSYENDLIQLFKVQLYKYSQQFFKLKSFPLQVDCFAHSQNEG 182

Query: 172 VDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
           + I+H DELVDWL+ +D IWGIPLGKCQW++I
Sbjct: 183 LCIVHVDELVDWLVTQDHIWGIPLGKCQWSKI 214

>YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}
           PRP38Unique component of the U4/U6.U5 tri-snRNP
           particle, required for conformational changes which
           result in the catalytic activation of the spliceosome;
           dispensible for spliceosome assembly
          Length = 242

 Score =  202 bits (513), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 103/211 (48%), Positives = 144/211 (68%), Gaps = 12/211 (5%)

Query: 4   EFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVRD 63
           EF VES +SPKQLN+QSVS VIPR+ RD+IHN+MYY+VNL+  SLRG+TM  L ++++  
Sbjct: 5   EFQVESNISPKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVMIGA 64

Query: 64  LGALK--DGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTML--QDDENFNNKYIVGLI 119
            G +K  +G ++ + VLGG+EF+C+LMKL+EI+P F QL  +L  +++  F++KYI+ L+
Sbjct: 65  FGTIKGQNGHLHMM-VLGGIEFKCILMKLIEIRPNFQQLNFLLNVKNENGFDSKYIIALL 123

Query: 120 LTYLRIQYYYLPVDDPWARRCQSFFR-------QYYNDYRKLKSVQLDQDCWSKSQTINV 172
           L Y R+QYYYL  ++          +       +Y   Y KLKS  L  DC++ S    +
Sbjct: 124 LVYARLQYYYLNGNNKNDDDENDLIKLFKVQLYKYSQHYFKLKSFPLQVDCFAHSYNEEL 183

Query: 173 DILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
            I+H DELVDWL  +D IWGIPLGKCQW +I
Sbjct: 184 CIIHIDELVDWLATQDHIWGIPLGKCQWNKI 214

>KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 255

 Score =  199 bits (505), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 142/223 (63%), Gaps = 20/223 (8%)

Query: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60
           M +EFHV+  +S KQLNHQS S VIP++ R RIHN+MYY++NL+ ASLRGDTM  LS+ +
Sbjct: 1   MSREFHVDENVSTKQLNHQSTSLVIPQLARTRIHNSMYYKINLDPASLRGDTMVQLSKTM 60

Query: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQD----DENFNNKYIV 116
           +RD G  +D +     V GGVEF+CLLMKLV ++P + Q+ T+LQ        F+NKY+V
Sbjct: 61  MRDFGTCRDNARRMALVCGGVEFKCLLMKLVHLRPQWGQIVTILQKGNERSSKFDNKYLV 120

Query: 117 GLILTYLRIQYYYLPVDDPWAR----------------RCQSFFRQYYNDYRKLKSVQLD 160
            L+L YLRIQYY+LP      +                  +  FR Y +DYRK+KS+ L+
Sbjct: 121 VLVLVYLRIQYYFLPDTSDEEKVTGVLNLNKRGSVSSGTLRGLFRIYLSDYRKVKSINLE 180

Query: 161 QDCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQWTEI 203
            D W  S +     LH DE+VDWL  +D IWGIPLG+CQW  I
Sbjct: 181 TDYWYNSASKVPKTLHIDEVVDWLCTQDQIWGIPLGRCQWCNI 223

>ZYRO0C13464g Chr3 complement(1066947..1067807) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P38241 Saccharomyces
           cerevisiae YBR065C ECM2 Pre-mRNA splicing factor
           facilitates the cooperative formation of U2/U6 helix II
           in association with stem II in the spliceosome function
           may be regulated by Slu7p
          Length = 286

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 15/96 (15%)

Query: 21  VSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRILVRDLGALKDGSVNQVNVLGG 80
           +S+ +P  LRDR+ + ++   +L T   R D M        R   +LKD        LGG
Sbjct: 66  LSWGVPTELRDRLLSLIHDDPSLKTQEARNDMM--------RRFLSLKDVK------LGG 111

Query: 81  VEFQCLLMKLVEIKPTFDQLTTMLQDDENFNNKYIV 116
            +       L E+KP   Q+   LQ D   +N Y++
Sbjct: 112 AQITSQTDSLEELKPLL-QINKSLQQDLYASNHYLI 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,173,434
Number of extensions: 997581
Number of successful extensions: 3197
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3234
Number of HSP's successfully gapped: 29
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)