Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B04972g3.159ON97997943980.0
YDL031W (DBP10)3.159ON99590431720.0
Skud_4.2203.159ON100190431650.0
Smik_4.2043.159ON99890531400.0
Suva_4.2183.159ON100790331340.0
NDAI0G028703.159ON99196931290.0
Kpol_1032.113.159ON97796030980.0
KAFR0C010603.159ON97396230970.0
CAGL0K01551g3.159ON96987530880.0
NCAS0C035303.159ON97796230780.0
SAKL0C08778g3.159ON100386230750.0
KLTH0C08866g3.159ON97287530560.0
KLLA0F24684g3.159ON97398830550.0
AEL086W3.159ON96096630460.0
KNAG0K011103.159ON100198230460.0
TDEL0D046303.159ON96887830330.0
Kwal_56.228043.159ON97396430280.0
TPHA0M003303.159ON98190630250.0
TBLA0B015903.159ON92987922680.0
TDEL0E042105.208ON7403965962e-64
Kpol_534.535.208ON7523965953e-64
NCAS0A015505.208ON7483965864e-63
KNAG0H025205.208ON7543965821e-62
TPHA0N007005.208ON7553965714e-61
TBLA0C061605.208ON7573955635e-60
KLLA0F15752g5.208ON7483945625e-60
Kwal_33.151655.208ON7313965615e-60
AAL164C5.208ON7343965591e-59
KNAG0B046605.337ON4944035451e-59
Skud_12.595.208ON7583965573e-59
SAKL0G12760g5.208ON7373965545e-59
KAFR0C064205.208ON7393975466e-58
KAFR0B045602.164ON5434005101e-54
NDAI0F020106.148ON8883925233e-54
ZYRO0B09856g2.164ON5403965064e-54
Kwal_14.16536.148ON6884015102e-53
YNL112W (DBP2)2.164ON5463955012e-53
CAGL0L03846g2.164ON5443965003e-53
Smik_14.2152.164ON5473954979e-53
NDAI0F027402.164ON5613964971e-52
Suva_7.1926.204ON5183864941e-52
TDEL0B040606.148ON8474005091e-52
NCAS0G025602.164ON5563964961e-52
YGL078C (DBP3)6.204ON5233864932e-52
Smik_7.2056.204ON5223864922e-52
TDEL0F011902.164ON5493954932e-52
KLTH0D09328g2.164ON5513954933e-52
Skud_7.2046.204ON5163864904e-52
Smik_2.3806.148ON8503925045e-52
Suva_14.2262.164ON5433954907e-52
YBR237W (PRP5)6.148ON8493925038e-52
Ecym_54222.164ON5603954872e-51
ZYRO0G14960g6.148ON8313964983e-51
KLLA0F10505g6.148ON8123964973e-51
TPHA0B028508.614ON6284074894e-51
Kpol_534.316.148ON8724034984e-51
Suva_4.4946.148ON8503924975e-51
Suva_8.2578.614ON6184074851e-50
KLLA0F23716g2.164ON5543954811e-50
AFL080W6.204ON5353884773e-50
Skud_2.3696.148ON8483934913e-50
NCAS0E039205.69ON4373934685e-50
SAKL0E10670g2.164ON5743954768e-50
Kpol_1033.406.204ON5303884731e-49
YHR169W (DBP8)5.69ON4313934651e-49
KLTH0H05852g6.148ON8114014823e-49
Kpol_1062.55.69ON4314044623e-49
Smik_8.2535.69ON4373934624e-49
Skud_8.2335.69ON4373934615e-49
NDAI0E015908.614ON6084034715e-49
TBLA0D035206.148ON8893924809e-49
Suva_15.3695.69ON4373934591e-48
TDEL0A055908.614ON5974024672e-48
TBLA0E041008.614ON8664204752e-48
KAFR0B015205.40ON4963994593e-48
NDAI0B009005.69ON4363934553e-48
TPHA0N011306.148ON8773914744e-48
TDEL0G009305.69ON4363934536e-48
KLLA0A09669g5.40ON4973994559e-48
TBLA0B079505.69ON3933904471e-47
ZYRO0C11660g5.69ON4354034492e-47
AER301C5.69ON4354184492e-47
SAKL0H02178g5.69ON4354094482e-47
CAGL0M13519g5.40ON4943884522e-47
KAFR0G020308.614ON6064074564e-47
KAFR0G034806.148ON8524024655e-47
Kwal_56.247605.69ON4333934465e-47
Kwal_27.117348.469ON5714004537e-47
Kpol_513.155.40ON5013994498e-47
TPHA0L021605.40ON4983944471e-46
Ecym_22696.148ON8773914621e-46
SAKL0H01430g5.40ON5003964471e-46
Ecym_13958.469ON5653904511e-46
CAGL0K07029g6.148ON8163904601e-46
KLTH0B08998g5.40ON4923994452e-46
AGR333C5.40ON5043994443e-46
NCAS0F022005.40ON5083994443e-46
Ecym_47755.40ON5003994435e-46
ZYRO0D07546g5.40ON4943994425e-46
Ecym_50955.69ON4383914385e-46
TDEL0G006505.40ON4853964391e-45
NCAS0H012806.148ON8873864541e-45
KNAG0A032808.614ON6074054451e-45
NDAI0C023205.241ON7644564512e-45
AFL221C2.164ON5573984412e-45
KNAG0M006606.148ON8843934505e-45
NCAS0B025708.469ON5904014405e-45
Kwal_23.42885.40ON4923964345e-45
TBLA0C067805.40ON4963994346e-45
NCAS0A014005.241ON7623974466e-45
KNAG0D027805.40ON4763974336e-45
YMR290C (HAS1)5.40ON5053994346e-45
TDEL0E038505.241ON7613964457e-45
Smik_13.5065.40ON5053994339e-45
Skud_13.4635.40ON5053994321e-44
Suva_13.4805.40ON5053994284e-44
CAGL0K11198g8.469ON5824044307e-44
CAGL0D03124g5.208ON7252294332e-43
ZYRO0A10802g5.241ON7714024324e-43
SAKL0A06204g6.148ON8432274325e-43
Smik_12.555.208ON7352334297e-43
YLL008W (DRS1)5.208ON7522334281e-42
AFL027C6.148ON8162064291e-42
TBLA0H032408.402ON7674194262e-42
YJL033W (HCA4)5.241ON7703974262e-42
ZYRO0B10318g5.208ON7502334252e-42
TPHA0B029302.164ON4273544102e-42
NDAI0C024905.208ON7712354235e-42
ACR040W5.241ON7633964226e-42
Smik_10.2395.241ON7703974217e-42
YOR046C (DBP5)5.643ON4824004099e-42
Suva_10.675.208ON7442334191e-41
SAKL0H11968g8.469ON5664014121e-41
Kpol_165.12.164ON4413554032e-41
Kwal_26.84702.164ON4253544022e-41
Smik_15.2245.643ON4774004044e-41
Suva_8.985.643ON4824004026e-41
KLTH0B03278g5.208ON7392334137e-41
Skud_15.2105.643ON4824004019e-41
Skud_14.2192.164ON4353673971e-40
Kpol_1058.438.87ON6074074061e-40
CAGL0F05577g8.402ON6664124082e-40
AGL112C8.402ON6584034063e-40
ZYRO0F04312g8.87ON6024034043e-40
Kwal_23.51258.87ON5984073962e-39
KLTH0A02244g8.87ON5984073953e-39
TPHA0D019905.337ON4982303903e-39
KNAG0I020502.164ON4233603854e-39
SAKL0H13574g8.402ON6684093965e-39
Kpol_340.28.402ON6704093948e-39
YFL002C (SPB4)8.87ON6064153911e-38
KAFR0D046305.337ON4872203851e-38
NDAI0C042505.337ON5042223851e-38
Ecym_32175.337ON4862223832e-38
KLLA0C14608g5.337ON4872223832e-38
KLLA0C15433g8.469ON5394063835e-38
ZYRO0B05852g3.122ON7514343897e-38
TPHA0B030401.211ON3963743747e-38
ZYRO0C14234g5.337ON4942223798e-38
Kpol_1005.115.337ON5062223781e-37
NCAS0F027905.337ON5022223781e-37
KLTH0F08382g8.402ON6574043842e-37
Smik_8.1365.337ON5012223753e-37
TDEL0E028905.337ON5012223753e-37
SAKL0G09328g5.337ON5052233753e-37
KAFR0B061708.402ON6234133804e-37
TDEL0H009301.211ON3953743675e-37
YHR065C (RRP3)5.337ON5012223735e-37
KAFR0G006501.211ON3953743666e-37
CAGL0J10912g5.337ON4932223727e-37
Skud_8.1225.337ON5032223727e-37
KLTH0F05610g1.211ON3963743651e-36
Suva_15.2545.337ON5032223711e-36
AAL041C5.337ON4872313701e-36
NCAS0A140607.336ON5101953701e-36
KLLA0A05731g1.211ON3963743632e-36
Kpol_1060.581.211ON3963743632e-36
Kwal_23.32358.402ON6764033752e-36
Ecym_60492.384ON4383893652e-36
Ecym_41658.402ON6584053743e-36
TBLA0C035005.337ON5062223683e-36
TPHA0L009608.402ON6764083743e-36
KAFR0E016405.241ON7601913754e-36
NCAS0B081301.211ON3963743605e-36
NDAI0C046808.402ON7164103735e-36
Kwal_33.143255.337ON5002223655e-36
CAGL0I04356g1.211ON3963743595e-36
ACR253C1.211ON3963733595e-36
TDEL0F052608.402ON6554083716e-36
YJL138C (TIF2)1.211ON3953743588e-36
YKR059W (TIF1)1.211ON3953743588e-36
Suva_11.2941.211ON3963743579e-36
Suva_6.2181.211ON3963743561e-35
NDAI0B054401.211ON3963743561e-35
ADR260C2.384ON4383893591e-35
SAKL0C06336g1.211ON3973733561e-35
KLTH0H15686g2.384ON4393893582e-35
Kwal_33.140001.211ON3963743562e-35
SAKL0F11088g7.336ON4971953612e-35
KLTH0F07106g5.337ON5252223622e-35
Skud_10.761.211ON3953743543e-35
TBLA0C055802.164ON5402233613e-35
TPHA0N009405.241ON7711913673e-35
NDAI0A019607.336ON5341953604e-35
Ecym_51961.211ON3963733524e-35
SAKL0G11748g5.241ON7631913665e-35
KLLA0E21935g2.384ON4373893545e-35
Skud_11.2951.211ON4293743536e-35
Smik_10.941.211ON3953743516e-35
Smik_11.3211.211ON3953743516e-35
KNAG0K004005.69ON4324033529e-35
TPHA0D045207.336ON5021953551e-34
Ecym_82615.241ON7751923631e-34
KNAG0A046608.402ON7134063621e-34
Kwal_23.28835.241ON7641963612e-34
KNAG0C038207.336ON5131983542e-34
Kpol_1004.135.241ON7681923612e-34
TBLA0D057501.211ON4013743472e-34
KLLA0C16599g7.336ON5141903532e-34
Ecym_47553.249ON3983973473e-34
Kpol_2001.677.336ON4841953513e-34
TDEL0C021007.336ON4791983495e-34
KAFR0H028208.614ON6112423546e-34
ZYRO0F11440g7.336ON5231983506e-34
YDR021W (FAL1)3.249ON3993953446e-34
KLLA0D09504g5.241ON7701913576e-34
NDAI0C036005.40ON5192293497e-34
Kwal_56.240056.204ON5331973508e-34
Ecym_46467.336ON4901953488e-34
Suva_4.1632.384ON4463893458e-34
TBLA0F023607.336ON5851983519e-34
SAKL0E05148g2.384ON4683893469e-34
ACR197W7.336ON4841953479e-34
Smik_4.777.336ON5061983489e-34
KAFR0B009107.336ON5121983481e-33
YDR194C (MSS116)8.402ON6644053531e-33
YDL160C (DHH1)7.336ON5061983471e-33
CAGL0I03476g7.336ON5071983462e-33
Smik_4.1522.384ON4463893432e-33
Smik_4.4428.402ON6654073522e-33
Suva_4.867.336ON5081983462e-33
YDL084W (SUB2)2.384ON4463893432e-33
KNAG0H015208.614ON6212443502e-33
KNAG0F026105.241ON7621923523e-33
Skud_4.1712.384ON4463893423e-33
KLTH0G07766g5.241ON7641913523e-33
CAGL0L06908g2.384ON4393893403e-33
KNAG0F020506.204ON5331973454e-33
Skud_4.967.336ON5071983434e-33
KNAG0A058502.384ON4493893404e-33
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B04972g
         (979 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1698   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1226   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1223   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1214   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1211   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1209   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1197   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1197   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1194   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1190   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1189   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1181   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1181   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1177   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1177   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1172   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1170   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1169   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   878   0.0  
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   234   2e-64
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   233   3e-64
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   230   4e-63
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   228   1e-62
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   224   4e-61
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   221   5e-60
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   221   5e-60
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   220   5e-60
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   219   1e-59
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   214   1e-59
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   219   3e-59
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   218   5e-59
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   214   6e-58
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   201   1e-54
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    206   3e-54
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   199   4e-54
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   201   2e-53
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   197   2e-53
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   197   3e-53
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   196   9e-53
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   196   1e-52
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   194   1e-52
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   200   1e-52
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   195   1e-52
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   194   2e-52
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   194   2e-52
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   194   2e-52
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   194   3e-52
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   193   4e-52
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   198   5e-52
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   193   7e-52
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   198   8e-52
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   192   2e-51
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   196   3e-51
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   196   3e-51
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   192   4e-51
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   196   4e-51
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   196   5e-51
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   191   1e-50
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   189   1e-50
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   188   3e-50
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   193   3e-50
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   184   5e-50
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   187   8e-50
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   186   1e-49
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   183   1e-49
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   190   3e-49
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   182   3e-49
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   182   4e-49
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   182   5e-49
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   186   5e-49
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   189   9e-49
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   181   1e-48
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   184   2e-48
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   187   2e-48
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   181   3e-48
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   179   3e-48
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   187   4e-48
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   179   6e-48
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   179   9e-48
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   176   1e-47
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   177   2e-47
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   177   2e-47
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   177   2e-47
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   178   2e-47
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   180   4e-47
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   183   5e-47
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   176   5e-47
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   179   7e-47
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   177   8e-47
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   176   1e-46
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   182   1e-46
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   176   1e-46
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   178   1e-46
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   181   1e-46
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   176   2e-46
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   175   3e-46
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     175   3e-46
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   175   5e-46
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   174   5e-46
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   173   5e-46
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   173   1e-45
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   179   1e-45
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   176   1e-45
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    178   2e-45
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   174   2e-45
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   177   5e-45
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    174   5e-45
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   171   5e-45
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   171   6e-45
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    176   6e-45
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   171   6e-45
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   171   6e-45
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   176   7e-45
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   171   9e-45
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   171   1e-44
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   169   4e-44
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   170   7e-44
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   171   2e-43
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   171   4e-43
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   171   5e-43
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   169   7e-43
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   169   1e-42
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   169   1e-42
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   168   2e-42
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   168   2e-42
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   168   2e-42
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   162   2e-42
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   167   5e-42
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   167   6e-42
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   166   7e-42
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   162   9e-42
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   166   1e-41
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   163   1e-41
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   159   2e-41
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   159   2e-41
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   160   4e-41
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   159   6e-41
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   163   7e-41
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   159   9e-41
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   157   1e-40
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   160   1e-40
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   161   2e-40
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   160   3e-40
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   160   3e-40
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   157   2e-39
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   156   3e-39
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   154   3e-39
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   152   4e-39
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   157   5e-39
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   156   8e-39
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   155   1e-38
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   152   1e-38
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    152   1e-38
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   152   2e-38
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   152   2e-38
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   152   5e-38
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   154   7e-38
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   148   7e-38
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   150   8e-38
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   150   1e-37
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    150   1e-37
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   152   2e-37
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   149   3e-37
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   149   3e-37
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   149   3e-37
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   150   4e-37
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   145   5e-37
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   148   5e-37
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   145   6e-37
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   147   7e-37
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   147   7e-37
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   145   1e-36
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   147   1e-36
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   147   1e-36
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   147   1e-36
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   144   2e-36
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   144   2e-36
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   149   2e-36
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   145   2e-36
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   148   3e-36
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   146   3e-36
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   148   3e-36
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   149   4e-36
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   143   5e-36
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   148   5e-36
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   145   5e-36
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   142   5e-36
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   142   5e-36
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   147   6e-36
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   142   8e-36
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   142   8e-36
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   142   9e-36
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   141   1e-35
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   141   1e-35
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   142   1e-35
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   141   1e-35
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   142   2e-35
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   141   2e-35
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   143   2e-35
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   144   2e-35
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   140   3e-35
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   143   3e-35
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   145   3e-35
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   143   4e-35
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   140   4e-35
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   145   5e-35
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   140   5e-35
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   140   6e-35
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   139   6e-35
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   139   6e-35
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   140   9e-35
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   141   1e-34
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   144   1e-34
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   144   1e-34
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   143   2e-34
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   140   2e-34
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   143   2e-34
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   138   2e-34
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   140   2e-34
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   138   3e-34
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   139   3e-34
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   139   5e-34
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   140   6e-34
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   139   6e-34
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   137   6e-34
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   142   6e-34
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   139   7e-34
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   139   8e-34
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   138   8e-34
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   137   8e-34
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   139   9e-34
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   137   9e-34
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   138   9e-34
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   138   9e-34
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   138   1e-33
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   140   1e-33
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   138   1e-33
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   137   2e-33
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   136   2e-33
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   140   2e-33
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   137   2e-33
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   136   2e-33
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   139   2e-33
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   140   3e-33
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   136   3e-33
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   140   3e-33
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   135   3e-33
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   137   4e-33
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   136   4e-33
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   135   4e-33
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   138   4e-33
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   137   6e-33
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   137   6e-33
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   138   6e-33
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   137   6e-33
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   135   7e-33
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   136   8e-33
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   137   8e-33
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   134   8e-33
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   136   8e-33
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   133   1e-32
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   137   1e-32
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   134   1e-32
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   135   2e-32
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   133   2e-32
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   135   2e-32
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   134   2e-32
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   134   2e-32
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   133   2e-32
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              132   3e-32
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   132   3e-32
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   134   3e-32
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   135   4e-32
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   136   4e-32
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   132   4e-32
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   135   5e-32
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   135   5e-32
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   134   6e-32
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   135   6e-32
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   132   6e-32
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   135   6e-32
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   134   1e-31
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    132   1e-31
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   133   1e-31
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    130   1e-31
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   133   1e-31
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   131   2e-31
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   133   2e-31
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   134   2e-31
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   131   2e-31
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   132   2e-31
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   132   2e-31
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   132   2e-31
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   132   2e-31
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   132   3e-31
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   132   3e-31
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   132   3e-31
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   131   4e-31
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   131   5e-31
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   129   5e-31
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   131   6e-31
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   130   7e-31
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   130   9e-31
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   130   1e-30
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   127   1e-30
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   131   1e-30
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   129   2e-30
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   127   2e-30
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   127   2e-30
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   127   3e-30
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   129   3e-30
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   129   3e-30
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   129   3e-30
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   125   4e-30
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   125   4e-30
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   129   5e-30
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            129   5e-30
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   128   5e-30
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   127   6e-30
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   127   8e-30
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   127   1e-29
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   127   1e-29
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    128   1e-29
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   127   1e-29
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   127   1e-29
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   126   2e-29
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   125   2e-29
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   125   3e-29
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   127   4e-29
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   125   4e-29
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   125   4e-29
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   125   5e-29
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   125   5e-29
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   124   6e-29
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   124   6e-29
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   124   8e-29
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...   124   1e-28
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      124   1e-28
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   123   1e-28
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   123   2e-28
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   123   3e-28
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   123   3e-28
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   123   3e-28
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    122   3e-28
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   122   3e-28
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   122   4e-28
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   122   5e-28
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   120   5e-28
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   123   5e-28
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              121   7e-28
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   118   9e-28
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   120   1e-27
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   120   2e-27
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   117   3e-27
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   117   4e-27
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   119   4e-27
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   119   5e-27
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   119   6e-27
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   119   7e-27
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...   118   1e-26
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   118   1e-26
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   115   1e-26
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   117   2e-26
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   114   2e-26
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   117   2e-26
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   114   3e-26
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   114   3e-26
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   114   3e-26
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   116   4e-26
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   116   4e-26
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   116   4e-26
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   112   8e-26
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   112   2e-25
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   114   2e-25
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...   115   2e-25
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...   115   2e-25
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   114   2e-25
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   114   2e-25
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   114   3e-25
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   110   3e-25
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   110   4e-25
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   110   4e-25
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   112   5e-25
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   110   6e-25
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   112   1e-24
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   111   2e-24
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   111   2e-24
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   110   2e-24
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   111   3e-24
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   108   3e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   110   3e-24
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   111   4e-24
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   110   4e-24
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   109   5e-24
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   108   8e-24
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   108   1e-23
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   108   1e-23
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   108   1e-23
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   108   2e-23
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   103   3e-23
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   108   3e-23
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   107   4e-23
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   107   5e-23
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   107   5e-23
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   107   8e-23
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   105   1e-22
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   103   2e-22
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   105   2e-22
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   105   2e-22
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   104   3e-22
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   104   4e-22
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   103   7e-22
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   103   7e-22
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   101   1e-21
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...   103   1e-21
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   101   1e-21
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...   101   1e-21
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...   100   2e-21
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   101   2e-21
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     101   2e-21
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   100   3e-21
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   101   3e-21
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   101   3e-21
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...   101   4e-21
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    99   6e-21
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...    99   6e-21
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    94   7e-21
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...    99   7e-21
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...    99   1e-20
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...    98   2e-20
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643     97   2e-20
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...    97   3e-20
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...    99   3e-20
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...    97   3e-20
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...    98   3e-20
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643     96   4e-20
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...    96   5e-20
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    98   5e-20
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...    96   6e-20
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...    96   2e-19
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...    96   2e-19
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    94   2e-19
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}             94   2e-19
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    95   3e-19
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...    95   4e-19
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...    95   5e-19
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    94   5e-19
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...    94   7e-19
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...    92   7e-19
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...    93   9e-19
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    93   1e-18
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...    93   2e-18
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    89   2e-17
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    87   6e-17
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    86   2e-16
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    84   5e-16
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    84   6e-16
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    84   6e-16
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    84   7e-16
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    84   8e-16
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    82   2e-15
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    82   4e-15
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    81   8e-15
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    80   1e-14
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    80   2e-14
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     80   2e-14
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    79   2e-14
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    79   3e-14
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    79   3e-14
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    75   7e-14
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    75   9e-14
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    77   1e-13
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    76   3e-13
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    75   3e-13
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    75   5e-13
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    73   2e-12
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    73   2e-12
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    72   3e-12
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    72   3e-12
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    72   5e-12
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    70   2e-11
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    69   2e-11
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    69   3e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    69   3e-11
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    69   4e-11
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    64   7e-11
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    67   1e-10
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    67   2e-10
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    67   2e-10
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    66   2e-10
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    62   3e-10
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    65   6e-10
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    61   1e-08
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    58   7e-08
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    56   4e-07
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    46   5e-04
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    46   6e-04
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    45   0.001
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    45   0.001
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    45   0.001
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    45   0.001
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    45   0.001
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    45   0.001
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    41   0.002
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    44   0.002
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    44   0.002
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    44   0.002
KLLA0B03179g Chr2 (289199..292204) [3006 bp, 1001 aa] {ON} simil...    44   0.003
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    44   0.003
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    44   0.003
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    43   0.003
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    44   0.003
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    42   0.004
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    43   0.004
Skud_10.145 Chr10 complement(273285..276482) [3198 bp, 1065 aa] ...    43   0.004
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    43   0.005
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    43   0.005
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    42   0.006
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    42   0.006
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    42   0.006
YJL050W Chr10 (342522..345743) [3222 bp, 1073 aa] {ON}  MTR4ATP-...    42   0.006
AEL181C Chr5 complement(296782..299997) [3216 bp, 1071 aa] {ON} ...    42   0.006
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    42   0.007
KAFR0A00860 Chr1 (156234..159437) [3204 bp, 1067 aa] {ON} Anc_1....    42   0.008
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    42   0.008
Kpol_1035.20 s1035 complement(45238..48471) [3234 bp, 1077 aa] {...    42   0.009
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    42   0.009
Suva_6.125 Chr6 complement(206404..209610) [3207 bp, 1068 aa] {O...    42   0.009
TDEL0D01990 Chr4 complement(384739..387966) [3228 bp, 1075 aa] {...    42   0.010
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    42   0.011
SAKL0D06622g Chr4 complement(544709..547954) [3246 bp, 1081 aa] ...    42   0.011
NCAS0A09110 Chr1 complement(1801017..1804211) [3195 bp, 1064 aa]...    42   0.012
CAGL0J04928g Chr10 complement(468765..471962) [3198 bp, 1065 aa]...    42   0.012
Smik_10.191 Chr10 (333972..337175) [3204 bp, 1067 aa] {ON} YJL05...    41   0.014
TBLA0F01280 Chr6 complement(316339..319554) [3216 bp, 1071 aa] {...    41   0.015
KLTH0H10406g Chr8 complement(894542..897769) [3228 bp, 1075 aa] ...    41   0.015
TPHA0O01420 Chr15 complement(281318..284545) [3228 bp, 1075 aa] ...    41   0.016
Kwal_14.2508 s14 complement(790049..793354) [3306 bp, 1101 aa] {...    41   0.016
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    41   0.017
Ecym_6303 Chr6 (570968..574195) [3228 bp, 1075 aa] {ON} similar ...    41   0.018
NDAI0G05850 Chr7 (1450221..1453484) [3264 bp, 1087 aa] {ON} Anc_...    41   0.019
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    41   0.019
ZYRO0B09306g Chr2 (730191..733388) [3198 bp, 1065 aa] {ON} highl...    41   0.020
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    41   0.022
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    40   0.022
KLLA0F01364g Chr6 complement(126312..129533) [3222 bp, 1073 aa] ...    41   0.022
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    40   0.023
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    40   0.030
KNAG0E02660 Chr5 (526419..529583) [3165 bp, 1054 aa] {ON} Anc_1....    40   0.032
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    40   0.032
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    40   0.034
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    40   0.035
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    40   0.041
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    40   0.042
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    40   0.042
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    40   0.042
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    39   0.047
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    39   0.054
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    39   0.055
TPHA0H01970 Chr8 complement(462534..466601) [4068 bp, 1355 aa] {...    39   0.060
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    39   0.073
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    39   0.074
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    39   0.074
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     39   0.081
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    38   0.086
NDAI0I00750 Chr9 (164874..169178) [4305 bp, 1434 aa] {ON} Anc_6....    39   0.094
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    39   0.11 
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    39   0.12 
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    38   0.12 
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    38   0.13 
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    38   0.14 
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    38   0.14 
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    38   0.15 
NCAS0D04180 Chr4 complement(788827..792861) [4035 bp, 1344 aa] {...    38   0.18 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    38   0.18 
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    37   0.22 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    37   0.24 
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    37   0.25 
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    37   0.27 
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    37   0.28 
KLTH0G14278g Chr7 (1236981..1243502) [6522 bp, 2173 aa] {ON} sim...    37   0.28 
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    37   0.32 
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    37   0.34 
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    37   0.40 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    36   0.49 
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    36   0.54 
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    36   0.63 
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    36   0.68 
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    36   0.73 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    35   0.86 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    35   1.2  
YGL251C Chr7 complement(27921..31426,31579..31636) [3564 bp, 118...    35   1.2  
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   1.3  
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    35   1.3  
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    35   1.3  
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    35   1.5  
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    35   1.5  
Skud_14.220 Chr14 (406111..406449) [339 bp, 112 aa] {ON} YNL112W...    32   1.7  
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    34   1.7  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    34   1.8  
Kwal_26.8466 s26 complement(797363..797710) [348 bp, 115 aa] {OF...    32   2.2  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    34   2.4  
Suva_7.10 Chr7 complement(22345..22614,22645..25886,26044..26101...    33   4.5  
Smik_7.10 Chr7 complement(22625..26133,26293..26350) [3567 bp, 1...    33   4.8  
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    33   5.2  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    33   5.5  
KLLA0D11462g Chr4 (982040..985303) [3264 bp, 1087 aa] {ON} simil...    33   5.8  
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    33   6.4  
Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] ...    33   6.4  
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    32   6.9  

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1698 bits (4398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 845/979 (86%), Positives = 845/979 (86%)

Query: 1   MGSTLKRKLXXXXXXXXXXXXFDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSXXXX 60
           MGSTLKRKL            FDIAGNIALT                NYQDVIDYS    
Sbjct: 1   MGSTLKRKLEDEESNSEGEEGFDIAGNIALTSSESEGEDGSDEDSEENYQDVIDYSDDDK 60

Query: 61  XXXXXXXXXXXXXXXXXXXFPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXX 120
                              FPILELS                   ISEYFTTNNSE    
Sbjct: 61  EKEAGKKKKEPVKKSDKHDFPILELSDNEEDADAKKKKEDGDADDISEYFTTNNSESKKH 120

Query: 121 XXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLP 180
                        ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLP
Sbjct: 121 KKGSFPSFGFSKFILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLP 180

Query: 181 MIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
           MIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM
Sbjct: 181 MIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQ 300
           MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQ
Sbjct: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQ 300

Query: 301 TLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE 360
           TLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE
Sbjct: 301 TLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE 360

Query: 361 VIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSE 420
           VIKIPLATEEQKMILGEGNKALSDSEDSDAENG                 LPSANELPSE
Sbjct: 361 VIKIPLATEEQKMILGEGNKALSDSEDSDAENGKKDRRKKGKKNKAKRPKLPSANELPSE 420

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA
Sbjct: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS              G
Sbjct: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLG 540

Query: 541 KKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKN 600
           KKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKN
Sbjct: 541 KKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKN 600

Query: 601 LMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEK 660
           LMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEK
Sbjct: 601 LMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEK 660

Query: 661 NKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGL 720
           NKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGL
Sbjct: 661 NKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGL 720

Query: 721 THSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMS 780
           THSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEG           DSNFFMS
Sbjct: 721 THSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGKKQKQKSKSFKDSNFFMS 780

Query: 781 HYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGA 840
           HYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWD     YVNPQGA
Sbjct: 781 HYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNPQGA 840

Query: 841 DNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSN 900
           DNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSN
Sbjct: 841 DNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSN 900

Query: 901 NRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRK 960
           NRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRK
Sbjct: 901 NRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRK 960

Query: 961 QRVVKDKRRAKNARVGKKR 979
           QRVVKDKRRAKNARVGKKR
Sbjct: 961 QRVVKDKRRAKNARVGKKR 979

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1226 bits (3172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/904 (65%), Positives = 713/904 (78%), Gaps = 9/904 (0%)

Query: 80  FPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNIN 139
           FP+LE+S                   ++EYF+TNN E                 +LNNI 
Sbjct: 95  FPMLEMSDDENNASGKTQTGDDEDD-VNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIK 153

Query: 140 KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199
           +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARAVIL
Sbjct: 154 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 213

Query: 200 SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259
           SPSRE+AMQT+ VFK+F++G++LRSVLLTGGDSLE+QFGMMM+NPDV++ATPGRFLHLKV
Sbjct: 214 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKV 273

Query: 260 EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319
           EMNL+LKSVEY VFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLPN+LVDF KAG
Sbjct: 274 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 333

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGN 379
           L NPVLVRLDAE+K+SENLEMLF+S+K+ +REANL Y+LQE+IKIPLAT EQ   L   N
Sbjct: 334 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSN 393

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
              +DS DSD EN                  +P+ANELPSEKATI+FVPTRHHVEYISQL
Sbjct: 394 NE-ADS-DSDDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQL 451

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           L+ CGYL+SYIYGTLDQHAR+RQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN+T+P 
Sbjct: 452 LRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 511

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEK 559
           SSKIFVHRVGRTARAGN+GWAYSIV+              GKKILL PMY++  +++K++
Sbjct: 512 SSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKR 571

Query: 560 WVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAE 619
           W++EG  E++FQPPK+SYT R+VLGSCPR+++E +GDLYKNLM SN+DL   +  ++KAE
Sbjct: 572 WIDEGKPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAE 631

Query: 620 IMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEF 679
            +Y RTR  AS ES+KR+K++I SGWD QN  FGKN E EK  FLAKLQ+RRNKETVFEF
Sbjct: 632 KLYYRTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEF 691

Query: 680 ARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYS 739
            RNPDD+M+V MK+RR+QL P+Q +A +R+EL+EKE++AGL+HS+EDE+L    GE GY+
Sbjct: 692 TRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYT 751

Query: 740 VPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGF 799
           V +  L+EFEDADQ+LE QE E            D  FF+SHYAPA  +QD QL I++GF
Sbjct: 752 VSEDALKEFEDADQLLEAQENEN-KKKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGF 810

Query: 800 TTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYR 859
             DAAQA+YDLN DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+R
Sbjct: 811 ANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFR 870

Query: 860 SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVP 915
           SG+FD+WSK R LK  KVGSRE+S+ +NLL+DP++G P++N R    +F HKQ+KAPK+P
Sbjct: 871 SGRFDDWSKARNLKPLKVGSRETSIPSNLLEDPSQG-PAANGRTVRGKFKHKQMKAPKMP 929

Query: 916 DKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARV 975
           DK+RD+Y  QK KV KAL+ GI VKG+NNAPG+ +EL+S +QIRK R++ +K+RAKNAR 
Sbjct: 930 DKHRDNYYSQKKKVEKALQSGISVKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARP 989

Query: 976 GKKR 979
            KKR
Sbjct: 990 SKKR 993

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
           (REAL)
          Length = 1001

 Score = 1223 bits (3165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/904 (66%), Positives = 709/904 (78%), Gaps = 9/904 (0%)

Query: 80  FPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNIN 139
           FP LELS                   ++EYF+T N E                 +LNNI 
Sbjct: 101 FPTLELSDDENDASGKTQADDDEDD-VNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIK 159

Query: 140 KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199
           +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARAVIL
Sbjct: 160 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 219

Query: 200 SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259
           SPSRE+AMQT+ VFK+F+KG++LRSVLLTGGDSLE+QF MMMSNPDV++ATPGRFLHLKV
Sbjct: 220 SPSRELAMQTFNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 279

Query: 260 EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319
           EMNL+LKSVEY VFDEADRLFEMGF EQLNELLASLP +RQTLLFSATLPN+LVDF KAG
Sbjct: 280 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAG 339

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGN 379
           L NPVLVRLD E+K+SENLEMLF+S+K+ +REANL Y+LQEVIKIPLAT EQ   L + N
Sbjct: 340 LVNPVLVRLDTETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSN 399

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
              +DS DSD EN                  +P+ANELPSE+ATI+FVPTRHHVEYISQL
Sbjct: 400 NE-ADS-DSDDENDRHKKKRNFKKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQL 457

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           L+ CGYL+SYIYGTLDQHAR+RQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN+T+P 
Sbjct: 458 LRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 517

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEK 559
           SSKIFVHRVGRTARAGN+GWAYSIVS              GKKILLAPMY+   + +K++
Sbjct: 518 SSKIFVHRVGRTARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKR 577

Query: 560 WVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAE 619
           W++EGN EF+FQPPK+SYT R+VLGSCPR+++E +GDLYKNLM SN+DL      S+KAE
Sbjct: 578 WIDEGNLEFQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAE 637

Query: 620 IMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEF 679
            +Y RTR  AS ES+KR+K++I SGWD QN  FGKN E EK  FLAKLQ+RRNKETVFEF
Sbjct: 638 KLYYRTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEF 697

Query: 680 ARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYS 739
            RNPDD+M+VLMK+RR+QL P+Q +A +R++L+EKE++AGL+HS+E+E+L    GE GY+
Sbjct: 698 TRNPDDEMAVLMKRRRKQLAPIQRKASERRKLLEKERMAGLSHSIENEILKGDDGETGYT 757

Query: 740 VPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGF 799
           V +  L+EFEDADQ+LE QE +            D  FF+SHYAPA  +QD QL I+SGF
Sbjct: 758 VSEEALKEFEDADQLLEAQENDS-KKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGF 816

Query: 800 TTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYR 859
             DAA A+YDLN DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+R
Sbjct: 817 ANDAAHAAYDLNTDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFR 876

Query: 860 SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVP 915
           SG+FD+WSK R LK  K GSRESS+ +NLL DP++G P SN R    +F HKQ+KAPK+P
Sbjct: 877 SGRFDDWSKARNLKPLKAGSRESSIPSNLLADPSQG-PGSNGRTARGKFKHKQMKAPKMP 935

Query: 916 DKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARV 975
           DK+RD+Y  QK KV KAL+ G++VKGHNNAPG+++EL+S +QIRK RV+ +K+RAKNAR 
Sbjct: 936 DKHRDNYYSQKKKVEKALQSGVNVKGHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARP 995

Query: 976 GKKR 979
            KKR
Sbjct: 996 SKKR 999

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/905 (65%), Positives = 707/905 (78%), Gaps = 11/905 (1%)

Query: 80  FPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNIN 139
           FPILELS                   ++EYF+TNN E                 +LNNI 
Sbjct: 98  FPILELSDDENNISGQTQAGEEEDD-VNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIK 156

Query: 140 KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199
           +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARAVIL
Sbjct: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216

Query: 200 SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259
           SPSRE+AMQT+ VFK+F++G++LRSVLLTGGDSLE+QF MMMSNPDV++ATPGRFLHLKV
Sbjct: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276

Query: 260 EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319
           EMNL+LKSVEY VFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLPN+LVDF KAG
Sbjct: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEG- 378
           L NPVLVRLDAE+K+SENLEMLF+S+K+ +REANL Y+LQEVI+IPLAT EQ + L +  
Sbjct: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKST 396

Query: 379 NKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQ 438
           N+A SDS+D   EN                  +P+ANELPSEKATI+FVPTRHHVEYISQ
Sbjct: 397 NEADSDSDD---ENDRQKKKINFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQ 453

Query: 439 LLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMP 498
           LL+ CGYL+SYIYGTLDQHAR+ QLYNFRAGLTSILVVTDVAARGVDIPMLANVIN+T+P
Sbjct: 454 LLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLP 513

Query: 499 SSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKE 558
            SSKIFVHRVGRTARAGN+GWAYSIV+              GKKILL PMY++  +++K+
Sbjct: 514 GSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKK 573

Query: 559 KWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKA 618
           +WV EGN  + FQ PK+SYT R+VLGSCPR+++E +GDLYKNLM SN+DL   +  ++KA
Sbjct: 574 RWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKA 633

Query: 619 EIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFE 678
           E +Y RTR  AS ES+KR+K++I SGWD QN  FGKN E EK  FLAKLQ+RRNKETVFE
Sbjct: 634 EKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFE 693

Query: 679 FARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGY 738
           F RNPDD+M+V MK+RR+QL P+Q +A +R+EL+EKE++AGL+HS+EDE+L    GE GY
Sbjct: 694 FTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGY 753

Query: 739 SVPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSG 798
           +V +  L+ FEDADQ+LE QE E            D  FF+SHYAPA  +QD QL I++G
Sbjct: 754 TVSEDALKNFEDADQLLEAQENES-KKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQITNG 812

Query: 799 FTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASY 858
           F  DAAQA+YDLN DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+
Sbjct: 813 FANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASF 872

Query: 859 RSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKV 914
           RSG+FD+WSK R LK  KVGSRESS+ +NLLQDP++G   SN R    +F HKQ+KAPK+
Sbjct: 873 RSGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKAPKM 931

Query: 915 PDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNAR 974
           PDK+RD+Y  QK KV KAL+ GI VKG+NNAPG+ NEL+S +QIRK R + +K+RAKNAR
Sbjct: 932 PDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNAR 991

Query: 975 VGKKR 979
             KKR
Sbjct: 992 PSKKR 996

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1211 bits (3134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/903 (65%), Positives = 701/903 (77%), Gaps = 7/903 (0%)

Query: 80   FPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNIN 139
            FP LELS                   ++EYF+T N E                 +LNNI 
Sbjct: 107  FPTLELSDDENSVPGKNQADDDEDD-VNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIK 165

Query: 140  KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199
            +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARAVIL
Sbjct: 166  RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 225

Query: 200  SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259
            SPSRE+AMQT+ VFKEF++G+ LRSVLLTGGDSLE+QF MMMSNPDV++ATPGRFLHLKV
Sbjct: 226  SPSRELAMQTFNVFKEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 285

Query: 260  EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319
            EMNL+LKSVEY VFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLPN+LVDF KAG
Sbjct: 286  EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKAG 345

Query: 320  LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGN 379
            L NPVLVRLD E+K+SENLEMLFVSTK+D+REANL Y+LQEVIKIPLAT EQ   L + N
Sbjct: 346  LVNPVLVRLDTETKVSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKSN 405

Query: 380  KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
               +DSE SD +N                  +P  NELPSEKATI+FVPTRHHVEYISQL
Sbjct: 406  NE-ADSE-SDDDNDRQKKRKNFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQL 463

Query: 440  LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
            L+ CG+L+SYIYGTLDQHAR+RQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN+T+P 
Sbjct: 464  LRDCGFLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 523

Query: 500  SSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEK 559
            SSKIFVHRVGRTARAGN+GWAYSIV+              GKKILLAPMY++   L+K++
Sbjct: 524  SSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKR 583

Query: 560  WVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAE 619
            WV+EG  E+ FQPP +SYT R+VLGSCPR+++E +GDLYKNLM SN+DL   +  ++KAE
Sbjct: 584  WVDEGKPEYTFQPPTLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAE 643

Query: 620  IMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEF 679
             +Y RTR  AS ES+KR+K++I SGWD QN  FGKN E EK  FLAKLQ+RRNKETVFEF
Sbjct: 644  QLYYRTRTAASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEF 703

Query: 680  ARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYS 739
             RNPDD+MSVLMK+RR+QL P+Q ++++R+EL+EKE++AGL+HS+EDE+L    GE GY+
Sbjct: 704  TRNPDDEMSVLMKRRRKQLAPIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGETGYT 763

Query: 740  VPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGF 799
            + +  L+EFEDADQ+LE QE +            D +FF+SHYAPA  +QD QL I+ GF
Sbjct: 764  ISEDALKEFEDADQLLEAQENDS-KKKKKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGF 822

Query: 800  TTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYR 859
              DAA A+YDLN DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+R
Sbjct: 823  ANDAAHAAYDLNGDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFR 882

Query: 860  SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR---RFMHKQVKAPKVPD 916
            SG+FD+WSK R LK  KVGSRESS+ +NLL DP++G  +       +F HKQ+KAPK+PD
Sbjct: 883  SGRFDDWSKARNLKPLKVGSRESSIPSNLLADPSQGPGARGGAVRGKFKHKQMKAPKMPD 942

Query: 917  KYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVG 976
            K+RD+Y  QK KV KAL+ G++V+G+NNAPG+ +EL+S DQIRK R   DK+RAKNAR  
Sbjct: 943  KHRDNYYTQKKKVEKALQSGVNVRGYNNAPGLRSELKSTDQIRKDRAAADKKRAKNARPT 1002

Query: 977  KKR 979
            KKR
Sbjct: 1003 KKR 1005

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1209 bits (3129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/969 (62%), Positives = 722/969 (74%), Gaps = 15/969 (1%)

Query: 22  FDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSXXXXXXXXXXXXXXXXXXXXX--XX 79
           FDIA +IAL                 + QDVIDYS                         
Sbjct: 25  FDIATDIALNASDSDDASSDSDNE--DVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKS 82

Query: 80  FPILELSXXXXXXXXXXXXXXXXXXXISE----YFTTNNSEXXXXXXXXXXXXXXXXXIL 135
           FPILELS                     +    YF+T N E                 I+
Sbjct: 83  FPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNLEKSKHKKGSFPSFGLSKIIV 142

Query: 136 NNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGAR 195
            NI K+GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF+LPMI K+K HSSKIGAR
Sbjct: 143 TNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGAR 202

Query: 196 AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL 255
           AVILSPSRE+AMQT+ VFKEFSKG+ LRSVLLTGGDSLEDQFGMMM+NPDV++ATPGRFL
Sbjct: 203 AVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL 262

Query: 256 HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDF 315
           HLKVEM+L+LKS+EYAVFDEADRLFEMGF +QLNELLASLP  RQTLLFSATLP++LVDF
Sbjct: 263 HLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVDF 322

Query: 316 AKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMIL 375
           AKAGLTNPVLVRLDAESKISENLEMLF+STK+DEREANL YLLQ+VIKIPLAT+EQ+   
Sbjct: 323 AKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRKF 382

Query: 376 GEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEY 435
            + NK  ++S DSDA++                  LP AN+LPSEKATI+FVPTRHHVEY
Sbjct: 383 NDQNKKDNES-DSDADD-NNNNNKNKKKRKFKKERLPPANQLPSEKATILFVPTRHHVEY 440

Query: 436 ISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINF 495
           ISQLLK  GYL+SYIYGTLDQHAR+RQLYNFR GLTSILVVTDVAARGVDIPMLANVINF
Sbjct: 441 ISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 500

Query: 496 TMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNL 555
           ++P+SSKIF+HRVGRTARAGNRGWAYSIVS              GKKI+L PMY++ C +
Sbjct: 501 SLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMYDSLCEI 560

Query: 556 LKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVS 615
           +K KW+ EGNDE  F  PK++YTDR++LGS PR+E+E +GDLYKN+M +N++L   + V+
Sbjct: 561 MKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVA 620

Query: 616 IKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKET 675
           +KAE +Y RTR  AS ES+KR+K++I SGWDEQN+LFGKN E EK  FLAKLQ+RRNKET
Sbjct: 621 MKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKET 680

Query: 676 VFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGE 735
           VFEF+RNPDD+MSV MK+RR+QL P+Q +A++R+EL++ EK+AGLTHS+EDE+L     E
Sbjct: 681 VFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNE 740

Query: 736 VGYSVP-DAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLN 794
            GYSV  D + ++F+DAD++L DQE +            D NFF+SHYAPA  +QD QL 
Sbjct: 741 AGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKDPNFFLSHYAPAGDIQDKQLE 800

Query: 795 ISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKI 854
           +++GF  DAA+ +YDLN+DDK+QVHKQTA VKWD     YVN QG DN +YI  E GQKI
Sbjct: 801 LTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKI 860

Query: 855 PASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVK 910
            AS+RSGKFDEW+KKRK+K  KVG+RE+++ +N+L +PT G+  S       +F HKQ+K
Sbjct: 861 AASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMK 920

Query: 911 APKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRA 970
           APK+PDK+RDDY  QK KV KAL  GI V+G+ NAPGM+NEL+S +QI K R VK+ +RA
Sbjct: 921 APKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRA 980

Query: 971 KNARVGKKR 979
           KNAR  K+R
Sbjct: 981 KNARPSKRR 989

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/960 (61%), Positives = 714/960 (74%), Gaps = 10/960 (1%)

Query: 22  FDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSXXXXXXXXXXXXXXXXXXXXXXXFP 81
           FDI  NI L                   QD++D+S                       FP
Sbjct: 24  FDITSNIGLNTADSSDESESSGDDEEEVQDIVDFSDEEDTKKKPKSSNKTLTDNNS--FP 81

Query: 82  ILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNINKK 141
            LE+S                    ++YF+ NNSE                 IL+N++KK
Sbjct: 82  SLEISDDEDSNNKGDHEDDDDDL--NDYFSINNSEKSKHKKGSFPSFGFSKLILSNVHKK 139

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLPMIEKLK+HSSKIGARAVILSP
Sbjct: 140 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIGARAVILSP 199

Query: 202 SREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEM 261
           SRE+A+QT++VFKEFSKG+ LRSVLLTGGDSLEDQF MMMSNPDV+VATPGRFLHLKVEM
Sbjct: 200 SRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGRFLHLKVEM 259

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLT 321
           +L+LK+VEY VFDEADRLFEMGF EQLNELLA+LP  RQTLLFSATLP++LVDFAKAGLT
Sbjct: 260 SLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLVDFAKAGLT 319

Query: 322 NPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKA 381
           NPVLVRLDAE+KISENLE+LF+STK++ERE NL YLLQ+VIKIPL T++Q   L + NK+
Sbjct: 320 NPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIKKLSDFNKS 379

Query: 382 LSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQLLK 441
           LSDS+  D +N                  + ++NELP+EK+TIVF PTRHHVEYI+QLLK
Sbjct: 380 LSDSDSEDEDNKGKQNSRKSKKGKFQKLKVSASNELPTEKSTIVFAPTRHHVEYITQLLK 439

Query: 442 ACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSS 501
             G+LVSY+YGTLDQHAR+RQL NFRAGLTSILVVTDVAARGVDIPMLANVIN+++P+SS
Sbjct: 440 DSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASS 499

Query: 502 KIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKWV 561
           KIF+HRVGRTARAGNRGWAYSIVS              GKKILL  MYEA+C L+K KW+
Sbjct: 500 KIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMYEASCKLMKSKWI 559

Query: 562 NEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIM 621
            +GN E  F+ PK+SYT+R+VLGS PR ++ES+GDLYKN+++SN+DL   + VS+KAE +
Sbjct: 560 ADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQMAKKVSLKAEKL 619

Query: 622 YMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFAR 681
           Y RTR  AS ES+KR+K++I SGWDEQNI FG+N+E EK  FLAK Q+RRNKETVFEF +
Sbjct: 620 YCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQNRRNKETVFEFGK 679

Query: 682 NPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVP 741
           NP+D  ++LM+KRR+Q+ P+Q +A++RQEL++KE++AGLTH +EDE+L     E GYSVP
Sbjct: 680 NPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKIEDEILKGEDHEAGYSVP 739

Query: 742 DAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGFTT 801
           +  L+ FEDAD++LE+QE+             D NFF+SHYAPA  +QD QL I+SGFT 
Sbjct: 740 EEALKSFEDADKILEEQES---SRKKKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFTN 796

Query: 802 DAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYRSG 861
           DAAQA+YDLNDDDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKIPAS++SG
Sbjct: 797 DAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKSG 856

Query: 862 KFDEWSKKRKLKMPKVGSRESSMATNLLQDPT--RGNPSSNNRRFMHKQVKAPKVPDKYR 919
           KF EWSK R +K  K G+RE+S+ TNLL DPT   G+      RF HKQ KAP++PDK+R
Sbjct: 857 KFAEWSKSRNIKGIKTGARETSIPTNLLSDPTTDSGSQRGPGGRFKHKQNKAPRLPDKFR 916

Query: 920 DDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979
           DDY  QK KV  A+E+G+ VKG   + G T EL++  QIRK+R+ K+K+R KNAR  KKR
Sbjct: 917 DDYQSQKKKVQSAIERGVSVKGFGGSSGNT-ELKTTAQIRKERMAKEKKRQKNARPTKKR 975

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1197 bits (3097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/962 (62%), Positives = 708/962 (73%), Gaps = 18/962 (1%)

Query: 22  FDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSXXXXXXXXXXXXXXXXXXXXXXXFP 81
           FDIA NIAL                   +D+I YS                       FP
Sbjct: 24  FDIASNIALNSSDSDSDSDVDEQDG-EVEDIISYSDDEKSQVEEVPKKSKKEKKVIKDFP 82

Query: 82  ILELSXXXXXXXXXXXXXXXXXXXISEYFTTNN-SEXXXXXXXXXXXXXXXXXILNNINK 140
           +LELS                   ++ YF+TNN +                  IL NI+K
Sbjct: 83  LLELSDDEDSKKQANDNDDD----VNSYFSTNNLNTKTKHKKGSFASFGLSKLILTNISK 138

Query: 141 KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILS 200
           +GFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAFVLPMIEKLK HSSKIGARA+ILS
Sbjct: 139 RGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIILS 198

Query: 201 PSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVE 260
           PSRE+AMQT+ VFKEFSKGSDLRSVLLTGGDSLEDQFGM+M+NPDV++ATPGRFLHLKVE
Sbjct: 199 PSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVIIATPGRFLHLKVE 258

Query: 261 MNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGL 320
           MNL+LKSVEY  FDEADRLFEMGF EQLNEL+ SLP  RQTLLFSATLP++LVDFAKAGL
Sbjct: 259 MNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSATLPSSLVDFAKAGL 318

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNK 380
           TNPVLVRLD E+KISENLEMLF+S K++EREANL YLLQE I IPLATEEQ   L   +K
Sbjct: 319 TNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLATEEQIKKLNNESK 378

Query: 381 ALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQLL 440
              DS+  D E                   LP AN+LPSEKATI+FVPTRHHVEYISQLL
Sbjct: 379 IDDDSDSEDDE---ATRRQKRKSKNFKKQRLPPANQLPSEKATIIFVPTRHHVEYISQLL 435

Query: 441 KACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSS 500
           K CGYLVSYIYGTLDQ AR RQLYNFR GLTSILVVTDVAARGVDIPMLANVINF++P S
Sbjct: 436 KDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPMLANVINFSLPVS 495

Query: 501 SKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKW 560
           SK+FVHRVGRTARAGNRGWAYSIVS              GKKILL  MY+ATC+++K+KW
Sbjct: 496 SKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMYDATCDIMKKKW 555

Query: 561 VNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEI 620
           V+EG  E  FQ PK SYT+RMVLGS PR+++E + DLY  ++  ++DL   +  ++KAE 
Sbjct: 556 VSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLKMMKQTALKAEK 615

Query: 621 MYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFA 680
           +Y RTR  AS ESMKR+K++I+SGWDEQNI FGKN+E EK +FLAKLQ+R NKETVFEFA
Sbjct: 616 LYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQNRHNKETVFEFA 675

Query: 681 RNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSV 740
           RNPDD+MSVLMK+RR+QL P+Q +A++R+ELMEKE+LAGLTH +ED++L     E GY+V
Sbjct: 676 RNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRIEDQILKGDDFEAGYTV 735

Query: 741 PDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGFT 800
           P+  L+EFEDAD+VL     E            D NFF+SHYAP  ++QD Q  +S+GFT
Sbjct: 736 PEDALKEFEDADKVL-----EASNKKSEQKTFRDENFFLSHYAPTSAIQDQQYKLSTGFT 790

Query: 801 TDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYRS 860
             AA+A+YDLN DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+RS
Sbjct: 791 NAAAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIVGESGQKIAASFRS 850

Query: 861 GKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR---RFMHKQVKAPKVPDK 917
           GKF+EWSK RKLK  KVG+RES+M TNLL +PT  N +       +F HKQ+K+PK+PDK
Sbjct: 851 GKFEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSNGQKTVRGKFKHKQMKSPKLPDK 910

Query: 918 YRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGK 977
           +RDDY KQK KVA AL +G HVKG+ + PGM NEL+S +QIRK+R+ K+ RRAKNAR  K
Sbjct: 911 FRDDYEKQKKKVASALARGAHVKGY-SGPGMKNELKSTEQIRKERMAKENRRAKNARPSK 969

Query: 978 KR 979
           KR
Sbjct: 970 KR 971

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1194 bits (3088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/875 (66%), Positives = 676/875 (77%), Gaps = 12/875 (1%)

Query: 109 YFTTNNSEXXXXXXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMAR 168
           YF+ N                    IL NI+K+GFRQPTPIQRKTIPLILQNRDIVGMAR
Sbjct: 101 YFSVNTDAKSKHKKGSFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMAR 160

Query: 169 TGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLT 228
           TGSGKTAAFVLPMIEKLK HSSKIGARA+ILSPSRE+AMQT+ VFKEFS+G+ LRSVLLT
Sbjct: 161 TGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLT 220

Query: 229 GGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQL 288
           GGDSLEDQFGMMM+NPDV++ATPGRFLHLKVEMNL+LKSVEYAVFDEADRLFEMGF EQL
Sbjct: 221 GGDSLEDQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQL 280

Query: 289 NELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHD 348
           NELLA+LP  RQTLLFSATLP +LVDFAKAGL NPVLVRLDAESKIS+NLEMLF+STK+D
Sbjct: 281 NELLAALPSSRQTLLFSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKND 340

Query: 349 EREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXX 408
           EREANL Y+LQEVIK+PLAT EQ   L + NKA    +DSD                   
Sbjct: 341 EREANLLYILQEVIKLPLATPEQIKQLND-NKA----DDSDESAEEDEDKKRRKRKSFNR 395

Query: 409 XXLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRA 468
             +P ANELPSEKAT+VFVPTRHHVEY+S LLK CGYLVSYIYG LDQHAR+ QLYNFR 
Sbjct: 396 KAMPKANELPSEKATVVFVPTRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRI 455

Query: 469 GLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXX 528
           GLTSILVVTDVAARGVDIPMLANV+N+++P+SSKIF+HRVGRTARAGNRGWAYSIVS   
Sbjct: 456 GLTSILVVTDVAARGVDIPMLANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENE 515

Query: 529 XXXXXXXXXXXGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPR 588
                      G+KILL PMYEA   L KEKWV EGNDE  FQ PK+SYT RMVLGSCPR
Sbjct: 516 LPYLLDLELFLGRKILLTPMYEALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPR 575

Query: 589 IELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQ 648
           +++E++ +LY NLM SN+DL   +  ++KAE +Y RTR  AS ES+KR+K++I SGWDEQ
Sbjct: 576 LDIEALSELYNNLMKSNFDLDMAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQ 635

Query: 649 NILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQR 708
           N+LFGKN+E EKN FL KLQ+RRNKETVFEF RNP+D+M+ LM +RR+ + P+Q +AK+R
Sbjct: 636 NVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKER 695

Query: 709 QELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGXXXXXX 768
           +EL+EKE++AGLTH+LEDE+L     EVGY+V +  L+ FEDAD +L +QE         
Sbjct: 696 KELLEKERMAGLTHALEDEILKGDDAEVGYTVTEDTLKAFEDADTILAEQEN---ASKKK 752

Query: 769 XXXXXDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWD 828
                D NFF+SHYAPA  +QD QL +S GF  +AAQ++YDLN DDK+QVHKQTATVKWD
Sbjct: 753 KKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQTATVKWD 812

Query: 829 XXXXXYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNL 888
                YVN  G DN +YI  ESGQKI AS+RSGKFDEWSK RKL   K G+ ESS+ +NL
Sbjct: 813 KKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKLAPLKTGANESSIPSNL 872

Query: 889 LQDPTRGNPSSN----NRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNN 944
           L DPTRG   S     N +F HK  KAP++PDK RDDY KQK KV  ALE+GI VKG+NN
Sbjct: 873 LVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIAVKGYNN 932

Query: 945 APGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979
           AP   +EL+S  QIRK R  K+ R AKNAR  KKR
Sbjct: 933 APAFKSELKSVAQIRKDRKTKENRHAKNARPSKKR 967

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1190 bits (3078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/962 (62%), Positives = 717/962 (74%), Gaps = 19/962 (1%)

Query: 22  FDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSX-XXXXXXXXXXXXXXXXXXXXXXF 80
           FDIAG+IAL                   QDVI+YS                        F
Sbjct: 29  FDIAGDIALNSSESDASESDDDEED--VQDVIEYSDDETETKKKNDKKKNNNKTKEDKSF 86

Query: 81  PILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNINK 140
           P LELS                   ++ YF+T N +                 I++NI +
Sbjct: 87  PSLELSDDEADRRNNEDEDDD----VNAYFSTTNLDKSKHKKGSFPSFGLSKFIISNITR 142

Query: 141 KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILS 200
           KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF+LPMIEKLK HS KIGARAVILS
Sbjct: 143 KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILS 202

Query: 201 PSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVE 260
           PSRE+AMQT+ VFK+FSKG+ LRSVLLTGGDSLEDQFGMMM+NPDV++ATPGRFLHLKVE
Sbjct: 203 PSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVE 262

Query: 261 MNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGL 320
           MNL+LKS+EYAVFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLP++LVDFAKAGL
Sbjct: 263 MNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGL 322

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNK 380
           TNPVLVRLDAE+KISENLEMLF+STK+DEREANL YLLQEVIKIPLA+ +Q   L + N 
Sbjct: 323 TNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQ---LAKFNA 379

Query: 381 ALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQLL 440
                  SD+++                  LP AN+LPSEK+TI+FVPTRHHVEYIS LL
Sbjct: 380 QNIKDNASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEKSTILFVPTRHHVEYISNLL 439

Query: 441 KACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSS 500
           +  GYL+SYIYGTLDQHAR+RQLYNFR GLTSILVVTDVAARGVDIPMLANVINF++P+S
Sbjct: 440 RESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPAS 499

Query: 501 SKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKW 560
           SKIFVHRVGRTARAGNRGWAYSIVS              GKKIL+ PMY++  +++ +KW
Sbjct: 500 SKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKW 559

Query: 561 VNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEI 620
           + EG+DE  F+PPKVSYT+RM+LGS PR+ELE +GDLY+N+M SN+++   +GV++KAE 
Sbjct: 560 IAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEK 619

Query: 621 MYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFA 680
           +Y RTR  AS ES+KR+K++I SGWDEQNI+FGKN E EK  FLAKLQ+RRNKETVFEFA
Sbjct: 620 LYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFA 679

Query: 681 RNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGE-VGYS 739
            NPDD+MSV MK+RR+QL P+Q +AK+R EL++KEKLAGLTH++EDEVL     E   Y+
Sbjct: 680 SNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYT 739

Query: 740 VPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGF 799
           + +  L++FED D++L  QE +            D  FF+SHYAPA  +QD QL +++GF
Sbjct: 740 ISEDTLKQFEDGDELLAGQENK-----KKKKTFKDPTFFLSHYAPASDIQDKQLQVANGF 794

Query: 800 TTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYR 859
             +AAQA+YDLN+DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQKI AS+R
Sbjct: 795 ANEAAQAAYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFR 854

Query: 860 SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRR--FMHKQVKAPKVPDK 917
           SGKFDEW+K RKLK  KVG+RESS+ +NLL DPT+G  + N+ R  F HKQ+KAPK+PDK
Sbjct: 855 SGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDK 914

Query: 918 YRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGK 977
           +RDDY  QK KVAKALE G+ V+G    PGM +EL+S ++IRKQR   +K+RAKNAR  K
Sbjct: 915 HRDDYQTQKKKVAKALENGVQVRGF-RGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAK 973

Query: 978 KR 979
           +R
Sbjct: 974 RR 975

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1189 bits (3075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/862 (68%), Positives = 693/862 (80%), Gaps = 21/862 (2%)

Query: 134  ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
            ILNNI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HS+KIG
Sbjct: 145  ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG 204

Query: 194  ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
             RAVILSPSRE+AMQTYKVFKEFS+GSDLRSVLLTGGDSLE+QFGMMM NPDVV+ATPGR
Sbjct: 205  VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR 264

Query: 254  FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            FLHLKVEMNL+LK+VEY VFDEADRLFEMGF EQLNELLA+LP  RQTLLFSATLP++LV
Sbjct: 265  FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV 324

Query: 314  DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
            DFAKAGLTNPVLVRLDAESK+SENLEMLF++TK+ EREANL YLLQEVI+IP+AT EQ  
Sbjct: 325  DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK 384

Query: 374  ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
             L    +AL+D  DSDA++                  +PSANELPSEKATI+FVPTRHHV
Sbjct: 385  QL----RALNDRSDSDADSDANDKNDRKKRKKQARRKMPSANELPSEKATILFVPTRHHV 440

Query: 434  EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
            EY+SQLLK  GYLVSYIYGTLDQ+AR++QL+NFR+GLTSILVVTDVAARGVDIPMLANVI
Sbjct: 441  EYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVI 500

Query: 494  NFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATC 553
            NF++PSSSKIF+HRVGRTARAGN GWAYSIVS              GKKILLAPMY+ATC
Sbjct: 501  NFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMYDATC 560

Query: 554  NLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRG 613
             L++++WV EG  E  F  P+VSYT+RMVLGSCPR+E+ESMGDLYKNL++S++DL   + 
Sbjct: 561  ELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKS 620

Query: 614  VSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNK 673
            V++KAE +Y RTR PAS E+MKR+K++I SGWDEQN+ FGKN+E EK  FLAKLQ+R +K
Sbjct: 621  VALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHK 680

Query: 674  ETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYK 733
            ETVFEFARN +D+M+VLM++RR+Q+ P+Q +A++RQEL+EKE++AGL H+LEDEVL    
Sbjct: 681  ETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTLEDEVLKGGD 740

Query: 734  GEVGYSVPDAVL-EEFEDADQVLEDQET----------EGXXXXXXXX-----XXXDSNF 777
            GE GYSVP+ VL +EFEDAD++L++QE           +G                D NF
Sbjct: 741  GEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPKPKPKTYKDPNF 800

Query: 778  FMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNP 837
            F+SHYAPA  +QD QL ++SGFT DAA A++DL+DD+K+QVHKQTATVKWD     YVN 
Sbjct: 801  FLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNA 860

Query: 838  QGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNP 897
            QG DN +YI  ESGQKIPAS+RSGKF EWSK RKL   KVG+RE+S  +NLL DP  G  
Sbjct: 861  QGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGR 920

Query: 898  SSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQ 957
                 RF HK  KAPK+PD++RDDY  Q+ KVA ALE+GI VKG   APG  +E++S +Q
Sbjct: 921  RVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQ 979

Query: 958  IRKQRVVKDKRRAKNARVGKKR 979
            IR QRV KDKR AKNAR  KKR
Sbjct: 980  IRSQRVAKDKRLAKNARPSKKR 1001

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/875 (66%), Positives = 692/875 (79%), Gaps = 10/875 (1%)

Query: 106 ISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVG 165
           ++EYF+TNN E                 I++NI KKGFRQPTPIQRKTIPLILQ RDIVG
Sbjct: 105 VTEYFSTNNPEAAKHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKRDIVG 164

Query: 166 MARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSV 225
           MARTGSGKTAAFVLPMIEKLK HS+KIGARAVILSPSRE+AMQT+KVF+EFS+GSDLRSV
Sbjct: 165 MARTGSGKTAAFVLPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRGSDLRSV 224

Query: 226 LLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFA 285
           LLTGG+SLE+QFG+MMSNPDVV+ATPGRFLHLKVEMNL+LKSVEY VFDEADRLFEMGF 
Sbjct: 225 LLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEADRLFEMGFE 284

Query: 286 EQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST 345
           EQL+ELLA+LP  RQTLLFSATLP++LV+FAKAGLTNPVLVRLDAE+K+SENLEMLF+S+
Sbjct: 285 EQLSELLAALPVARQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVSENLEMLFLSS 344

Query: 346 KHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXX 405
           K++EREANL YLLQE +KIP+ATEEQ   L E    + +S DSD  +             
Sbjct: 345 KNEEREANLLYLLQEAMKIPVATEEQ---LLEYKAKVKNSYDSDDSDEDAKAKAKKQRKS 401

Query: 406 XXXXXLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYN 465
                LPSANELPSE ATIVFVPTRHHVEYISQLLK CGYLVSY+YGTLDQHARR+QL+N
Sbjct: 402 AIRKKLPSANELPSEHATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFN 461

Query: 466 FRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           FRAGLT+ILVVTDVAARGVDIP+LANV+N+++P+SSKIFVHRVGRTARAGN+G+AYSIVS
Sbjct: 462 FRAGLTTILVVTDVAARGVDIPLLANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVS 521

Query: 526 XXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGS 585
                         GKKILL PM+EAT  LLK KW+ EGN E  F PPKVSYT+RMVLG+
Sbjct: 522 ENELPYLLDLELFLGKKILLTPMFEATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGA 581

Query: 586 CPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGW 645
           CPR++LE+ GDL+KNL  S++DL   +GV+ KAE +Y RTR PAS++SMKR+K++I SGW
Sbjct: 582 CPRLDLETCGDLFKNLTQSSFDLQQLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGW 641

Query: 646 DEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRA 705
           DEQN+ FGKN+E EK  FLAKLQ+R NKETVFEFARN DD+MS+LMKKRR Q+ P+Q RA
Sbjct: 642 DEQNLRFGKNIEKEKLDFLAKLQNRNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRA 701

Query: 706 KQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLE-EFEDADQVLEDQETEGXX 764
           K+R+EL+EKE++AGL H++EDE+L   + EVGYSVP+ VL  EF+DAD++L  Q      
Sbjct: 702 KERKELLEKERMAGLRHTVEDEILKGDENEVGYSVPEEVLHREFQDADELLGAQ-----S 756

Query: 765 XXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTAT 824
                    D  FF+SHYAPA  +QD QL +++GFT +AA A++DL++DDK+Q HKQ AT
Sbjct: 757 KSKRPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQVAT 816

Query: 825 VKWDXXXXXYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSM 884
            KWD     YVN QG DN +YI  ESG KIPAS+RSGKFDEWSK RKL   KVG++ESS 
Sbjct: 817 TKWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKESST 876

Query: 885 ATNLLQDPTRGNPSSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNN 944
              +L +PT     S   RF H +V+APK+PDK+RDDY  QK KV KA+  GI VKG+ N
Sbjct: 877 TAKMLSNPTAEGQRSIGGRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIPVKGY-N 935

Query: 945 APGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979
           APGM +E+RS  QI K+RV K+K+RAKNAR  KKR
Sbjct: 936 APGMKSEMRSTQQIYKERVAKEKKRAKNARPAKKR 970

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1181 bits (3055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/988 (60%), Positives = 716/988 (72%), Gaps = 26/988 (2%)

Query: 1   MGSTLKRKLXXXXXXXXXXXXFDIAGNIALTXXXXXXXXXXXXXXXXNYQ----DVIDYS 56
           M  + KR L            FDIAG+IAL                  +Q    DVI++S
Sbjct: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNADSEDSDISDDDNDNIGFQAEVQDVIEFS 60

Query: 57  XXXXXXXXXXXXXXXXXXXXX-----XXFPILELSXXXXXXXXXXXXXXXXXXXISEYFT 111
                                       FP LELS                   +++YF 
Sbjct: 61  SDEEEKEKKPKKQNKKAKVKAGPIVDSKFPSLELSDDEKKATNESDDD------LNDYFN 114

Query: 112 TNNSEXXXXXXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGS 171
           T                     +L NI+KKGFRQPTPIQRKTIPLILQ RDIVGMARTGS
Sbjct: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174

Query: 172 GKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGD 231
           GKTAAFVLPMIEKLK HS+KIG RAVILSPSRE+A+QT++VFKEFSKGSDLRS+LLTGGD
Sbjct: 175 GKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234

Query: 232 SLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNEL 291
           SLEDQFGMMM NPDVV+ATPGRFLHLKVEMNL+LKSVEY VFDEADRLFEMGF EQLNEL
Sbjct: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294

Query: 292 LASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDERE 351
           L + P  RQTLLFSATLP++LVDFAKAGL+NPVLVRLDAE+KISENLEMLF+S K DERE
Sbjct: 295 LVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE 354

Query: 352 ANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXL 411
           ANL YLLQE IK+P+ATE Q   L + N A SDS+DS+ E                   L
Sbjct: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNDADSDSDDSEDEK-----KKKAKKAKKSKRRL 409

Query: 412 PSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLT 471
           P+ANE+PSEKATIVFVPTRHHVEY++QLLK CGYLVSYIYG L+QHAR++QLYNFRAGLT
Sbjct: 410 PNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT 469

Query: 472 SILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXX 531
           SILVVTDVAARGVDIP+LANVIN+++P SSKIF+HRVGRTARAGNRGWA+SIVS      
Sbjct: 470 SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPY 529

Query: 532 XXXXXXXXGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIEL 591
                   GKKILL PMYE++C +L++K  +EGN+   F  PKVSYT RMVLG+CPR E+
Sbjct: 530 LLDLELFLGKKILLTPMYESSCQILRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEI 587

Query: 592 ESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNIL 651
           + MGDLY N++ S+++L + +GV++KAE +Y RTR PASAESMKR+K+++ SGWDEQNI 
Sbjct: 588 DGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIY 647

Query: 652 FGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQEL 711
           FGKN E EK  FLAKLQ R NKETVFEFARNPDD+MSVLMK+RR+Q+ P+Q +AK+RQEL
Sbjct: 648 FGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQEL 707

Query: 712 MEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGXXXXXXXXX 771
           +EKE++ GL HS+EDE+L     EVGYSVPD VL+EFEDAD +LE+QE            
Sbjct: 708 LEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQEN---IKKKQKKT 764

Query: 772 XXDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXX 831
             D  F++SH+AP   +QD QL ISSGFT DA+ A++DL +DDK+QVHKQTATVKWD   
Sbjct: 765 FRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKR 824

Query: 832 XXYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQD 891
             YVN QG DN +YI  ESGQKIPAS+RSGKF +WSK RK+   KVG+RES++ +NLL D
Sbjct: 825 KKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLAD 884

Query: 892 PTRGNPSSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNE 951
           PT  +  +   +F HK  KAPK+PDK+RDDY  QK KV  ALE+G+ VKG+ N PGM  E
Sbjct: 885 PTSPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMKQE 943

Query: 952 LRSADQIRKQRVVKDKRRAKNARVGKKR 979
           ++S D+IRK R +K+K+R+KNAR  K+R
Sbjct: 944 IKSVDEIRKLREIKEKKRSKNARPTKRR 971

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/966 (60%), Positives = 714/966 (73%), Gaps = 36/966 (3%)

Query: 22  FDIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYSX-------XXXXXXXXXXXXXXXXX 74
           FDIAGNIAL                   QD+I++S                         
Sbjct: 21  FDIAGNIALDSEDSDDSVSDSDN---EVQDIIEFSDDEKQNAPQVSKTAKGAKGAKVAAP 77

Query: 75  XXXXXFPILELSXXXXXXXXXXXXXXXXXXXISEYF-TTNNSEXXXXXXXXXXXXXXXXX 133
                FP LELS                   +  YF TT+                    
Sbjct: 78  RSDAAFPSLELSDGEDADNGDKDD-------VDSYFNTTSQLAASKAKKGSFASFGLSKF 130

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           IL NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLP+IEKLK HS+KIG
Sbjct: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
           ARA+ILSPSRE+AMQT+KVFKEF+KGS+LRSVLLTGGD LEDQF MMMSNPDV++ATPGR
Sbjct: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR 250

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
           FLHLKVEMNL+L S+EY VFDEADRLFEMGF EQLNELL SLP  RQTLLFSATLP++LV
Sbjct: 251 FLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
           DFAKAGLTNPVLVRLD E+K+SENLEMLF+S K+DEREANL YLLQEVIKIP+ATEEQ  
Sbjct: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL- 369

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
                 +      + DA++                  LPSA ++PS  +TI+FV TRHHV
Sbjct: 370 ------QRFRKQSNDDADDSDDETDKKKKHSKKSKQPLPSAKDMPSPNSTIIFVSTRHHV 423

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
           EY+S LLK CGYLVSY+YGTLDQHARR+QL+NFR GLT+ILVVTDVAARGVDIP+LANV+
Sbjct: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483

Query: 494 NFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATC 553
           N ++P+SSKIFVHRVGRTARAGN+GWAY+I+S              GKK+LL PMYEATC
Sbjct: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMYEATC 543

Query: 554 NLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRG 613
           +LLK+KW++EGN+   FQPPK+SY +R++LGS PR++LE+MGDL+KNL++SN++L + + 
Sbjct: 544 DLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKA 603

Query: 614 VSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNK 673
           VSIKAE +Y+RTRQPASAES+KRAK++I +GWDEQN+ FGKN+E EK +FLAKLQ+R NK
Sbjct: 604 VSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNK 663

Query: 674 ETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYK 733
           ETVFEFARN DD+M++LMK+RR+Q+ P+Q RAK+RQ+L+EKE+ AGL H+LEDE+L   +
Sbjct: 664 ETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILKGEE 723

Query: 734 GEVGYSVPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQL 793
            EVGYSVP  +L +FEDAD++   + T+            D NF++SH+APA  +QD QL
Sbjct: 724 NEVGYSVPQELLRDFEDADELAAKRNTK--------KGFRDENFYLSHFAPASDIQDKQL 775

Query: 794 NISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQK 853
            ++S FT + ++A++DL++DDK+QVHKQTATVKWD     YVN QG DN +YI  ESGQK
Sbjct: 776 QVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQK 835

Query: 854 IPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRRFMHKQVKAPK 913
           IPAS+RSGKFDEWSK RKL   KVG+RESS+  NLL DPT    +  N +F HKQ+KAPK
Sbjct: 836 IPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLA--NGKFKHKQIKAPK 893

Query: 914 VPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNA 973
           +PDK RDDY  Q  KV KA+E G+HVKG+ NAPGM  ELR+ +QIRKQR + +KR+AKNA
Sbjct: 894 MPDKNRDDYQSQLKKVNKAMESGLHVKGY-NAPGMKQELRTTEQIRKQRSMAEKRKAKNA 952

Query: 974 RVGKKR 979
           R  KKR
Sbjct: 953 RPAKKR 958

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON}
           Anc_3.159 YDL031W
          Length = 1001

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/982 (60%), Positives = 716/982 (72%), Gaps = 48/982 (4%)

Query: 23  DIAGNIALTXXXXXXXXXXXXXXXXNYQDVIDYS----XXXXXXXXXXXXXXXXXXXXXX 78
           DIAG+IAL                 +  D+IDYS                          
Sbjct: 41  DIAGDIALESSDEEEEEDVQG----DIADIIDYSDEEPAEAKGKQQKQKQKPSKKSPKEN 96

Query: 79  XFPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNN-SEXXXXXXXXXXXXXXXXXILNN 137
            FP LELS                   ++ YF+TNN +E                 IL+N
Sbjct: 97  AFPSLELSDDESSKAAGDASDDD----VNAYFSTNNQAEKQKFKKGSFASFGLSKAILSN 152

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAV 197
           + +KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLK HSSKIG RA+
Sbjct: 153 VTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGVRAI 212

Query: 198 ILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           ILSPSRE+A+QT+ VFK+FSKG+ LRSVLLTGGDSLE+QFGMMMSNPDVV+ATPGRFLHL
Sbjct: 213 ILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGRFLHL 272

Query: 258 KVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAK 317
           KVEMNL LK+VEYAVFDEADRLFEMGF EQLNELLA+LP  RQTLLFSATLP++LV+FAK
Sbjct: 273 KVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLVEFAK 332

Query: 318 AGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGE 377
           AGLTNPVLVRLDAESKISENL+MLF+S K+DEREANL YLLQ VIKIPLAT EQ      
Sbjct: 333 AGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQ------ 386

Query: 378 GNKALSDSEDSDAE-------------NGXXXXXXXXXXXXXXXXXLPSANELPSEKATI 424
               L    DSDA+              G                 LP+ANELPSE AT+
Sbjct: 387 ----LKKLRDSDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATV 442

Query: 425 VFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
           VFVPTRHHVEYISQ+LK CGYLVSYIYG+LDQ+AR+ QLYNFR GLTSILVVTDVAARGV
Sbjct: 443 VFVPTRHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGV 502

Query: 485 DIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKIL 544
           DIPMLANVIN+++PSSSKIF+HRVGRTARAGN+GWAY+IVS               KK+L
Sbjct: 503 DIPMLANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVL 562

Query: 545 LAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDS 604
           L PM EA   +LK+KW+++GNDE  F+PP VSYTDR+VLGSCPR++LESMGDL+KN++++
Sbjct: 563 LTPMLEAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILEN 622

Query: 605 NYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFL 664
           N+DL   +  S+KAE +Y RTR  AS ES+KR+K++I SGWDEQNI+FG N+E EK  FL
Sbjct: 623 NFDLSLMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFL 682

Query: 665 AKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSL 724
           AKLQ+RRNKETVFEF+RNPDD+MSV MK+RR+QL PVQ +AK+R+EL+EKE+ +GL+HS+
Sbjct: 683 AKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSI 742

Query: 725 EDEVLDKYKG---EVGYSVPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSH 781
           EDE+ ++      E GY+V +  L++FEDAD++L+ Q  +            D NFF+SH
Sbjct: 743 EDEIFNQNNNTEMETGYTVSEEALKQFEDADELLQKQSEK----KTKPKNYKDPNFFLSH 798

Query: 782 YAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGAD 841
           YAPA  +QD QL ++SGFT DAAQA+YDLNDDDK+QVHKQTATVKWD     YVN QG D
Sbjct: 799 YAPAADIQDKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGID 858

Query: 842 NVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNN 901
           N +YI  ESGQKI AS+RSGKFDEWSK R +K  KVG++E S+ T+LL+DPT  +  S N
Sbjct: 859 NKKYIIGESGQKIAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNISGN 918

Query: 902 R----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQ 957
           R    ++ HKQ KAPK+PDK+RD+Y  QK K+A A+E+G +VKG  N PG  +EL+S  Q
Sbjct: 919 RTASGKYKHKQDKAPKLPDKHRDNYHSQKKKIASAMERGTYVKGF-NGPGTQSELKSTAQ 977

Query: 958 IRKQRVVKDKRRAKNARVGKKR 979
           IRK R+  +K++AKNAR  KKR
Sbjct: 978 IRKGRLQAEKKKAKNARPNKKR 999

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/878 (65%), Positives = 699/878 (79%), Gaps = 12/878 (1%)

Query: 106 ISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVG 165
           ++EYF+T                     ILNNI++KGF QPTPIQRKTIPLILQ+RDIVG
Sbjct: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156

Query: 166 MARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSV 225
           +ARTGSGKTAAF+LPMIEKLK+HSSK+GARAVILSPSRE+AMQT+KVFK+FS+G+ LRSV
Sbjct: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216

Query: 226 LLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFA 285
           LLTGGDSLE+QFGMMMSNPDV+VATPGRFLHLKVEMNL+LKS+EYAVFDE+DRLFEMGF 
Sbjct: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276

Query: 286 EQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST 345
           EQLNELLA+LP  RQTLLFSATLPN+LVDFAKAGLTNPVLVRLD ESKISENLEMLF+ST
Sbjct: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336

Query: 346 KHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXX 405
           KHDEREA L YL+QEVI+IPLATEEQ  ++ +  K+    E+SD +NG            
Sbjct: 337 KHDEREAALLYLIQEVIQIPLATEEQIKLIKD--KSPDSDEESDDDNG-KRSHNKHKKEK 393

Query: 406 XXXXXLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYN 465
                +P+AN+LPSEK+TI+FVPTRHHVEYI+ LLK CGYLVSYIYG+LDQ AR RQLYN
Sbjct: 394 FKKVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYN 453

Query: 466 FRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           FRAGLTSILVVTDVAARGVDIPMLANVINF+ PSSSKIFVHRVGRTARAGNRGWAYSI+S
Sbjct: 454 FRAGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIIS 513

Query: 526 XXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGS 585
                         GKKIL  PMYEA  +LL+++WV EG ++  F+ PK SYT+R+VLGS
Sbjct: 514 ESELPYLLDLELFLGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGS 573

Query: 586 CPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGW 645
           CPR++++SMGDLYKNLM S+++L + RGV+ KAE +Y+RTR  AS ES+KR+++++ SGW
Sbjct: 574 CPRLDIDSMGDLYKNLM-SSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGW 632

Query: 646 DEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRA 705
           DEQN++FGKN+E EK  FLAKLQDR NKETVFEFARN DD+ S+LMKKRR Q+ P+  +A
Sbjct: 633 DEQNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITEKA 692

Query: 706 KQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGXXX 765
           K+R+EL+E +K AG +H++EDE+L+  +  +  SVP+ VL+EFEDAD++LEDQE  G   
Sbjct: 693 KKRKELLELQKAAGFSHAMEDELLNDNE-LIKESVPEEVLQEFEDADKLLEDQEKLG--- 748

Query: 766 XXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATV 825
                   D NFF+SHYAP   + +++LN++SGFTTDAAQA+ D+N DDK+QVHKQ ATV
Sbjct: 749 RKKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATV 808

Query: 826 KWDXXXXXYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMA 885
           KWD     Y+N QGADN +YI  ESGQKIPAS+RSGK+ EWSK R L+  KVG+RES  A
Sbjct: 809 KWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTA 868

Query: 886 TNLLQDPTRGNPSSNNR----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKG 941
            N+L++P + +P+   R    +F HKQVKAPK+PDK+RDDY KQK KV +AL+KGI+VKG
Sbjct: 869 ANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKG 928

Query: 942 HNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979
           +N      NEL+S  QIRKQR   +K+ AKNAR  KKR
Sbjct: 929 YNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKR 966

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1170 bits (3028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/964 (61%), Positives = 712/964 (73%), Gaps = 21/964 (2%)

Query: 23  DIAGNIALTXXXXXXXXXXXXXXXXN---YQDVIDYS---XXXXXXXXXXXXXXXXXXXX 76
           DIAGNIAL                      QD+ID+S                       
Sbjct: 22  DIAGNIALDSDESSESEDDSEDGEGEEGDVQDIIDFSGDEEETSKNAKKTGKAEKKPSSK 81

Query: 77  XXXFPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILN 136
              FP+LELS                   ++EYFTT N+E                 I++
Sbjct: 82  QASFPLLELSDDEEEQAANDGEDD-----VTEYFTTTNAEASKHKKGSFASFGLSKFIIS 136

Query: 137 NINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARA 196
           NI KKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLPMIE+LK HS+KIGARA
Sbjct: 137 NIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIGARA 196

Query: 197 VILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLH 256
           VI+SPSRE+A+QT+KVF+EFS+GSDLRSVLLTGG+SLE+QFG+MMSNPDVV+ATPGRFLH
Sbjct: 197 VIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLH 256

Query: 257 LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
           LKVEMNL+LKS+EY VFDEADRLFEMGF EQLNELLA+ P  RQTLLFSATLP++LVDFA
Sbjct: 257 LKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLVDFA 316

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           KAGLT+PVLVRLD E+K+SENLEML++S+K++EREANL YLLQE ++IP+ATEEQ   L 
Sbjct: 317 KAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQ---LA 373

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E    + D  DSD  +                  +P+ANELPSE ATIVFVPTRHHVEYI
Sbjct: 374 EYRTKIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHATIVFVPTRHHVEYI 433

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           +QLLK CGYLVSY+YGTLDQHARR+QL+NFRAGLT+ILVVTDVAARGVDIPMLANV+N++
Sbjct: 434 TQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPMLANVVNYS 493

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLL 556
           +P+SSKIFVHRVGRTARAGN+G AYSIVS              GKKILL PMYEAT  +L
Sbjct: 494 LPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMYEATTEML 553

Query: 557 KEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSI 616
           K +W+ EG  E  F  PKVSYT+RMVLG+CPR+ELE+ GDL+K+L+DS++DL   + V+ 
Sbjct: 554 KSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLKQLKAVAN 613

Query: 617 KAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETV 676
           KAE +Y RTR PAS++SMKR+K+++ SGWDEQN+ FGKNME EK  FLAKLQ+R +KETV
Sbjct: 614 KAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQNRHHKETV 673

Query: 677 FEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEV 736
           FEFARN DD+M++LMKKRR Q+ P+Q RAK+R+EL+EKE+ AGL HS+EDE+L   + EV
Sbjct: 674 FEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSVEDEILKGDETEV 733

Query: 737 GYSVPDAVL-EEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNI 795
           GYSVP+ VL +EFEDAD++LE Q+              D  +F+SHYAPA  +QD QL +
Sbjct: 734 GYSVPEEVLHQEFEDADELLEGQKK-----EKKQKSFRDPTYFLSHYAPASEIQDKQLEV 788

Query: 796 SSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIP 855
           S+GFT +AA A++DL++DDK+Q HKQ AT+KWD     YVN QG DN +YIT ESG KIP
Sbjct: 789 SNGFTNEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGLDNKKYITGESGHKIP 848

Query: 856 ASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRRFMHKQVKAPKVP 915
           AS+RSGKFDEWSK RKL   KVG+RESS  + +L +PT  N      +F H +VKAPK+P
Sbjct: 849 ASFRSGKFDEWSKARKLGPIKVGARESSSTSKMLSNPTSNNQRMGGGKFKHNKVKAPKLP 908

Query: 916 DKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARV 975
           DK RDDY  QK KV KA+  GI VKG  NAPGM +E+R+  QI K+RV K+K+RAKNAR 
Sbjct: 909 DKNRDDYHVQKKKVEKAISSGIRVKGF-NAPGMKSEMRTPQQIYKERVAKEKKRAKNARP 967

Query: 976 GKKR 979
            KKR
Sbjct: 968 AKKR 971

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/906 (63%), Positives = 686/906 (75%), Gaps = 13/906 (1%)

Query: 80  FPILELSXXXXXXXXXXXXXXXXXXXISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNIN 139
           FP+LE+S                   +++YF+TN  +                 IL+NIN
Sbjct: 81  FPLLEMSDDEDDKNSKNSAFNDDADDVNDYFSTNMQDKSKHKKGSFPSFGLSKLILSNIN 140

Query: 140 KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199
           KKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPMIEKLK HS KIGARAVIL
Sbjct: 141 KKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVIL 200

Query: 200 SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259
           SPSRE+AMQT+KVFK+FS+GS LRSVLLTGGDSLE+QF MMMSNPDV+VATPGRF+HLKV
Sbjct: 201 SPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKV 260

Query: 260 EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319
           EM L+LK+VEY VFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLPN+LVDFAKAG
Sbjct: 261 EMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSLVDFAKAG 320

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGN 379
           LTNPVLVRLDAESKISENL++ F STK++EREA L Y+LQ+VI + + TEE+   L   N
Sbjct: 321 LTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEIKKLTASN 380

Query: 380 KALSDSEDSD--AENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYIS 437
           K  SD  DSD   E                   LPSANELPSEKATIVFVPTRHHVEYIS
Sbjct: 381 KR-SDEIDSDNEREQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFVPTRHHVEYIS 439

Query: 438 QLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTM 497
            LLK CGYLVSY+YGTLDQHAR+ QL+NFRAGLTSILVVTDVAARGVDIPMLANVIN+++
Sbjct: 440 NLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPMLANVINYSL 499

Query: 498 PSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKILLAPMYEATCNLLK 557
           P+SSKIFVHRVGRTARAGN+GWAYSI S              GKKILL  MYEATC+L K
Sbjct: 500 PASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMYEATCSLAK 559

Query: 558 EKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIK 617
            KW+  GN+E+ FQPPK SYTDRM+LGSCPR+ELE++GDLYKN+M +++DL   +  S+K
Sbjct: 560 NKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQMAKKTSLK 619

Query: 618 AEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVF 677
           AE +Y RTR  AS ES+KR K++I SGWDEQ+I+FGKN+E EK  FL+K Q+R NKETVF
Sbjct: 620 AEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVF 679

Query: 678 EFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVG 737
           EF RNP D  +VLM +RR+QL P+Q +A +R++L+EKE+LAGL+H+LEDE+L     E G
Sbjct: 680 EFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDEILKGEDHESG 739

Query: 738 YSVPDAVLEEFEDADQVLEDQETEGXXXXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISS 797
           Y++    L  FEDAD++L++QE +            D  FF+SHYAPA+ +QD QLN++S
Sbjct: 740 YTISKEALAAFEDADKLLQEQEKK----KRKPKTYKDPQFFLSHYAPAKDIQDKQLNLTS 795

Query: 798 GFTTDAAQASYDLNDDDKIQVHKQTATVKWDXXXXXYVNPQGADNVRYITSESGQKIPAS 857
           GFT DAAQA+YDLN+DDK+QVHKQTA +KWD     YVN  G DN +YI  E GQKIPAS
Sbjct: 796 GFTNDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKIPAS 855

Query: 858 YRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPK 913
           ++SG+FDEWSK R +K  K G RE S+ TNLL D T   PS  +R    RF HKQ KAP+
Sbjct: 856 FKSGRFDEWSKARHIKPLKAGVREDSIPTNLLADVT--GPSDGSRTFGGRFKHKQNKAPR 913

Query: 914 VPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNA 973
           +PDK+RDDY  QK KV  ALE+G+ VKG+NN   + +EL++  QIRK+R+V + ++ KNA
Sbjct: 914 LPDKHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNA 973

Query: 974 RVGKKR 979
           R  KKR
Sbjct: 974 RPSKKR 979

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/879 (54%), Positives = 598/879 (68%), Gaps = 43/879 (4%)

Query: 106 ISEYFTTNNSEXXXXXXXXXXXXXXXXXILNNINKKGFRQPTPIQRKTIPLILQNRDIVG 165
           I++YF T + +                 I+NNINKKG++QPTPIQRKTIPLILQ RDIVG
Sbjct: 88  INDYFATTHLDTKKFKKGSFASFGFNRFIMNNINKKGYKQPTPIQRKTIPLILQKRDIVG 147

Query: 166 MARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSV 225
           MARTGSGKTAAF+LPMIEKLK HSSKIG R VILSPSREIA+QT++VFKEFSK ++LRSV
Sbjct: 148 MARTGSGKTAAFLLPMIEKLKTHSSKIGVRGVILSPSREIAIQTHRVFKEFSKNTELRSV 207

Query: 226 LLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFA 285
           LLTGGDSLEDQFGMMMSNPDVV+ATPGRFLHLKVEM L+LKSVEY VFDEADRLFEMGF 
Sbjct: 208 LLTGGDSLEDQFGMMMSNPDVVIATPGRFLHLKVEMKLDLKSVEYIVFDEADRLFEMGFE 267

Query: 286 EQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST 345
           EQLNELLA+LP+ RQ+LLFSATLPN+LV+FAKAGL NPVLV+LD ESKIS+NLEMLF+S 
Sbjct: 268 EQLNELLAALPDNRQSLLFSATLPNSLVEFAKAGLKNPVLVKLDQESKISDNLEMLFLSC 327

Query: 346 KHDEREANLFYLLQEVIKIPLA-TEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXX 404
           K +ERE+NL +LLQ+VI +P+A TEE K              DS                
Sbjct: 328 KKEERESNLLFLLQDVIGVPVASTEEMKRF----------QTDSREVEEKEEKEKEKGKE 377

Query: 405 XXXXXXLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLY 464
                    ++E+P E+ATI+FVPTRHHVEYISQLL  CGYLVSY+YGTLDQHARR QL 
Sbjct: 378 KEKRAKYYKSDEIPHEQATIIFVPTRHHVEYISQLLMKCGYLVSYLYGTLDQHARRNQLR 437

Query: 465 NFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            F  G+T ILVVTDVAARGVDIP+L NVIN+++P SSKIFVHRVGRTARAGNRGWAYSIV
Sbjct: 438 QFCFGITRILVVTDVAARGVDIPLLPNVINYSLPGSSKIFVHRVGRTARAGNRGWAYSIV 497

Query: 525 SXXXXXXXXXXXXXXGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLG 584
           S              GKK++   M E                +      K+SY   MVLG
Sbjct: 498 SESELPYLVELGTFLGKKVITTGMVE----------------KLGVSFDKISYNKWMVLG 541

Query: 585 SCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISG 644
           S PR+++ES GDLYKN+ D  +DL  ++    KAE +Y+RTR  AS +S+KR+K++I+  
Sbjct: 542 SGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEKAEKLYLRTRGGASNDSVKRSKELILQK 601

Query: 645 WDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLR 704
           WD QN+ FG+++E  K + L K   R+NKETVFEF +N +D+MS LM +R + ++ ++ +
Sbjct: 602 WDGQNVKFGQDLERAKLELLNKFALRKNKETVFEFGKNGEDEMSTLMNRRWKVVKGIERK 661

Query: 705 AKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGXX 764
           AK+R+E+ E+E+         +E L    G      P   L +  + + V ED +     
Sbjct: 662 AKRRREMKEEEEGGVEEELQFEEELGSGSGPGPGQGPGQDLVDAGNYNGVFEDGDAILNG 721

Query: 765 XXXXXXXXXDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQ-TA 823
                    D  FF+SHYA  + V++ +  +  GF   A++ASYDLN+D+KIQVHKQ +A
Sbjct: 722 QTKKRKTFKDERFFLSHYADPKKVENEE--VVDGFINAASEASYDLNNDEKIQVHKQSSA 779

Query: 824 TVKWDXXXXXYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKL---KMPKVGSR 880
           TVKWD     YVN QG DN +YI  ESG+KIPA++RSGK++EW+K R +    + +VG+R
Sbjct: 780 TVKWDRKRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKARNINTRNVMRVGAR 839

Query: 881 ESSMATNLLQDPTRGNPSSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVK 940
           ES  +         G       RF HK  K PK+PDKYRDDY KQK K  +A+E+G+ +K
Sbjct: 840 ESEGSV------VGGGRGGGGGRFKHKLDKKPKMPDKYRDDYKKQKEKNERAVERGV-MK 892

Query: 941 GHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR 979
           G     G  +EL++  +IRK RV K+KRRAKN R G++R
Sbjct: 893 GKR---GYKDELKNVAEIRKNRVEKEKRRAKNGRPGRER 928

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  234 bits (596), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 212/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +KI 
Sbjct: 230 VLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 289

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  K  S L   L  GG +L  Q   + + PD+VVATP
Sbjct: 290 STRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNLRQQEQSLKARPDIVVATP 349

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF E+LNE+L+ LP KRQTLLFSAT+ +
Sbjct: 350 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEILSLLPSKRQTLLFSATMNS 409

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV V +D   + +  L   FV  +  +  + + LF+L+          
Sbjct: 410 KIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFVRIRKRDHLKPSVLFHLI---------- 459

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
              K + G G K +                                         +VFV 
Sbjct: 460 ---KKLDGTGQKRM-----------------------------------------VVFVA 475

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G  V  ++G+L Q  R + +  F++    ILV TD+A+RG+DIP 
Sbjct: 476 RKEMAHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDLASRGLDIPK 535

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP + ++++HRVGRTARAG  G + S+V
Sbjct: 536 IEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLV 571

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  233 bits (595), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/396 (35%), Positives = 213/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 242 VLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVA 301

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  K  S L   L  GG +L  Q   + + PD+V+ATP
Sbjct: 302 STRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELKTRPDIVIATP 361

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF E+LNE+L  LP KRQTLLFSAT+ +
Sbjct: 362 GRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQTLLFSATMNS 421

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + ++   + +  L   FV  +  +  + A LFYL+++        
Sbjct: 422 RIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLIRK-------- 473

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
                + G G K +                                         +VFV 
Sbjct: 474 -----LDGTGQKRI-----------------------------------------VVFVA 487

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G  V  ++G+L Q  R + + NF++    +L+ TD+A+RG+DIP 
Sbjct: 488 RKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDLASRGLDIPK 547

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VINF MP S +I++HRVGRTARAG  G + + V
Sbjct: 548 IEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  230 bits (586), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 139/396 (35%), Positives = 210/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L   S+KI 
Sbjct: 237 VLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAFMIPVIERLLFKSAKIA 296

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKG-SDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           A R ++L+P+RE+A+Q   V K+  K  + +   L  GG +L  Q   + + PD+V+ATP
Sbjct: 297 ATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVGGLNLRQQEQELKARPDIVIATP 356

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF E+LNE++  LP KRQTLLFSAT+ +
Sbjct: 357 GRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIMQLLPNKRQTLLFSATMNS 416

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   + +  L   FV  +  +  + A LF L+          
Sbjct: 417 KIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRARDHLKPALLFNLI---------- 466

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
              K + G G K +                                         +VFV 
Sbjct: 467 ---KKLDGYGQKRM-----------------------------------------VVFVS 482

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G  V+ ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP 
Sbjct: 483 RKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDLASRGLDIPK 542

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP S +I++HRVGRTARAG  G + S V
Sbjct: 543 IEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFV 578

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  228 bits (582), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 211/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ LQ +D++  A TGSGKTAAF++P+IE+L    SK+ 
Sbjct: 250 VLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGKTAAFMIPIIERLLFKPSKVA 309

Query: 194 -ARAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
             R ++L+P+RE+A+Q   V K+  +  S L   L  GG +L  Q   + + PD+V+ATP
Sbjct: 310 MTRVIVLTPTRELAIQISDVAKKIGQFVSGLTFGLAVGGLNLRQQEQALKARPDIVIATP 369

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++L E++  LP KRQ LLFSAT+ +
Sbjct: 370 GRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKEIMTMLPSKRQNLLFSATMNS 429

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   + +  L   FV  +  +  + A LF L++++       
Sbjct: 430 KIKSLVSLSLRRPVRIMIDPPKQAASKLTQEFVRIRKRDNLKPALLFNLIRKL------- 482

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
                             DS+A                             +K  +VFV 
Sbjct: 483 ------------------DSNA-----------------------------QKRIVVFVA 495

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G  V+ ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP 
Sbjct: 496 RKETAHRLRIILGLLGMAVAELHGSLTQEQRLESVTRFKSLDVPVLICTDLASRGLDIPK 555

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP S +I++HRVGRTARAG  G + ++V
Sbjct: 556 IEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLV 591

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  224 bits (571), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 213/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    + I 
Sbjct: 231 VLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPANIA 290

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSD-LRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K   K  + L   L  GG +L  Q   + + PDVV+ATP
Sbjct: 291 STRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLRQQEQELKTRPDVVIATP 350

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF E+LNE+++ LP KRQTLLFSAT+ +
Sbjct: 351 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMSLLPTKRQTLLFSATMNS 410

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + ++   + +  L   FV  +  +  + A L+YL++++       
Sbjct: 411 KIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKPALLYYLIRKL------- 463

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
                             DS ++                             K  +VFV 
Sbjct: 464 ------------------DSSSQ-----------------------------KRIVVFVS 476

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  ++   G  V+ ++G+L Q  R + +  F++    +L+ TD+A+RG+DIP 
Sbjct: 477 RKEMAHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVPVLICTDLASRGLDIPK 536

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 537 IEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 572

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  221 bits (563), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 135/395 (34%), Positives = 205/395 (51%), Gaps = 57/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI- 192
           +L  +   G+ +P+PIQ   IP+ L  +DI+  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 247 VLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVT 306

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSV-LLTGGDSLEDQFGMMMSNPDVVVATP 251
             R ++L+P+RE+A+Q   V K+  K  +  +  L  GG +L  Q   + S PD+VVATP
Sbjct: 307 STRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFGLAVGGLNLRQQEQQLKSRPDIVVATP 366

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE+++ LP KRQTLLFSAT+ +
Sbjct: 367 GRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNS 426

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST-KHDEREANLFYLLQEVIKIPLATE 369
            +       L  PV + +D   + +  L   FV   K D  +  L Y L           
Sbjct: 427 KIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLKPALLYTL----------- 475

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
             + + G G K +                                         +VFV  
Sbjct: 476 -IRKLDGAGQKRI-----------------------------------------VVFVAR 493

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML 489
           +     +  +L   G  V  ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP +
Sbjct: 494 KETAHKLRIILGLLGQSVGELHGSLTQEQRLDSVNKFKSLEVPVLLCTDLASRGLDIPKI 553

Query: 490 ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
             VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 554 EVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 588

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  221 bits (562), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 133/394 (33%), Positives = 207/394 (52%), Gaps = 55/394 (13%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++P+IE+L    + I 
Sbjct: 244 VLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAHIA 303

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSD-LRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R V+L+P+RE+A+Q   V K   K  + L   L  GG +L  Q   + + PD+V+ATP
Sbjct: 304 STRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQEQALKTRPDIVIATP 363

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ HL+   + ++ SVE  V DEADR+ E GF E+L E+++ +P KRQTLLFSAT+ +
Sbjct: 364 GRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIPSKRQTLLFSATMNS 423

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +       L  PV + +D   + ++                    L QE I+I      
Sbjct: 424 KIKQLISLSLKKPVRIMIDPPKQAADK-------------------LTQEFIRIRKRDHL 464

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +L +  + L ++                                 S+K  +VFV  +
Sbjct: 465 KPALLYQLIRKLDNT---------------------------------SQKRIVVFVARK 491

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
                +  +L   G  V  ++G+L Q  R + + NF++    +L+ TD+A+RG+DIP + 
Sbjct: 492 ETAHKLRIVLGLLGMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTDLASRGLDIPKIE 551

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            VINF MP + +I++HRVGRTARAG  G + + V
Sbjct: 552 VVINFDMPKTYEIYLHRVGRTARAGREGRSVTFV 585

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  220 bits (561), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 211/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    +++ 
Sbjct: 226 VLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQVS 285

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V  + +K  + +   L  GG +L  Q   + + PDVV+ATP
Sbjct: 286 STRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNLRQQEQALRARPDVVIATP 345

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR + H++   + N+ SVE  V DEADR+ E GF ++LNE+++ +P KRQTLLFSAT+ +
Sbjct: 346 GRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNS 405

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENL--EMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   + +  L  E + V  + D + A LF+L+          
Sbjct: 406 KINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLKPALLFHLI---------- 455

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
                      + L D+                                 S+K  +VFV 
Sbjct: 456 -----------RKLDDA---------------------------------SQKRVVVFVA 471

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G  V+ ++G+L Q  R + +  F++    +L+ TD+A+RG+DIP 
Sbjct: 472 RKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTDLASRGLDIPK 531

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VINF MP +  I++HRVGRTARAG  G + S V
Sbjct: 532 IEFVINFDMPKTYDIYLHRVGRTARAGREGRSISFV 567

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  219 bits (559), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/396 (33%), Positives = 211/396 (53%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+IE+L    +KI 
Sbjct: 230 VLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 289

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  K  S L   L  GG +L  Q   +   PD+V+ATP
Sbjct: 290 STRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALKLRPDIVIATP 349

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR + H++   + ++ SVE  V DEADR+ E GF ++LNE+++ +P KRQTLLFSAT+ +
Sbjct: 350 GRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNS 409

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   + +  L   FV  +  E  + A L++LL++     L +
Sbjct: 410 RIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHLLRK-----LDS 464

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
             QK I                                                 +VFV 
Sbjct: 465 TGQKRI-------------------------------------------------VVFVA 475

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  +L   G     ++G+L Q  R + + NF++    +LV TD+A+RG+DIP 
Sbjct: 476 RKEVAHRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDLASRGLDIPK 535

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP + +I++HRVGRTARAG  G + ++V
Sbjct: 536 IEVVINYDMPKTYEIYLHRVGRTARAGREGKSVTLV 571

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  214 bits (545), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/403 (34%), Positives = 208/403 (51%), Gaps = 61/403 (15%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RSV + GG ++ DQ   +M  P +++ TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L++++Y V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNK 380
           TNPV                  VSTK+   +     L+Q ++ +P   ++  ++      
Sbjct: 272 TNPV---------------KCAVSTKYQTVDT----LVQTLMVVPGGVKDTYLVY----- 307

Query: 381 ALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQLL 440
                                             NE    K+ I+F  T+ + E IS L 
Sbjct: 308 --------------------------------LLNEFIG-KSMIIFTRTKANAERISGLA 334

Query: 441 KACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSS 500
               +  + ++G L+Q+ R   L  F+AG  SILV TDVAARG+DIP +  VIN+ +P  
Sbjct: 335 NLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDVVINYDIPVD 394

Query: 501 SKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 543
           SK ++HRVGRTARAG  G + S+VS              GKK+
Sbjct: 395 SKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 437

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  219 bits (557), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 133/396 (33%), Positives = 207/396 (52%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +KI 
Sbjct: 248 VLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 307

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L P+RE+A+Q   V K+ ++    +   L  GG +L  Q  M+ S PD+V+ATP
Sbjct: 308 STRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVGGLNLRQQEQMLKSRPDIVIATP 367

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE++  LP  RQ LLFSAT+ +
Sbjct: 368 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSSRQNLLFSATMNS 427

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   K +  L   FV  +  +  + A +F L++++   P+A 
Sbjct: 428 KIKSLVSLSLKRPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALIFNLIRKL--DPMA- 484

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
             QK I                                                 +VFV 
Sbjct: 485 --QKRI-------------------------------------------------VVFVA 493

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
            +     +  ++   G  V  ++G+L Q  R   +  F+     +L+ TD+A+RG+DIP 
Sbjct: 494 RKESAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNLEVPVLICTDLASRGLDIPK 553

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VIN+ MP S ++++HRVGRTARAG  G + + V
Sbjct: 554 IEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFV 589

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  218 bits (554), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 131/396 (33%), Positives = 217/396 (54%), Gaps = 59/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    +++ 
Sbjct: 234 VLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQVA 293

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSD-LRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R V+L+P+RE+A+Q   V K+  K  + L   L  GG +L  Q   +   PD+V+ATP
Sbjct: 294 STRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQQEQTLKLRPDIVIATP 353

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + ++ SVE  V DEADR+ E GF ++LNE+++ +P KRQTLLFSAT+ +
Sbjct: 354 GRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSLIPSKRQTLLFSATMNS 413

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEVIKIPLAT 368
            +       L  PV + +D   + +  L   FV  +  +  + A LF+L++++ +    T
Sbjct: 414 KIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPALLFHLIRKIDE----T 469

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
            ++++++    K ++                                             
Sbjct: 470 SQKRIVVFVSRKEMA--------------------------------------------- 484

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
             H +  I  LL   G  V+ ++G+L Q  R + + +F++    +L+ TD+A+RG+DIP 
Sbjct: 485 --HRLRIILGLL---GMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTDLASRGLDIPK 539

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  VINF MP + +I++HRVGRTARAG  G + S V
Sbjct: 540 IEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFV 575

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  214 bits (546), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 136/397 (34%), Positives = 212/397 (53%), Gaps = 61/397 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  ++  GF +P+PIQ  TIP+ L  +DIV  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 225 VLKGLSSLGFTKPSPIQSATIPIALLGKDIVAGAVTGSGKTAAFMIPIIERLLYKPAKVA 284

Query: 194 A-RAVILSPSREIAMQTYKVFKE---FSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVA 249
           + R VIL+P+RE+A+Q   V K+   F  G  L   L  GG +L  Q  ++ S PD+V+A
Sbjct: 285 STRVVILTPTRELAIQISDVAKKIGHFVNG--LTFGLAVGGLNLRQQEQILKSRPDIVIA 342

Query: 250 TPGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATL 308
           TPGRF+ H++   + ++  VE  V DEADR+ E GF ++L+E++  LP +RQ LLFSAT+
Sbjct: 343 TPGRFIDHVRNSASFSVDRVEILVLDEADRMLEEGFQDELSEIMTLLPTRRQNLLFSATM 402

Query: 309 PNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST-KHDEREANLFYLLQEVIKIPLA 367
            + +       L  PV + +D   + ++ L   FV   K D  +  L Y L   I+   +
Sbjct: 403 NSKIKQLVSLSLKKPVRIMIDPPKQAADRLVQEFVRIRKRDHLKPALLYNL---IRKLDS 459

Query: 368 TEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFV 427
           T ++++++    K ++                                            
Sbjct: 460 TGQKRIVVFVSRKEVA-------------------------------------------- 475

Query: 428 PTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIP 487
              H +  I  LL   G  V+ ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP
Sbjct: 476 ---HRLRIILGLL---GMGVAELHGSLSQEQRLDSVNKFKSLDVPVLICTDLASRGLDIP 529

Query: 488 MLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            +  VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 530 KIEIVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 566

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  201 bits (510), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 197/400 (49%), Gaps = 66/400 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    S 
Sbjct: 121 VLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLSP 180

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q  K   +F   S +R+  + GG     Q   ++   ++V+AT
Sbjct: 181 GDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDLVRGAEIVIAT 240

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 241 PGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 311 TLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
            +   A   L +P+ V+     L A   I++ +E+L    K D    +L     E+    
Sbjct: 301 EVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHL-----EIA--- 352

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
                              SED D++                                +V
Sbjct: 353 -------------------SEDKDSK-------------------------------ILV 362

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
           F  T+   + I++ L+A G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D
Sbjct: 363 FASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARGID 422

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +  +  VIN+ MP + + +VHR+GRT RAG +G A S  +
Sbjct: 423 VKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  206 bits (523), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 210/392 (53%), Gaps = 46/392 (11%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHS----SKIGARAV 197
           GFR  TPIQ + IP I+   D++G+++TGSGKT +++LP+I  +KA +    ++ G   +
Sbjct: 306 GFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIRHIKAQNPLMKNETGPLGL 365

Query: 198 ILSPSREIAMQTYK-VFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLH 256
           IL+P+RE+A+Q ++ + K  S  + + S+  TGG  L+ Q   +     +VVATPGR + 
Sbjct: 366 ILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQINSLKKGVHIVVATPGRLID 425

Query: 257 LKVEMN---LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
           L    N   +++K V + + DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 426 LLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 485

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREAN-LFYLLQEVIKIPLATEEQK 372
           +FA   L +P+ + ++++S ++E ++  F    +DE + + L  +++E    P+ T +  
Sbjct: 486 NFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDELLAMIEENSSEPIETTD-- 543

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L   E+ +                            P ++ TI+FV ++  
Sbjct: 544 ---------LGKEEEEE--------------------------HTPQDRKTIIFVASQQI 568

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            ++I   L+  GY    I+       R + L NF++   SILV T+V +RG++I  ++ V
Sbjct: 569 CDFIGTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVATEVLSRGLNITEVSLV 628

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           I F    +   +VH  GRTAR  + G A S++
Sbjct: 629 IIFNAVKTFAQYVHTTGRTARGNHSGVAISLI 660

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  199 bits (506), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 125/396 (31%), Positives = 206/396 (52%), Gaps = 58/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 121 VLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIVHINAQPLLAP 180

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F + S +R+  + GG     Q   +    ++V+AT
Sbjct: 181 GDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDLARGAEIVIAT 240

Query: 251 PGRFLHLKVEMN-LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLP 309
           PGR + + +E+N  NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P
Sbjct: 241 PGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 299

Query: 310 NTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATE 369
             +   A+  LT+P+ V++ +          L +S  H          +++V+++ ++  
Sbjct: 300 KEVKQLARDYLTDPIQVQIGS----------LELSASH---------TIKQVVEV-ISEF 339

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
           E++  L +  +  S+ +DS                                   +VF  T
Sbjct: 340 EKRDRLSKHLEIASEDQDS---------------------------------KVLVFAST 366

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML 489
           +   + I+Q L+  G+    I+G  DQ  R   L  F+ G + I+V TDVAARG+D+  +
Sbjct: 367 KRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAARGIDVKGI 426

Query: 490 ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
             VIN+ MP + + +VHR+GRT RAG +G A S  +
Sbjct: 427 NYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  201 bits (510), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/401 (31%), Positives = 209/401 (52%), Gaps = 57/401 (14%)

Query: 134 ILNNI-NKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKA----H 188
           I+N I N   F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+ ++KA     
Sbjct: 118 IMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLRQIKALRPLA 177

Query: 189 SSKIGARAVILSPSREIAMQTYKVFKEFSKG-SDLRSVLLTGGDSLEDQFGMMMSNPDVV 247
             + G   +IL+P+RE+A+Q ++   +F KG + LRS+  TGG  L+ Q   +    ++V
Sbjct: 178 REESGPLGLILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQINDLKKGVEIV 237

Query: 248 VATPGRFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLL 303
           VATPGRF+ L + +N    +N + + + V DEADRLF++GF  Q+ E++ ++   +Q +L
Sbjct: 238 VATPGRFIDL-LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKTVRPDKQCVL 296

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           FSAT P+ L  FA   L  PV + ++++S I+EN+E      ++DE +   F  L EV+K
Sbjct: 297 FSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEK---FNSLLEVLK 353

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
             +            N+     +D D                               + T
Sbjct: 354 AQI------------NREAESHDDKD-------------------------------EKT 370

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+FV ++   + I   L    Y    I+     H R   L  F+     IL+ T+V +RG
Sbjct: 371 IIFVSSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCTEVLSRG 430

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +++P ++ V+ +    +   +VH  GRTAR   +G A S++
Sbjct: 431 LNVPEVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLL 471

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  197 bits (501), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/395 (31%), Positives = 200/395 (50%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +LN +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 124 VLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q      +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +          L +S  H+         + +++++      
Sbjct: 304 EVKQLAADYLNDPIQVQVGS----------LELSASHN---------ITQIVEV------ 338

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
                      +SD E  D  N                  L +A++  +E  T++F  T+
Sbjct: 339 -----------VSDFEKRDRLN----------------KYLETASQ-DNEYKTLIFASTK 370

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 371 RMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGIN 430

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 431 YVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  197 bits (500), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/396 (31%), Positives = 191/396 (48%), Gaps = 58/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    S 
Sbjct: 121 VLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLSP 180

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F K S +R+  + GG     Q   ++   ++V+AT
Sbjct: 181 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRELIRGAEIVIAT 240

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 241 PGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 311 TLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATE 369
            +   A+  L +P+ V++ + E   S N+  L       E+   L   L           
Sbjct: 301 EVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHL----------- 349

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
                         D+   D E+                               ++F  T
Sbjct: 350 --------------DTASQDKES-----------------------------KILIFAST 366

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML 489
           +   + I+  L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  +
Sbjct: 367 KRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAARGIDVKGI 426

Query: 490 ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
             V+N+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 427 NFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 462

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  196 bits (497), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 124/395 (31%), Positives = 200/395 (50%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 124 VLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q      +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +          L +S  H+         + +++++      
Sbjct: 304 EVKQLAADYLNDPIQVQVGS----------LELSASHN---------ITQIVEV------ 338

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
                      +SD E  D  N                  L +A++  +E  T+VF  T+
Sbjct: 339 -----------VSDFEKRDRLN----------------KYLETASQ-DNEYKTLVFASTK 370

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 371 RMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGIN 430

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 431 YVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  196 bits (497), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/396 (31%), Positives = 194/396 (48%), Gaps = 58/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 129 VLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 188

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 189 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIAT 248

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 249 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 308

Query: 311 TLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATE 369
            +   A   L +P+ V++ + E   S N+  L       E+   L   L+          
Sbjct: 309 EVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEKRDRLLKHLE---------- 358

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
                        + SED +++                                ++F  T
Sbjct: 359 -------------TASEDKESK-------------------------------ILIFAST 374

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML 489
           +   + I+++L+  G+    I+G  DQ  R   L  FRAG + I+V TDVAARG+D+  +
Sbjct: 375 KRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAARGIDVKGI 434

Query: 490 ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
             VIN+ MP + + +VHR+GRT RAG +G A S  +
Sbjct: 435 NFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 470

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  194 bits (494), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 191/386 (49%), Gaps = 56/386 (14%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G + +++SP+
Sbjct: 127 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 186

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMN 262
           RE+A Q Y      +    L+   + GG   ++Q   +  +  VVVATPGR L L  E +
Sbjct: 187 RELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGS 245

Query: 263 LNLKSVEYAVFDEADRLFEMGFAEQLNELLASL-PEKRQTLLFSATLPNTLVDFAKAGLT 321
           ++L  V Y V DE DR+ E GF E +  ++      KRQTL+F+AT P  + + A + + 
Sbjct: 246 VDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASSFMK 305

Query: 322 NPVLVRLDAESKISENLEMLFVSTKHDER--EANLFYLLQEVIKIPLATEEQKMILGEGN 379
           NP+ V +    +++ N ++  +    D R  E  L  LL++                   
Sbjct: 306 NPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKKY------------------ 347

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
                       +G                  P  NE       ++F   +     + + 
Sbjct: 348 -----------HSG------------------PKKNE-----KVLIFALYKKEATRVERN 373

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           LK  GY V+ I+G L Q  R + L  F++G +++L+ TDVAARG+DIP +  VIN T P 
Sbjct: 374 LKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 433

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +VHR+GRT RAG  G A+++ +
Sbjct: 434 TVEDYVHRIGRTGRAGQTGTAHTLFT 459

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  200 bits (509), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 214/400 (53%), Gaps = 52/400 (13%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----S 189
           I++N+    +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++ ++KA     +
Sbjct: 272 IMHNLK---YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLAT 328

Query: 190 SKIGARAVILSPSREIAMQTYKVFKEFSKGS-DLRSVLLTGGDSLEDQFGMMMSNPDVVV 248
           ++ G   +IL+P+RE+A+Q ++  + F+K    + S+  TGG  L+ Q  M+    ++VV
Sbjct: 329 NETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIVV 388

Query: 249 ATPGRFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLF 304
           ATPGRF+ L + +N    L  K + + V DEADRLF++GF  Q+ +++ ++   +Q +LF
Sbjct: 389 ATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVLF 447

Query: 305 SATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKI 364
           SAT PN L  FA   L  P+ + +++++ ++EN++  F     DE   N +  L  ++  
Sbjct: 448 SATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDE---NKYRALLSIL-- 502

Query: 365 PLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATI 424
               +  K         L+D E +D                              +KA I
Sbjct: 503 ---DKRMKEEDENEESELADDEVND------------------------------DKA-I 528

Query: 425 VFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
           +FV ++   +++   L+  GY +  I+       R   L NFR    SIL+ T+V +RG+
Sbjct: 529 IFVSSQQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGL 588

Query: 485 DIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           ++P ++ VI +    +   +VH  GRTAR  N G A +++
Sbjct: 589 NVPEVSLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITLL 628

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  195 bits (496), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 193/396 (48%), Gaps = 58/396 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +LN +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    + 
Sbjct: 126 VLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLAP 185

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 186 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIAT 245

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 246 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 305

Query: 311 TLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATE 369
            +   A   L +P+ V++ + E   S N+  L       E+   L   L+       A++
Sbjct: 306 EVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE------TASQ 359

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
           +Q                                                E   ++F  T
Sbjct: 360 DQ------------------------------------------------ESKILIFAST 371

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML 489
           +   + +++ L+  G+    I+G  DQ  R   L  FR+G + I+V TDVAARG+D+  +
Sbjct: 372 KRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAARGIDVKGI 431

Query: 490 ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
             VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 432 NYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 467

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  194 bits (493), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 190/386 (49%), Gaps = 56/386 (14%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G + +++SP+
Sbjct: 132 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 191

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMN 262
           RE+A Q Y      +    ++   + GG   ++Q  + +    VVVATPGR L L  E +
Sbjct: 192 RELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKKSQVVVATPGRLLDLLQEGS 250

Query: 263 LNLKSVEYAVFDEADRLFEMGFAEQLNELLASL-PEKRQTLLFSATLPNTLVDFAKAGLT 321
           ++L  V Y V DEADR+ E GF E +  ++      KRQTL+F+AT P  + + A   + 
Sbjct: 251 VDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMN 310

Query: 322 NPVLVRLDAESKISENLEMLFVSTKHDER--EANLFYLLQEVIKIPLATEEQKMILGEGN 379
           NP+ V +    +++ N  +  +    D R  E  L  LL++                   
Sbjct: 311 NPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKY------------------ 352

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
                       +G                  P  NE       ++F   +     + + 
Sbjct: 353 -----------HSG------------------PKKNE-----KVLIFALYKKEAARVERN 378

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           LK  GY V+ I+G L Q  R + L  F++G +++L+ TDVAARG+DIP +  VIN T P 
Sbjct: 379 LKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 438

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +VHR+GRT RAG  G A+++ +
Sbjct: 439 TVEDYVHRIGRTGRAGQTGTAHTLFT 464

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  194 bits (492), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 191/386 (49%), Gaps = 56/386 (14%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G + +++SP+
Sbjct: 131 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 190

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMN 262
           RE+A Q Y      +    ++   + GG   ++Q   +  +  VVVATPGR L L  E +
Sbjct: 191 RELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGS 249

Query: 263 LNLKSVEYAVFDEADRLFEMGFAEQLNELLASL-PEKRQTLLFSATLPNTLVDFAKAGLT 321
           ++L  V Y V DEADR+ E GF E +  ++      KRQTL+F+AT P  + + A   + 
Sbjct: 250 VDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTLMFTATWPKEVRELASTFMK 309

Query: 322 NPVLVRLDAESKISENLEMLFVSTKHDER--EANLFYLLQEVIKIPLATEEQKMILGEGN 379
           NP+ V +    +++ N ++  +    D R  E  L  LL++                   
Sbjct: 310 NPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELLKKY------------------ 351

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
                       +G                  P  NE       ++F   +     + + 
Sbjct: 352 -----------HSG------------------PKKNE-----KVLIFALYKKEAARVERN 377

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           LK  GY V+ I+G L Q  R + L  F++G +++L+ TDVAARG+DIP +  VIN T P 
Sbjct: 378 LKYNGYSVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 437

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +VHR+GRT RAG  G A+++ +
Sbjct: 438 TVEDYVHRIGRTGRAGQTGTAHTLFT 463

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  194 bits (493), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 196/395 (49%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    + 
Sbjct: 120 VLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIVHINAQPLLAP 179

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F K S +R+  + GG     Q   +    ++V+AT
Sbjct: 180 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLARGAEIVIAT 239

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 240 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 299

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +          L ++  H+         +++V+++    E+
Sbjct: 300 EVKQLASDYLHDPIQVQIGS----------LELAASHN---------IKQVVEVITDFEK 340

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +    + A  D E                                     +VF  T+
Sbjct: 341 RDRLTKHMDIASQDKESK----------------------------------ILVFASTK 366

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 367 RTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGIDVKGIN 426

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 427 YVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 461

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  194 bits (493), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 199/395 (50%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 122 VLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 181

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q      +F K S +R+  + GG     Q   +    ++V+AT
Sbjct: 182 GDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELTRGAEIVIAT 241

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 242 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 301

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L +P+ V          N+  L ++  H+         + +++++    E+
Sbjct: 302 EVQQLARDYLHDPIQV----------NVGSLELAASHN---------IAQIVEVVSDMEK 342

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +L     A   SED D++                                ++F  T+
Sbjct: 343 RDRLLKHLETA---SEDKDSK-------------------------------ILIFASTK 368

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G   Q+ R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 369 RTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARGIDVKGIN 428

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 429 FVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 463

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  193 bits (490), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 124/386 (32%), Positives = 190/386 (49%), Gaps = 56/386 (14%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G + +++SP+
Sbjct: 125 FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQGKRGIQVLVISPT 184

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMN 262
           RE+A Q Y      +    ++   + GG   ++Q   +  +  VVVATPGR L L  E +
Sbjct: 185 RELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKRS-QVVVATPGRLLDLLQEGS 243

Query: 263 LNLKSVEYAVFDEADRLFEMGFAEQLNELLASL-PEKRQTLLFSATLPNTLVDFAKAGLT 321
           ++L  V Y V DEADR+ E GF E +  ++      KRQTL+F+AT P  + + A   + 
Sbjct: 244 VDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTLMFTATWPKEVRELASTFMK 303

Query: 322 NPVLVRLDAESKISENLEMLFVSTKHDER--EANLFYLLQEVIKIPLATEEQKMILGEGN 379
           NP+ V +    +++ N ++  +    D R  E  L  LL++                   
Sbjct: 304 NPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKKY------------------ 345

Query: 380 KALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQL 439
                       +G                  P  NE       ++F   +     + + 
Sbjct: 346 -----------HSG------------------PKKNE-----KVLIFALYKKEATRVERN 371

Query: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499
           LK  GY V+ I+G L Q  R + L  F++G +++L+ TDVAARG+DIP +  VIN T P 
Sbjct: 372 LKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPL 431

Query: 500 SSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +VHR+GRT RAG  G A+++ +
Sbjct: 432 TVEDYVHRIGRTGRAGQTGTAHTLFT 457

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  198 bits (504), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 116/392 (29%), Positives = 209/392 (53%), Gaps = 48/392 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++KA       + G   +I
Sbjct: 276 FESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 199 LSPSREIAMQTYKVFKEFSKGSDL-RSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           L+P+RE+A+Q ++  ++F+    L RSV  TGG  ++ Q   +    ++VVATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    L+ K + + + DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLF-VSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            FA   L +P+ + ++++  ++EN++  F +    DE+  NL  ++          E   
Sbjct: 455 SFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLVQIVHG------RAEFFN 508

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
            IL E +   SD E++DA+                                I+FV ++  
Sbjct: 509 EILTEADGESSDFEEADAK-------------------------------AIIFVSSQQI 537

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            ++IS+ L+  G +   I+       R   L  F+    S+L+ T+V +RG+++P ++ V
Sbjct: 538 CDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRGLNVPEVSLV 597

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           I +    +   +VH  GRTAR    G A +++
Sbjct: 598 IIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  193 bits (490), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 197/395 (49%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 125 VLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 184

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q      +F + S +R+  + GG     Q   +    ++V+AT
Sbjct: 185 GDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 244

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +       LE+    T            + +++++    E+
Sbjct: 305 EVKQLAADYLNDPIQVQVGS-------LELAASHT------------ITQLVEVVSDFEK 345

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +    NK L  +   D                              E  T++F  T+
Sbjct: 346 RDRL----NKHLETASQDD------------------------------EYKTLIFASTK 371

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 372 RMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARGIDVKGIN 431

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 432 YVINYDMPGNIEDYVHRIGRTGRAGATGTAVSFFT 466

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  198 bits (503), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/392 (29%), Positives = 210/392 (53%), Gaps = 48/392 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++KA       + G   +I
Sbjct: 276 FGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLI 335

Query: 199 LSPSREIAMQTYKVFKEFSKG-SDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           L+P+RE+A+Q ++   +F++  + +RSV  TGG  ++ Q   +    ++VVATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDI 395

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    L+ K + + V DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 396 -LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLF-VSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            FA   L +P+ + ++++  ++EN++  F +    DE+  NL  L+ E       +E   
Sbjct: 455 SFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNLVQLIHE------RSEFFD 508

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
            +  E +   SD E+ DA+                                I+FV +++ 
Sbjct: 509 EVQSENDGQSSDVEEVDAK-------------------------------AIIFVSSQNI 537

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            ++IS+ L   G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ V
Sbjct: 538 CDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLV 597

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           I +    +   +VH  GRTAR    G A +++
Sbjct: 598 IIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  192 bits (487), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 195/395 (49%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 134 VLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 193

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++++AT
Sbjct: 194 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 253

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 254 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 313

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L +P+ V          N+  L ++  H          + +++++      
Sbjct: 314 EVQQLARDYLHDPIQV----------NIGSLELAASH---------TITQIVEV------ 348

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
                      +SD E  D                     L  A++ P  K  I+F  T+
Sbjct: 349 -----------ISDFEKRD----------------RLVKHLDIASKDPESK-IIIFASTK 380

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I+  L+  G+    I+G   Q  R   L  FR G + I+V TDVAARG+D+  + 
Sbjct: 381 RTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARGIDVKGIN 440

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 441 FVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 475

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  196 bits (498), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 208/396 (52%), Gaps = 48/396 (12%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIG 193
           IN   F  PT IQ + IP I+  RD++G+++TGSGKT +++LP+I  +KA     S + G
Sbjct: 256 INDLKFENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQRHLASDESG 315

Query: 194 ARAVILSPSREIAMQTYKVFKEFS-KGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
              ++L+P+RE+A+Q  +   +F+ K   + SV  TGG  L++Q   +    ++VVATPG
Sbjct: 316 PLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGIEIVVATPG 375

Query: 253 RFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATL 308
           RF+ L + +N    L+ + + + + DEADRLF+MGF  Q+ +++ ++   +Q +LFSAT 
Sbjct: 376 RFIDL-LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQCVLFSATF 434

Query: 309 PNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
           PN L +FA   L  P+ + ++++S ++EN+   F     DE + N    +       L  
Sbjct: 435 PNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTLLRI-------LEK 487

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
            E+        +  +DSE+ D                              EKA I+FV 
Sbjct: 488 HEESSNGVPMQQDWNDSENKD------------------------------EKA-IIFVS 516

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
           ++   + +   L+  GY +  I+       R   L NF++   SIL+ T+V +RG+++P 
Sbjct: 517 SQQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLSRGLNVPE 576

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           ++ V+ +    +   +VH  GRTAR  + G A +++
Sbjct: 577 VSLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLL 612

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  196 bits (497), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 197/396 (49%), Gaps = 63/396 (15%)

Query: 139 NKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHS----SKIGA 194
           N+  F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP++ ++KA       + G 
Sbjct: 262 NELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVRQIKAQPPLAPDETGP 321

Query: 195 RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRF 254
             +IL+P+RE+A+Q  +   +F KGS + S+   GG  L+ Q   +    D++VATPGRF
Sbjct: 322 IGLILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINELKRGVDIIVATPGRF 381

Query: 255 LHLKVEMNLNLKS---VEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           + L    + +L S   + + V DEADRLF++GF  Q+N+++  +   +Q +LFSAT P+ 
Sbjct: 382 IDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIRPDKQCVLFSATFPSK 441

Query: 312 LVDFAKAGLTNPVLVRLDAESKISENLEM---LFVSTKHDEREANLFYLLQEVIKIPLAT 368
           L  FA   L NP+ + ++++S I+EN++    +F     DE      +LL+ +       
Sbjct: 442 LKHFASRTLKNPIQITINSKSLINENIQQRVQIF-----DEEHVKFEFLLKRL------- 489

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
              ++ L  G                                         ++ TI+FV 
Sbjct: 490 -SDRLALHRG----------------------------------------EDEKTIIFVG 508

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
           ++   + +   L   G     I+       R R L  F+     IL+ T+V +RG+++P 
Sbjct: 509 SQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEVLSRGLNVPE 568

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           ++ VI +    +   +VH VGRT R  N G A S V
Sbjct: 569 VSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  192 bits (489), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 200/407 (49%), Gaps = 74/407 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI----------- 182
           +L NI+   F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++           
Sbjct: 166 LLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQSFKNGPAPV 225

Query: 183 -EKLKAHSSKIG-ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
            E LK    + G   A++L+P+RE+A Q Y   K+F+  S +R V++ GG  +  Q   +
Sbjct: 226 PEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGSDVGTQIREL 285

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL--ASLPE- 297
               D++VATPGR   L     ++L +V+Y V DEADR+ +MGF  Q+  ++    +P+ 
Sbjct: 286 ERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHIVDGCDMPDA 345

Query: 298 -KRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
             RQTL+FSAT P+ +   A+  L + + + +      SEN+    +  +  ++++ L  
Sbjct: 346 NNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVEDMDKKSALLD 405

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
           L        LA E   + L                                         
Sbjct: 406 L--------LAAENDGLTL----------------------------------------- 416

Query: 417 LPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
                   +FV T+   + ++  L    ++ + I+G   Q  R R L  F+ G  ++LV 
Sbjct: 417 --------IFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRANVLVA 468

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSI 523
           T VAARG+DIP + +VIN+ +P+    +VHR+GRT RAGN G A S 
Sbjct: 469 TAVAARGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  196 bits (498), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 218/403 (54%), Gaps = 51/403 (12%)

Query: 134 ILNNINKK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSS-- 190
           I+N I K+  + +PT IQ + IP I+  RD++G+++TGSGKT +++LPM+ ++KA  +  
Sbjct: 287 IMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLRQIKAQRTLS 346

Query: 191 --KIGARAVILSPSREIAMQTYKVFKEFSKGS-DLRSVLLTGGDSLEDQFGMMMSNPDVV 247
             + G   +IL+P+RE+A+Q  +  ++F+K    +R++  TGG  ++ Q   +    ++V
Sbjct: 347 KNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQINDLKRGVEIV 406

Query: 248 VATPGRFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLL 303
           VATPGR + + + +N    ++ K + + V DEADRLF+MGF  Q+ +++ ++   +Q +L
Sbjct: 407 VATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKTVRPDKQCVL 465

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENL-EMLFVSTKHDEREANLFYLLQEVI 362
           FSAT PN L  FA   LT+P+ V +++ + ++EN+ +  ++    +++   L  +L    
Sbjct: 466 FSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNRLVNILDGFY 525

Query: 363 KIPLATEEQKMILGEGNKAL-SDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEK 421
           K+              NK + S+SE+ +                         +E  S+K
Sbjct: 526 KV--------------NKNITSNSEERE------------------------IDEEVSDK 547

Query: 422 ATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
             I+FV ++   + +   L+  GY    I+       R   L  F+    SIL+ T+V +
Sbjct: 548 KIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLCTEVLS 607

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           RG+++P ++ VI +    +   +VH  GRTAR  ++G A +++
Sbjct: 608 RGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  196 bits (497), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/392 (30%), Positives = 212/392 (54%), Gaps = 48/392 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++KA       + G   +I
Sbjct: 276 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 199 LSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           L+P+RE+A+Q ++   +F++  + +RSV  TGG  ++ Q   +    ++VVATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    L+ K + + + DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQFVLFSATFPNKLR 454

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLF-VSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            FA   L +P+ + ++++  ++EN++  F +    DE+  NL  +L++  +  L  E Q 
Sbjct: 455 SFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQILRK--RNELLDEVQS 512

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
            + GE     SD E+ DA+                                I+FV ++  
Sbjct: 513 DVDGE----TSDLEEVDAK-------------------------------AIIFVSSQQI 537

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            ++IS+ L   G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ V
Sbjct: 538 CDFISKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEVLSRGLNVPEVSLV 597

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           I +    +   +VH  GRTAR    G A +++
Sbjct: 598 IIYNSVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score =  191 bits (485), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 198/407 (48%), Gaps = 73/407 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI-EKLKAHSS-- 190
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K   S  
Sbjct: 160 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQ 219

Query: 191 ----------KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
                     K    AVI++P+RE+A Q +   K+F+  S +++ ++ GG  + +Q   +
Sbjct: 220 PEAQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREI 279

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP---- 296
               D++VATPGR   L     ++L +V+Y V DEADR+ +MGF  Q+  ++        
Sbjct: 280 ERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPV 339

Query: 297 EKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
            +RQTL+FSAT P  +   A+  L++ + + +      SEN+    +  ++ ++++ L  
Sbjct: 340 GERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLD 399

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
           LL        AT +  + L                                         
Sbjct: 400 LLS-------ATTDDGLTL----------------------------------------- 411

Query: 417 LPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
                   +FV T+   + ++  L    +  + I+G   Q  R R L  FR+G  S+LV 
Sbjct: 412 --------IFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVA 463

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSI 523
           T VAARG+DIP + +VIN+ +PS    +VHR+GRT RAGN G A + 
Sbjct: 464 TAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAF 510

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  189 bits (481), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 198/395 (50%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 124 VLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++++AT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +          L +S  H          + +++++      
Sbjct: 304 EVKQLASDYLHDPIQVQIGS----------LELSASH---------TITQIVEV------ 338

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
                      L+D E  D                     L +A++    K  I F  T+
Sbjct: 339 -----------LTDFEKRD----------------RLAKHLETASQDQDSKIII-FASTK 370

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I+  L+  G+    I+G   Q+ R   L  FR+G + I+V TDVAARG+D+  + 
Sbjct: 371 RTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARGIDVKGIN 430

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG+ G A S  +
Sbjct: 431 YVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFT 465

>AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL078C (DBP3)
          Length = 535

 Score =  188 bits (477), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 124/388 (31%), Positives = 194/388 (50%), Gaps = 59/388 (15%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH-SSKIGARAVILSP 201
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L +  S+  G + +++SP
Sbjct: 143 FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINSLMSEKSTPRGVKCLVISP 202

Query: 202 SREIAMQTYKVFKEFSKGSDLRSVLLTGG---DSLEDQFGMMMSNPDVVVATPGRFLHLK 258
           +RE+A Q Y    + +    L    + GG   DS  +Q    +    VVVATPGR L L 
Sbjct: 203 TRELASQIYDNLVQLTDKVGLNCCCVYGGVQKDSQREQ----LKKAQVVVATPGRLLDLI 258

Query: 259 VEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLA-SLPEKRQTLLFSATLPNTLVDFAK 317
            E +  L  V+Y V DEADR+ E GF E +  ++  +  + RQTL+F+AT P  + + A 
Sbjct: 259 EEGSAKLAGVQYLVLDEADRMLEKGFEEDIKRIIKETKSDVRQTLMFTATWPKEVRELAS 318

Query: 318 AGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGE 377
             +  PV V +                   DE  AN    + +V+++    +++K +L  
Sbjct: 319 TFMRAPVKVSIG----------------NRDELSAN--KRITQVVEVIDPFKKEKRLLEL 360

Query: 378 GNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYIS 437
             +  S ++ +D                                  ++F   +     + 
Sbjct: 361 LKQYQSGAKKNDK--------------------------------VLIFALYKKEASRVE 388

Query: 438 QLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTM 497
           + LK  GY V+ I+G L Q  R + L  F+AG  ++L+ TDVAARG+DIP +  VIN T 
Sbjct: 389 RNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTANLLLATDVAARGLDIPNVKTVINLTF 448

Query: 498 PSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           P + + +VHR+GRT RAG  G A+++ +
Sbjct: 449 PLTVEDYVHRIGRTGRAGATGVAHTLFT 476

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  193 bits (491), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/393 (30%), Positives = 210/393 (53%), Gaps = 50/393 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSS----KIGARAVI 198
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++KA  S    + G   +I
Sbjct: 274 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRSLSKHETGPLGLI 333

Query: 199 LSPSREIAMQTYKVFKEFSKGSD--LRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLH 256
           L+P+RE+A+Q ++   +F+ G+D  +RSV  TGG  ++ Q   +    ++VVATPGRF+ 
Sbjct: 334 LAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFID 392

Query: 257 LKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           + + +N    L+ K + + + DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L
Sbjct: 393 I-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKL 451

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLF-VSTKHDEREANLFYLLQEVIKIPLATEEQ 371
             FA   L +P+ + ++++  ++EN++  F +    DE+  NL  +     K     E Q
Sbjct: 452 RSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFENLIQIAHGGNK--FFDEGQ 509

Query: 372 KMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRH 431
             I GE     SD +++DA+                                I+FV ++ 
Sbjct: 510 TEIDGE----TSDLDETDAK-------------------------------AIIFVSSQQ 534

Query: 432 HVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLAN 491
             + IS+ L   G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ 
Sbjct: 535 ICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSL 594

Query: 492 VINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           VI +    +   +VH  GRTAR    G A +++
Sbjct: 595 VIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  184 bits (468), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 182/393 (46%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K     S  G   V+L+P+RE
Sbjct: 29  QPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAPMLTKWSEDPS--GMFGVVLTPTRE 86

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  L+ GG+S+ DQ   +   P  ++ATPGR  H  +    +
Sbjct: 87  LAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQLQKKPHFIIATPGRLAHHIMSSGED 146

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKA 318
               LK  ++ V DEAD L    FA  L   + +LP  +KRQTLLF+AT+ + +     A
Sbjct: 147 TIGGLKRAKFLVLDEADSLLTDTFASDLATCIGALPSKDKRQTLLFTATITDQVRALEDA 206

Query: 319 GLT--NPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            +    P L     ES     I   L+  ++      +EA L+ L        L  E  K
Sbjct: 207 PIQEGKPPLFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQL--------LTCETYK 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                         DS A                                 I+FV     
Sbjct: 259 --------------DSSA---------------------------------IIFVNRTMT 271

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + L      V+ ++  + Q  R   L+ FRA +  +L+ TDVA+RG+DIP +  V
Sbjct: 272 AEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDVASRGLDIPTVELV 331

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           IN+ +P+    F+HR GRTARAG  G A S V+
Sbjct: 332 INYDIPADPDTFIHRAGRTARAGRSGDAISFVT 364

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  187 bits (476), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 193/395 (48%), Gaps = 56/395 (14%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A      
Sbjct: 149 VLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLGP 208

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F K S +R+  + GG     Q   +    ++ +AT
Sbjct: 209 GDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLQRGAEICIAT 268

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 269 PGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 328

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L + + V          N+  L ++  H+         + +VI++    ++
Sbjct: 329 EVQQLAQDYLHDYIQV----------NVGSLELAASHN---------ITQVIEVVSDFDK 369

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  ++     A  D+E                                     +VF  T+
Sbjct: 370 RDRLVKHMEVASQDAESK----------------------------------ILVFASTK 395

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G   Q  R   L  FR+G + I+V TDVAARG+D+  + 
Sbjct: 396 RMCDEITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAARGIDVKGIN 455

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ MP + + +VHR+GRT RAG  G A S  S
Sbjct: 456 FVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFS 490

>Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa]
           {ON} complement(104203..105795) [1593 nt, 531 aa]
          Length = 530

 Score =  186 bits (473), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/388 (31%), Positives = 188/388 (48%), Gaps = 56/388 (14%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSS----KIGARAVI 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  +   S     K G + +I
Sbjct: 135 FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINNILTKSGSKPGKNGIQVLI 194

Query: 199 LSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLK 258
           +SP+RE+A Q Y      +    L    + GG   ++Q    +    VVVATPGR L L 
Sbjct: 195 ISPTRELASQIYDNLVILTDKVGLECCCVYGGVPKDEQ-RTQLKRSQVVVATPGRLLDLI 253

Query: 259 VEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL-ASLPEKRQTLLFSATLPNTLVDFAK 317
            E   NL +V Y V DEADR+ E GF E +  ++  +    RQTL+F+AT P  + + A 
Sbjct: 254 QEGAANLSNVNYLVLDEADRMLEKGFEEDIKNIIRETKSTGRQTLMFTATWPKEVRELAS 313

Query: 318 AGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGE 377
             + +P+ V +                   DE  AN    + +++++    ++++ +L  
Sbjct: 314 TFMNSPIKVSIG----------------NTDELSAN--KRITQIVEVIDPFKKERKLLEL 355

Query: 378 GNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYIS 437
             K  S S+  D                                  ++F   +     + 
Sbjct: 356 LKKYQSGSKKDDK--------------------------------VLIFALYKKEAARVE 383

Query: 438 QLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTM 497
           + L   GY VS I+G L Q  R   L  F+ G +SIL+ TDVAARG+DIP +  VIN T 
Sbjct: 384 RNLNYNGYKVSAIHGDLSQQQRTNALDEFKTGRSSILLATDVAARGLDIPNVKTVINLTF 443

Query: 498 PSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           P + + +VHR+GRT RAG  G A+++ +
Sbjct: 444 PLTVEDYVHRIGRTGRAGKTGTAHTLFT 471

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  183 bits (465), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 184/393 (46%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K     S  G   V+L+P+RE
Sbjct: 24  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPS--GMFGVVLTPTRE 81

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG+S+  Q   +   P  ++ATPGR  H  +    +
Sbjct: 82  LAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKPHFIIATPGRLAHHIMSSGDD 141

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKA 318
               L   +Y V DEAD L    FA+ L   +++LP  +KRQTLLF+AT+ + +     A
Sbjct: 142 TVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDKRQTLLFTATITDQVKSLQNA 201

Query: 319 GLTN--PVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            +    P L     ES     I   L++ ++      +EA L+ L        L  EE  
Sbjct: 202 PVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEAYLYQL--------LTCEEY- 252

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                             EN                            K  I+FV     
Sbjct: 253 ------------------EN----------------------------KTAIIFVNRTMT 266

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L+ FRA    IL+ TDVA+RG+DIP +  V
Sbjct: 267 AEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIATDVASRGLDIPTVELV 326

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ +PS   +F+HR GRTARAG  G A S V+
Sbjct: 327 VNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  190 bits (482), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 206/401 (51%), Gaps = 59/401 (14%)

Query: 134 ILNNINKK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKA----H 188
           I++ I K+  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ ++KA     
Sbjct: 243 IMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLRQIKALRPLT 302

Query: 189 SSKIGARAVILSPSREIAMQTYKVFKEF-SKGSDLRSVLLTGGDSLEDQFGMMMSNPDVV 247
           S + G   +IL+P+RE+A+Q ++  ++F +  S LRS+  TGG  L+ Q   +    ++V
Sbjct: 303 SGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIKELKKGVEIV 362

Query: 248 VATPGRFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLL 303
           VATPGRF+ L + +N    LN + V + V DEADRLF++GF  Q+ E++ ++   +Q +L
Sbjct: 363 VATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKTIRPDKQCVL 421

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           FSAT P  L  FA   L  P+ + ++++S I+EN+E       +D  E+    LL     
Sbjct: 422 FSATFPTKLKSFASRILDRPISITINSKSLINENIEQQL--RIYDNDESKFEGLLD---- 475

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
                     IL +  +  SD E                                 ++  
Sbjct: 476 ----------ILRKQTQMSSDDE--------------------------------RDEKI 493

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           IVF+ ++   + I   L+   Y    I+     + R   L  F+     IL+ T+V +RG
Sbjct: 494 IVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCTEVLSRG 553

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +++P ++ VI +    +   +VH  GRTAR    G A +++
Sbjct: 554 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON}
           complement(10370..11665) [1296 nt, 432 aa]
          Length = 431

 Score =  182 bits (462), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 190/404 (47%), Gaps = 69/404 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           ++ ++N      PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ +     S  G
Sbjct: 13  LVESLNAMRITHPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLSQWSDDPS--G 70

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              V+L+P+RE+A+Q  + F       ++R  L+ GG+S+  Q   +   P  ++ATPGR
Sbjct: 71  MFGVVLTPTRELAIQIAEQFTALGSSMNIRVCLVVGGESIVKQALELQKKPHFIIATPGR 130

Query: 254 FLHLKV----EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSAT 307
             H  +    E+   L  V+Y V DEAD +    FA  L+  +A LP  +KRQTLLF+AT
Sbjct: 131 LAHHILSSGEEVVGGLSRVKYLVLDEADLILTQTFAADLSTCIAKLPPKQKRQTLLFTAT 190

Query: 308 LPNTL--VDFAKAGLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEV 361
           + + +  +  A A  + P L   + E+     +   L++ ++      +EA L+ LL   
Sbjct: 191 ITDQVRALQNAPAQDSKPPLFAYEVENVDNVAVPSTLKLEYLLVPEHVKEAYLYQLL--- 247

Query: 362 IKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEK 421
                                 D +DS                                 
Sbjct: 248 -------------------TCEDYKDS--------------------------------- 255

Query: 422 ATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           + IVFV      E + + L++    V+ ++  + Q  R   L  FRA    +L+ TDVAA
Sbjct: 256 SVIVFVNRTTAAEVLRRTLRSLEVRVASLHSQMPQSERINSLQRFRANAARVLIATDVAA 315

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           RG+DIP +  VIN+ +P     F+HR GRTARAG  G A S V+
Sbjct: 316 RGLDIPTVELVINYDIPQDPDTFIHRSGRTARAGRSGDAISFVT 359

>Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  182 bits (462), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 180/393 (45%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQR  IP IL+ RD +G A+TGSGKT AF  PM+ K        G   V+L+P+RE
Sbjct: 30  QPTAIQRACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWS--EDPCGMFGVVLTPTRE 87

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG+S+  Q   +   P  ++ATPGR  H  +    +
Sbjct: 88  LAMQIAEQFTALGSSMNIRVSVVVGGESIVQQALDLQRKPHFIIATPGRLAHHIMSSGDD 147

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDF--A 316
               L   +Y V DEAD L    FA  L   + +LP  +KRQTLLF+AT+ + +     A
Sbjct: 148 TVGGLMRTKYLVLDEADILLTSTFAGHLATCIGALPPKDKRQTLLFTATITDQVRSLQDA 207

Query: 317 KAGLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            A    P L     ES     I   L+  ++      +EA L+ L        L  EE  
Sbjct: 208 PAQEAKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQL--------LTCEEY- 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                             EN                            K  I+FV     
Sbjct: 259 ------------------EN----------------------------KTAIIFVNRTMT 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L+ FRA    +L+ TDVA+RG+DIP +  V
Sbjct: 273 AEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELV 332

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ +PS   +F+HR GRTARAG  G A S V+
Sbjct: 333 VNYDIPSDPDVFIHRAGRTARAGRNGDAISFVT 365

>Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  182 bits (461), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 126/393 (32%), Positives = 181/393 (46%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K        G   V+L+P+RE
Sbjct: 30  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWS--EDPCGMFGVVLTPTRE 87

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG+S+  Q   +   P  ++ATPGR  H  +    +
Sbjct: 88  LAMQIAEQFTALGSSMNIRVSVVVGGESIIQQALALQRKPHFIIATPGRLAHHIMSSGED 147

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKA 318
               L   +Y V DEAD L    FA+ L   + +LP  +KRQTLLF+AT+ + +     A
Sbjct: 148 TVGGLMRAKYLVLDEADILLTSTFADHLATCIGALPAKDKRQTLLFTATITDQVRSLQDA 207

Query: 319 GLT--NPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            +    P L     ES     I   L+  ++      +EA L+ L        L  EE  
Sbjct: 208 PVQEGKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQL--------LTCEEY- 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                             EN                            K  I+FV     
Sbjct: 259 ------------------EN----------------------------KTAIIFVNRTMT 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L+ FRA    +L+ TDVA+RG+DIP +  V
Sbjct: 273 AEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELV 332

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ +PS   +F+HR GRTARAG  G A S V+
Sbjct: 333 VNYDIPSDPDVFIHRSGRTARAGRNGDAISFVT 365

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  186 bits (471), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 193/403 (47%), Gaps = 73/403 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI-EKLKA----- 187
           +L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ E  K      
Sbjct: 146 LLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTGPTAT 205

Query: 188 ------HSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMM 241
                 +  K    AV+++P+RE+A Q +   K+F   S ++  +  GG  + +Q   M 
Sbjct: 206 HDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAPIGNQMREMD 265

Query: 242 SNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP----E 297
              D++VATPGR   L     ++L +V+Y V DEADR+ +MGF  Q+  ++         
Sbjct: 266 RGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGADMTPVG 325

Query: 298 KRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYL 357
           +RQTL+FSAT P  +   A+  L + + + +      SEN+    +  ++ ++++ L  L
Sbjct: 326 ERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKKSALLDL 385

Query: 358 LQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANEL 417
                                   LS SED                              
Sbjct: 386 ------------------------LSASEDG----------------------------- 392

Query: 418 PSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVT 477
                T++FV T+   + ++  L    +  + I+G   Q  R R L  F++G  ++LV T
Sbjct: 393 ----LTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAATLLVAT 448

Query: 478 DVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
            VAARG+DIP + +VIN+ +P     +VHR+GRT RAGN G A
Sbjct: 449 AVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIA 491

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  189 bits (480), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 120/392 (30%), Positives = 200/392 (51%), Gaps = 50/392 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHS----SKIGARAVI 198
           F  PTPIQ + IP I+  +DI+G+++TGSGKT A++LP++  ++A      ++ G  A++
Sbjct: 310 FETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLLRHVRAQKPLSRNETGPIALV 369

Query: 199 LSPSREIAMQTYKVFKEFSKGSD--LRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL- 255
           L+P+RE+A+Q       F    +  L S+   GG  L  Q  ++     ++VATPGR++ 
Sbjct: 370 LAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQINIIKKGVSIIVATPGRYID 429

Query: 256 --HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
              L     LN K + + V DEADRLF++GF  Q+++++ ++   +  +LFSAT P  L 
Sbjct: 430 LLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMKTIRPDKHGVLFSATFPKKLR 489

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHD-EREANLFYLLQEVIKIPLATEEQK 372
            FA   L +P+ + +D+E+ I+EN+E  F   K D E+  NL  +L +            
Sbjct: 490 SFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFNNLLDILNK------------ 537

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                      + + S + +G                    +NE  ++K  I+FV ++  
Sbjct: 538 -------HDYENIQSSASRDGI-------------------SNE--NDKKIIIFVSSQQI 569

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E I   L+  G+    I+     + R + L NFR    SIL+ T+V +RG+++P  + V
Sbjct: 570 SELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILLCTEVLSRGLNVPETSLV 629

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           I +    +   +VH  GRT R   RG A S++
Sbjct: 630 IIYNAVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  181 bits (459), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 180/393 (45%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K        G   V+L+P+RE
Sbjct: 30  QPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWS--EDPCGMFGVVLTPTRE 87

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG+S+  Q   +   P  ++ATPGR  H  +    +
Sbjct: 88  LAMQIAEQFTALGSNMNIRVSVVVGGESIVKQALDLQRKPHFIIATPGRLAHHIMSSGED 147

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKA 318
               L   +Y V DEAD L    FA  L   + +LP  +KRQTLLF+AT+ + +     A
Sbjct: 148 TVGGLMRAKYLVLDEADILLTSTFANHLATCIGALPPKDKRQTLLFTATITDQVRSLQDA 207

Query: 319 GL--TNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            +    P L     ES     I   L+  ++      +EA L+ L        L  EE  
Sbjct: 208 PVQGNKPPLFAYQVESVDDVAIPSTLKTEYILVPEHVKEAYLYQL--------LTCEEY- 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                             EN                            K  IVFV     
Sbjct: 259 ------------------EN----------------------------KTAIVFVNRTMS 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L+ FRA    +L+ TDVA+RG+DIP +  V
Sbjct: 273 AEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELV 332

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ +PS   +F+HR GRTARAG  G A S V+
Sbjct: 333 VNYDIPSDPDVFIHRSGRTARAGRDGDAISFVT 365

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 196/402 (48%), Gaps = 74/402 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI-EKLKAHSSKI 192
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E      S+I
Sbjct: 151 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFSTGPSEI 210

Query: 193 --GAR----------AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
              AR          AV+L+P+RE+A Q +   K+F+  S +R+ ++ GG  +  Q   +
Sbjct: 211 PENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGADVGSQMREL 270

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL--ASLP-- 296
               D++VATPGR   L     ++L  V+Y V DEADR+ +MGF  Q+  ++    +P  
Sbjct: 271 DRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHIVEGCDMPGV 330

Query: 297 EKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
           E RQTL+FSAT P  +   A+  L++ + + +      SEN+    +  + +++++ L  
Sbjct: 331 EDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVEDEDKKSALLD 390

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
           L+        AT+   +I  E                                       
Sbjct: 391 LISS------ATDGLTLIFVE--------------------------------------- 405

Query: 417 LPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
                       T+   + ++  L    +  + I+G   Q  R R L  FR+G  ++LV 
Sbjct: 406 ------------TKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGKANLLVA 453

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           T VAARG+DIP + +VIN+ +PS    +VHR+GRT RAGN G
Sbjct: 454 TAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/420 (29%), Positives = 208/420 (49%), Gaps = 83/420 (19%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL-------- 185
           ++ NI    F +PTPIQ+ +IP++ Q RD++  A+TGSGKT AF+ P++ K         
Sbjct: 368 LVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSKAFSLGPSIN 427

Query: 186 ----------------KAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTG 229
                           K  +  I    +IL+P+RE+A Q ++  ++FS  S +R  ++ G
Sbjct: 428 NNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRSWIRPCVVYG 487

Query: 230 GDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLN 289
           G ++  Q   + +   ++VATPGR   L     ++L +++Y + DEADR+ +MGF  Q+ 
Sbjct: 488 GTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRMLDMGFELQIR 547

Query: 290 ELLAS----LPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST 345
           +++      +   RQTL+FSAT P+ + + A   L + + + +      ++N+       
Sbjct: 548 QIVEHYDMPIATSRQTLMFSATFPSNIQNLAGDFLNDYIFLSVGKIGSTTDNI------I 601

Query: 346 KHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXX 405
           +H      ++Y+ QE        E+   +L      L DS++                  
Sbjct: 602 QH------IYYVRQE--------EKDNTLLD-----LLDSKNY----------------- 625

Query: 406 XXXXXLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYN 465
                         +K T++FV T+   + ++ LL   GY  + I+G   Q  R R L  
Sbjct: 626 -------------KKKQTLIFVETKRSADALTDLLIIEGYKATAIHGDRTQLERERALTA 672

Query: 466 FRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           F+    ++LV T VAARG+DIP +A+V+N+ +P++   +VHR+GRT R GN G A S  +
Sbjct: 673 FKTKRANVLVATSVAARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIGMATSFFN 732

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  181 bits (459), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 125/399 (31%), Positives = 200/399 (50%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I+K GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE L  HS K   
Sbjct: 46  LKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKFKP 103

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 104 RNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNILIAT 163

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 164 PGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 223

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + + +E  S  ++ LE  +V  + D+R   LF  L+      
Sbjct: 224 TTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLLFSFLKR----- 278

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 279 --NQKKKIIV----------------------------------FLSSCNS--------- 293

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 294 -------VKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLD 346

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 347 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  179 bits (455), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 128/393 (32%), Positives = 181/393 (46%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ   IP IL+ RD +G A+TGSGKT AF  PM+ K        G   V+L+P+RE
Sbjct: 29  QPTAIQSACIPEILKGRDCIGGAKTGSGKTIAFAGPMLTKWS--EDPCGMFGVVLTPTRE 86

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG S+ +Q   + + P  ++ATPGR  H  +    +
Sbjct: 87  LAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQAIQLQNKPHFIIATPGRLAHHIMNSGED 146

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTL--VDFA 316
               LK  ++ V DEAD L    FA  L   + +LP   KRQTLLF+AT+ + +  ++ A
Sbjct: 147 TVGGLKRTKFLVLDEADSLLTDSFAGDLATCIGALPPKHKRQTLLFTATITDQVRTLENA 206

Query: 317 KAGLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            A    P +     ES     I   L+  ++      +EA L+ L        L  E  K
Sbjct: 207 PAQDGKPSVFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQL--------LTCETYK 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                         DS A                                 I+FV     
Sbjct: 259 --------------DSSA---------------------------------IIFVNRAMT 271

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + L      V+ ++  + Q  R   L+ FRA    +LV TDVAARG+DIP++  V
Sbjct: 272 AEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDVAARGLDIPIVELV 331

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           IN+ +PS    F+HR GRTARAG  G A S V+
Sbjct: 332 INYDIPSDPDTFIHRAGRTARAGRSGDAISFVT 364

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  187 bits (474), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 204/391 (52%), Gaps = 47/391 (12%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+I  +KA     +S+ G   +I
Sbjct: 302 YDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIRHVKAQRPLSNSETGPLGLI 361

Query: 199 LSPSREIAMQTYKVFKEFSKGS-DLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           ++P+RE+A+Q  +  ++F K    +RS+  TGG  L++Q        ++VVATPGRF+ L
Sbjct: 362 IAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIYEFKRGIEIVVATPGRFIDL 421

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    LN K +   + DEADRLF+MGF  Q+ +++ ++   +Q +LFSAT P  L 
Sbjct: 422 -LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPIKLQ 480

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
            F K  L NP+ + +D+++ ++EN+   F    +D  +   F+ L E++   +   E   
Sbjct: 481 AFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEK---FFKLIEILDNFVEKRES-- 535

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
                    S S+ S+                          +   +K  I+FV ++   
Sbjct: 536 ---------SQSKGSE-----------------------QVEDEIIDKKIIIFVSSQQTC 563

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
           + ++  L+   Y V  I+       R   L  F+    SIL+ T+V +RG+++P ++ VI
Sbjct: 564 DAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTEVLSRGLNVPEVSLVI 623

Query: 494 NFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            +   +    +VH  GRTAR   RG A +++
Sbjct: 624 IYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  179 bits (453), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 189/393 (48%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT IQ+  IP I++  D +G A+TGSGKT AF  PM+ K     S  G   V+L+P+RE
Sbjct: 29  QPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAFAAPMLTKWSEDPS--GMFGVVLTPTRE 86

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  ++ GG+S+  Q   +   P  ++ATPGR  H  +    +
Sbjct: 87  LAMQIAEQFTALGSSMNIRVSIVVGGESIVKQALELQRKPHFIIATPGRLAHHILNSGED 146

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTL--VDFA 316
               L   ++ V DEAD L    FA+ LN  +++LP  +KRQTLLF+AT+ + +  +  A
Sbjct: 147 TVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVSALPPKDKRQTLLFTATITDQVRALQDA 206

Query: 317 KAGLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            +    P L   + E+     +   L+  ++      +EA L++L        L +EE K
Sbjct: 207 PSQENKPPLYCYEVENVDNVAVPSTLKTEYILIPEYVKEAYLYHL--------LTSEEYK 258

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                         DS A                                 I+FV     
Sbjct: 259 --------------DSSA---------------------------------IIFVNRTMT 271

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L  FRA    +L+ TDVA+RG+DIP++  V
Sbjct: 272 AEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIATDVASRGLDIPVVELV 331

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ +PS   +++HR GRTARAG RG A S ++
Sbjct: 332 VNYDIPSDPDVYIHRSGRTARAGRRGDAISFIT 364

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  179 bits (455), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 199/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           +  I K GF Q T +Q +TIP +L  +D++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 46  MKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 103

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 104 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMKGVNILIAT 163

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 164 PGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 223

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +D+E  +  ++ LE  +V  + D+R   LF  L+      
Sbjct: 224 TTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFLLLFSFLKR----- 278

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 279 --NQKKKVIV----------------------------------FLSSCNS--------- 293

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 294 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLD 346

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 347 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa]
           {ON} Anc_5.69 YHR169W
          Length = 393

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/390 (31%), Positives = 185/390 (47%), Gaps = 65/390 (16%)

Query: 146 PTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREI 205
           PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K        G  AVIL+P+RE+
Sbjct: 29  PTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLTKWS--EDPCGMFAVILTPTREL 86

Query: 206 AMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN- 264
           AMQ  + F       ++R  L+ GG+++  Q   + + P  ++ATPGR  H  +    + 
Sbjct: 87  AMQIAEQFTALGSSMNIRVCLVVGGENIVKQALELQNKPHFIIATPGRLAHHILRSGEDT 146

Query: 265 ---LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKAG 319
                  +Y V DEAD L    F++ L+  +  LP  EKRQTLLF+AT            
Sbjct: 147 VGGFIRCKYLVLDEADILLTSTFSKDLSVCIGKLPPKEKRQTLLFTAT------------ 194

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT---EEQKMILG 376
                         I++ +++L  + KHD R     Y ++ + K+ + +    E  ++ G
Sbjct: 195 --------------ITDQVKVLQDAPKHDGRLPLFSYQVESIDKVAIPSTLKTEYVLVPG 240

Query: 377 EGNKA-LSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEY 435
              +A L      +A N                           E + IVFV      E 
Sbjct: 241 HVKEAYLYHLLTCEAYN---------------------------ESSAIVFVNRTVTAEI 273

Query: 436 ISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINF 495
           + + L      V+ ++  + Q  R   L+ FRA    +L+ TDVA+RG+DIP +  VIN+
Sbjct: 274 LRRTLYDLEVRVTSLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVELVINY 333

Query: 496 TMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            +P+    F+HR GRTARAG  G A S V+
Sbjct: 334 DLPADPDTFIHRSGRTARAGRTGDAISFVT 363

>ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly
           similar to uniprot|P38719 Saccharomyces cerevisiae
           YHR169W DBP8 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in biogenesis of the 40S
           ribosomal subunit
          Length = 435

 Score =  177 bits (449), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 184/403 (45%), Gaps = 68/403 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           ++  +N     QPT IQ   IP IL+ RD +G A+TGSGKT AF  PM+ K        G
Sbjct: 18  LVETLNAMKISQPTTIQSACIPEILKGRDCIGGAKTGSGKTIAFGAPMLTKWS--EDPCG 75

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              V+L+P+RE+AMQ  + F       ++R  ++ GG+ +  Q   +   P  ++ATPGR
Sbjct: 76  MFGVVLTPTRELAMQIAEQFTALGSNMNIRVSIIVGGEDIVKQGLELQRKPHFIIATPGR 135

Query: 254 FLHLKVEMNLN----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSAT 307
             H  +    +    L   ++ V DEAD L    FA+ L   + +LP   KRQTLLF+AT
Sbjct: 136 LAHHILNSGDDTVGGLIRTKFLVLDEADSLLTGTFAKDLAICIGALPPKNKRQTLLFTAT 195

Query: 308 LPNTLVDFAKA-GLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVI 362
           + + +     A     P L   +  S     I  +L+  ++      +EA L+ LL    
Sbjct: 196 VTDQVRALENAPSEGKPPLFTYEVASMDKVAIPSSLKTEYILVPEYVKEAYLYQLL---- 251

Query: 363 KIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKA 422
                                D +DS A                                
Sbjct: 252 ------------------TCEDYKDSTA-------------------------------- 261

Query: 423 TIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
            +VFV      E + + L A G  V+ ++  + Q  R   L+ FRA    +L+ TDVA+R
Sbjct: 262 -MVFVNRTMAAEILRRTLYAMGVRVTSLHSQMPQQERTNSLHRFRANAARVLIATDVASR 320

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           G+DIP +  V+N+ +PS   +F+HR GRTARAG RG A S ++
Sbjct: 321 GLDIPTVQLVVNYDIPSDPDVFIHRSGRTARAGRRGDAISFIT 363

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  177 bits (449), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/418 (29%), Positives = 189/418 (45%), Gaps = 69/418 (16%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAV 197
           +N     QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ K  A     G   +
Sbjct: 21  LNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLTKWSA--DPCGMFGI 78

Query: 198 ILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           +L+P+RE+AMQ  + F       ++R  L+ GG+ +  Q   +   P  ++ATPGR  H 
Sbjct: 79  VLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRKPHFIIATPGRLAHH 138

Query: 258 KVEMNLN----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNT 311
            +    +    LK V Y V DEAD L    F++ L   +  LP  EKRQ LLF+AT+ + 
Sbjct: 139 IMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKEKRQNLLFTATMTDQ 198

Query: 312 LVDFAKAGLTN--PVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
           ++    A  T+  P L     E+     +  +L+  ++      +EA L+ +        
Sbjct: 199 VLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKEAYLYQV-------- 250

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
           L++EE K                                                K+ IV
Sbjct: 251 LSSEEYK-----------------------------------------------SKSAIV 263

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
           FV      E + ++L      V+ ++  + Q  R   L  FRA    +L+ TDVA+RG+D
Sbjct: 264 FVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVLIATDVASRGLD 323

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGKKI 543
           IP +  V+N+ +P++   ++HR GRTARAG  G A S ++              GKK+
Sbjct: 324 IPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQAIEERIGKKM 381

>SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  177 bits (448), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 187/409 (45%), Gaps = 79/409 (19%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           ++  +N     QPT IQR  IP IL  RD +G A+TGSGKT AF  PM+       S  G
Sbjct: 17  LVEALNAMKITQPTAIQRTCIPEILGGRDCIGGAKTGSGKTIAFAAPMLTSWSEDPS--G 74

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              VIL+P+RE+AMQ  + F       +++  L+ GG+S+  Q   +   P  +VATPGR
Sbjct: 75  MFGVILTPTRELAMQIAEQFTALGSSMNIKVALVVGGESIVQQAIELQKKPHFIVATPGR 134

Query: 254 FLHLKVEMNLN----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSAT 307
             H  +    +    L+ V+Y V DEAD L    F+E L   ++ LP   KRQ LLF+A 
Sbjct: 135 LAHHIMNSGDDTIGGLRRVKYLVLDEADILLTNTFSEDLATCVSILPPKNKRQNLLFTA- 193

Query: 308 LPNTLVDFAKAGLTN-------PVLVRLDAES----KISENLEMLFVSTKHDEREANLFY 356
              T+ D  KA L N       P +     ES     I   L+  ++      +EA L+ 
Sbjct: 194 ---TMTDQVKA-LQNAPNQEGKPPVFSYQVESVDKLAIPSTLKTEYLLVPEHVKEAYLYQ 249

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
           +L         T E             D E+S A                          
Sbjct: 250 IL---------TSE-------------DYENSSA-------------------------- 261

Query: 417 LPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
                  I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    +L+ 
Sbjct: 262 -------IIFVNRTVTAEILRRTLKGLDVRVASLHSQMPQQERTNSLHRFRANAARVLIA 314

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           TDVA+RG+DIP +A V+N+ +P++   F+HR GRTARAG  G +   V+
Sbjct: 315 TDVASRGLDIPSVALVVNYDIPANPDTFIHRAGRTARAGRSGESICFVT 363

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  178 bits (452), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 193/388 (49%), Gaps = 68/388 (17%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI----G 193
           I K GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE L  HS K     G
Sbjct: 44  IEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPTIELL--HSLKFKPRNG 101

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              +I++P+RE+A+Q + V +E  +       ++ GG +   +   +M   +++VATPGR
Sbjct: 102 TGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNLLVATPGR 161

Query: 254 FL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNT 311
            L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT    
Sbjct: 162 LLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTK 221

Query: 312 LVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
           + D ++  L   P+ + + +E  S  ++ LE  +V  + D+R   LF  L+         
Sbjct: 222 VEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVVCESDKRFLLLFSFLKR-------N 274

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
           +++K+I+                                   L S N             
Sbjct: 275 QKKKIIV----------------------------------FLSSCNS------------ 288

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
               V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+DIP 
Sbjct: 289 ----VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPA 344

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGN 516
           +  +I F  P   + ++HRVGRTAR  N
Sbjct: 345 VDWIIQFDPPDDPRDYIHRVGRTARGTN 372

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 195/407 (47%), Gaps = 74/407 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI-EKLK------ 186
           +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K      
Sbjct: 149 LLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNGPTPL 208

Query: 187 ------AHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
                  +  K    AVI++P+RE+  Q +   K+F+  S ++  ++ GG  + +Q   M
Sbjct: 209 PENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQMREM 268

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP---- 296
               D++VATPGR   L     ++L +V+Y V DEADR+ +MGF  Q+  ++        
Sbjct: 269 DRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCDMTPV 328

Query: 297 EKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
            +RQTL+FSAT P  +   A+  L++ + + +      SEN+    +  + +++++ L  
Sbjct: 329 GERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKSALLD 388

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
           LL        A++E   ++    K L+D                                
Sbjct: 389 LLA-------ASDEGLTLIFVETKRLADQ------------------------------- 410

Query: 417 LPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
                              ++  L    +  + I+G   Q  R R L  FR+G  ++LV 
Sbjct: 411 -------------------LTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLLVA 451

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSI 523
           T VAARG+DIP + +VINF +PS    +VHR+GRT RAGN G A + 
Sbjct: 452 TAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATAF 498

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  183 bits (465), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/402 (28%), Positives = 212/402 (52%), Gaps = 53/402 (13%)

Query: 134 ILNNI-NKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---- 188
           I+N+I N   F++ TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K+     
Sbjct: 269 IMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKSQRDLS 328

Query: 189 SSKIGARAVILSPSREIAMQTYK-VFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVV 247
           +S+ G   ++L+P+RE+A+Q ++ + K  +  + L  +  TGG  L+DQ   +     +V
Sbjct: 329 NSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQISSVKRGVKIV 388

Query: 248 VATPGRFLHLKVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLL 303
           VATPGRF+ L + +N    L+   + + V DEADRLF+MGF  Q+ +++ ++   +Q +L
Sbjct: 389 VATPGRFIDL-LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKAIRPDKQCVL 447

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREAN-LFYLLQEVI 362
           FSAT  N +  FA   L NP+ + +++ + ++EN+   F   + D ++ + L  LL+E  
Sbjct: 448 FSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDELISLLKE-- 505

Query: 363 KIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKA 422
                         + ++A    E+SD                              +  
Sbjct: 506 ------------RNDKHEAQEGFEESDN---------------------------LQDNK 526

Query: 423 TIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
           TI+FV ++   + +   L + G+ +  I+       R   L  +R    S+L+ T+V +R
Sbjct: 527 TIIFVASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLCTEVLSR 586

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           G+++P ++ VI +    +   ++H  GRTAR  ++G A S +
Sbjct: 587 GLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  176 bits (446), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 181/393 (46%), Gaps = 69/393 (17%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
            PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ K     S  G   V+L+P+RE
Sbjct: 25  HPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLTKWSEDPS--GMFGVVLTPTRE 82

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       ++R  L+ GG+S+ DQ   +   P  ++ATPGR  H  +    +
Sbjct: 83  LAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRKPHFIIATPGRLAHHVMNSGED 142

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNT--LVDFA 316
               LK V++ V DEAD L    F E L   +  LP  E+RQ LLF+AT+ +   ++  A
Sbjct: 143 TIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKERRQNLLFTATVTDQVKMLQNA 202

Query: 317 KAGLTNPVLVRLDAES----KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
            A    P L   + ES     I   L+  ++      +EA L+ +L     I        
Sbjct: 203 PATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKEAYLYQILTSAAYI-------- 254

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                         DS A                                 I+FV     
Sbjct: 255 --------------DSSA---------------------------------IIFVNRTVT 267

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
            E + + LK     V+ ++  + Q  R   L+ FRA    +L+ TDVA+RG+DIP +  V
Sbjct: 268 AEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLV 327

Query: 493 INFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +N+ + ++   F+HR GRTARAG +G +   V+
Sbjct: 328 VNYDISANPDTFIHRAGRTARAGRKGESICFVA 360

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  179 bits (453), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 127/400 (31%), Positives = 198/400 (49%), Gaps = 74/400 (18%)

Query: 139 NKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKA-----HSSKI- 192
           +K  +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + +L         +K+ 
Sbjct: 185 SKLKYREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKLPPLNDITKLD 244

Query: 193 GARAVILSPSREIAMQ----TYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVV 248
           G   +IL+P+RE+A Q      KV   +S+ + + S++  GG S+E+    +    D++V
Sbjct: 245 GPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISYSLSDGCDILV 302

Query: 249 ATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPE--KRQTLLFSA 306
           ATPGR +       L LK V   V DEADR+ + GF +QL  +LA       RQT++F+A
Sbjct: 303 ATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESVSGRQTMMFTA 362

Query: 307 TLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPL 366
           T+ NT+   A   LT P                  +V    D+ +A +  +++      L
Sbjct: 363 TMSNTVEKIANGYLTKPA-----------------YVRVGSDDTKAQIKQIVEY-----L 400

Query: 367 ATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATI-V 425
            +EEQ+       K   D                                LP  +A I +
Sbjct: 401 PSEEQRF-----QKMARDI-------------------------------LPKFRAPIMI 424

Query: 426 FVPTRHHVEY-ISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
           F+  +   ++ +S+      + V+ ++G+  Q  R   L   R G   I++ TDVA RG+
Sbjct: 425 FINYKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMIATDVAGRGI 484

Query: 485 DIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           DIP ++ V+NF M ++ + +VHR+GRT RAG  G A + +
Sbjct: 485 DIPDVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFL 524

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  177 bits (449), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 196/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 49  LKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 106

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   ++   +++VAT
Sbjct: 107 RNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLIKGVNMLVAT 166

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 167 PGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 226

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  E  +  ++ LE  +V  + D+R   LF  L+      
Sbjct: 227 TTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCESDKRFLLLFSFLKR----- 281

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 282 --NQKKKIIV----------------------------------FLSSCNS--------- 296

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 297 -------VRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLD 349

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 350 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  176 bits (447), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/394 (29%), Positives = 197/394 (50%), Gaps = 65/394 (16%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKA--HSSKIGAR 195
           I K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF+LP IE L +  +  + G  
Sbjct: 49  IEKMGFENMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIEMLHSLKYKPRNGTG 108

Query: 196 AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL 255
            ++++P+RE+A+Q + V +E  +       ++ GG +   +   ++   ++++ATPGR L
Sbjct: 109 VIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNMLIATPGRLL 168

Query: 256 -HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLV 313
            HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT    + 
Sbjct: 169 DHLQNTKGFVYKNLKALIIDEADRILEIGFEDEMKQIIRILPKEDRQSMLFSATQTTKVE 228

Query: 314 DFAKAGL-TNPVLVRL--DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
           D A+  L   P+ + +  D ++  ++ LE  +V  + D+R   LF  L+         ++
Sbjct: 229 DLARMSLRKGPLFINVVTDKDTSTADGLEQGYVVCESDKRFLLLFSFLKR-------NQK 281

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +K+I+                                   L S N               
Sbjct: 282 KKIIV----------------------------------FLSSCNS-------------- 293

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
             V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+DIP + 
Sbjct: 294 --VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIPAVD 351

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 352 WIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  182 bits (462), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/391 (28%), Positives = 200/391 (51%), Gaps = 62/391 (15%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHS----SKIGARAVI 198
           F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++ ++K+       + G   ++
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGLL 377

Query: 199 LSPSREIAMQTYKVFKEFSKGSD-LRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           L+P+RE+A+Q ++   +F+  +  ++S+  TGG  ++ Q   +    +++VATPGRF+ L
Sbjct: 378 LAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRFIDL 437

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    +N K + + V DEADRLF++GF  Q+N+++  +   +Q +LFSAT P  L 
Sbjct: 438 -LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPTKLK 496

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
            FA   L NP+ + ++++S I+EN+E   V    DE E+    LL  ++       ++K 
Sbjct: 497 SFASKILHNPIHITINSKSLINENIEQR-VEIFGDE-ESKFKSLLHWLVPTQTREVDEKT 554

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
           I+   ++ + D                                                 
Sbjct: 555 IIFVSSQQICD------------------------------------------------- 565

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
            ++S  L+  G     I+     + R   L +F+     IL+ T+V +RG+++P ++ V+
Sbjct: 566 -FLSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSLVL 624

Query: 494 NFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            +    S   +VH  GRTAR  N+G A +++
Sbjct: 625 IYNAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  176 bits (447), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/396 (30%), Positives = 196/396 (49%), Gaps = 69/396 (17%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI----G 193
           I K GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P IE L  HS K     G
Sbjct: 52  IEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKPRNG 109

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              ++++P+RE+A+Q + V +E  +       ++ GG +   +   ++   ++++ATPGR
Sbjct: 110 TGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLVKGVNLLIATPGR 169

Query: 254 FL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNT 311
            L HL+       K+++    DEADR+ E+GF +++ +++  LP E RQ++LFSAT    
Sbjct: 170 LLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQTTK 229

Query: 312 LVDFAKAGL-TNPVLVRLDA--ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
           + D A+  L   P+ + +D+  E+   E LE  +V  + D+R   LF  L+         
Sbjct: 230 VEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCESDKRFLLLFSFLKR-------N 282

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
           +++K+I+                                   L S N             
Sbjct: 283 QKKKIIV----------------------------------FLSSCNS------------ 296

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
               V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+DIP 
Sbjct: 297 ----VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIPA 352

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 353 VDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  178 bits (451), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/390 (30%), Positives = 193/390 (49%), Gaps = 72/390 (18%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEK------LKAHSSKIGAR 195
           G+ +PTPIQR TIP +  NRD +G+A TGSGKT AF++P+  K      L   + + G +
Sbjct: 182 GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLPPLNVITRQDGPQ 241

Query: 196 AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLT---GGDSLEDQFGMMMSNPDVVVATPG 252
           A+IL+P+RE+A Q     K+F      R  L+T   GG +LE+    +    +++VATPG
Sbjct: 242 ALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNLQDGCNILVATPG 300

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPE--KRQTLLFSATLPN 310
           R +       L LK V   V DEADR+ + GF +QL  +LA   +  ++QTL+F+AT+ +
Sbjct: 301 RLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILEKQTLMFTATMSS 360

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
           ++   A   L NP  V +       +                     +Q++I+  +AT+E
Sbjct: 361 SIERIANGYLRNPGFVTIGGSGSAPQ---------------------IQQIIEY-VATDE 398

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEK-ATIVFVPT 429
           Q+                                      + + + LP+ +   I+F+  
Sbjct: 399 QRF------------------------------------KMLTQDILPNYRPPVIIFINY 422

Query: 430 RHHVEY-ISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
           +   ++ + +  +   + V+ ++G+  Q  R   L  FR G   I+V TDVA RG+DIP 
Sbjct: 423 KVTADWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATDVAGRGIDIPN 482

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           ++ V+NF MPS    ++HR+GRT RA  +G
Sbjct: 483 VSLVVNFQMPSKLDDYIHRIGRTGRANQKG 512

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/390 (29%), Positives = 195/390 (50%), Gaps = 59/390 (15%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAV 197
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LPMI  +KA     + + G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 198 ILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           I +P+RE+A+Q  +  ++     D+ S+  TGG  L+ Q   + +  ++ +ATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 258 KVEMNLNLKS---VEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVD 314
                 NL S   + + V DEADRLF+ GF  Q+  +L ++   RQ +LFSAT P+ + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 315 FAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMI 374
           FA   L +P+ + ++AE  ++E +   F        E++ F  L  ++K+          
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKFTICSD---ESDKFKELLSLLKV---------- 497

Query: 375 LGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVE 434
                    +SE  D                               + TI+FV ++   +
Sbjct: 498 --------FNSETVD-------------------------------EKTIIFVSSQQICD 518

Query: 435 YISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN 494
            I + L      +  I+     + RR+ L  F+    SIL+ T+V +RG+++P ++ VI 
Sbjct: 519 IIEKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVIL 578

Query: 495 FTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +    +   +VH  GRTAR    G + S++
Sbjct: 579 YNSAKTFAQYVHSTGRTARGTREGTSISLL 608

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  176 bits (445), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 197/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           +  I+K GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP IE L  HS K   
Sbjct: 40  MKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKFKP 97

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V K   +       ++ GG +   +   +    ++++AT
Sbjct: 98  RNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEADKLAKGVNLLIAT 157

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+   +   K+++  V DEADR+ E+GF +++ +++  LP E+RQT+LFSAT 
Sbjct: 158 PGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILPSEERQTMLFSATQ 217

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +D+E + S  + LE  +V    D+R   LF  L+      
Sbjct: 218 TTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFLLLFSFLKR----- 272

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 273 --NQKKKIIV----------------------------------FLSSCNS--------- 287

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V Y ++LL      V  ++G   Q  R    + F       LV TDVAARG+D
Sbjct: 288 -------VRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDVAARGLD 340

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G++G   S++
Sbjct: 341 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  175 bits (444), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 197/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP IE L  HS K   
Sbjct: 51  LKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKFKP 108

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +    ++++AT
Sbjct: 109 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLAKGVNLLIAT 168

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 169 PGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 228

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +D+E + S  + LE  +V    D+R   LF  L++     
Sbjct: 229 TTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLFTFLKKF---- 284

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              + +K+I+                                   L S N          
Sbjct: 285 ---QNKKIIV----------------------------------FLSSCNS--------- 298

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 299 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLD 351

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTA+ G +G   S++
Sbjct: 352 IPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLM 389

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  175 bits (444), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 121/399 (30%), Positives = 196/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 56  LKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKP 113

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 114 RNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMKGVNMLIAT 173

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 174 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 233

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + + +E   S  + LE  +V    D+R   LF  L+      
Sbjct: 234 TTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVCDSDKRFLLLFSFLKR----- 288

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 289 --NQKKKIIV----------------------------------FLSSCNS--------- 303

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+D
Sbjct: 304 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICTDVAARGLD 356

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 357 IPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 394

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  175 bits (443), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 196/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 48  LKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 105

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +    ++++AT
Sbjct: 106 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLSKGVNLIIAT 165

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 166 PGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 225

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +D+E + S  + LE  +V  + D+R   LF  L++     
Sbjct: 226 TTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLFTFLKKF---- 281

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              + +K+I+                                   L S N +        
Sbjct: 282 ---QTKKIIV----------------------------------FLSSCNSV-------- 296

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                    Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 297 --------RYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVAARGLD 348

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 349 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 386

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  174 bits (442), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 197/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I+K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE+L  HS K   
Sbjct: 42  LKAIDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIERL--HSLKFKP 99

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   ++   ++++AT
Sbjct: 100 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNLLIAT 159

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF E++ +++  LP E RQ++LFSAT 
Sbjct: 160 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQIIKILPNEDRQSMLFSATQ 219

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + + +E   S  E LE  +V    D+R   LF  L+      
Sbjct: 220 TTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCDSDKRFLLLFSFLKR----- 274

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 275 --NQKKKIIV----------------------------------FLSSCNS--------- 289

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 290 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVSTDVAARGLD 342

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 343 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GAKGKGKSLM 380

>Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii AER301C
          Length = 438

 Score =  173 bits (438), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 185/391 (47%), Gaps = 65/391 (16%)

Query: 145 QPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSRE 204
           QPT +Q+  IP IL+  D +G A+TGSGKT AF  PM+    A  S  G   V+L+P+RE
Sbjct: 25  QPTIVQKACIPEILKGCDCIGGAKTGSGKTIAFAAPMLSNWSADPS--GMFGVVLTPTRE 82

Query: 205 IAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLN 264
           +AMQ  + F       +++  L+ GGD +  Q   +   P  ++ATPGR  H  +    +
Sbjct: 83  LAMQIAEQFTALGSIMNIKVALVVGGDDIVKQALELQRRPHFIIATPGRLAHHIMHSGED 142

Query: 265 ----LKSVEYAVFDEADRLFEMGFAEQLNELLASLP--EKRQTLLFSATLPNTLVDFAKA 318
               L+ V+Y V DEAD L    F + L   L+ LP  EKRQ LLF+A    T+ D  KA
Sbjct: 143 TIGGLRRVKYLVLDEADILLTNTFGKDLATCLSVLPPKEKRQNLLFTA----TITDQVKA 198

Query: 319 GLTNPVLVRLDAESKI----SENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMI 374
               P   R++ +  +     E+L+ L +             L  E + +P   +E  + 
Sbjct: 199 LKEAP---RVEGKPPVFSFQVEDLDCLAIPKA----------LKTEYLLVPEHVKEAYLY 245

Query: 375 LGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVE 434
                + LS  E +D                               K  IVFV      E
Sbjct: 246 -----QILSSEEYND-------------------------------KTVIVFVNRTVSAE 269

Query: 435 YISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN 494
            + + L+     V+ ++  L Q  R   L  FRA    IL+ TDVA+RG+DIP +  V+N
Sbjct: 270 ILRRTLRLLDVRVTSLHSQLPQKERTNSLQRFRANAARILIATDVASRGLDIPAVQLVLN 329

Query: 495 FTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + +P++   ++HRVGRTARAG  G + S VS
Sbjct: 330 YDIPANPDTYIHRVGRTARAGRSGESLSFVS 360

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  173 bits (439), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 196/396 (49%), Gaps = 69/396 (17%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI----G 193
           + K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE+L  HS K     G
Sbjct: 36  VEKMGFSSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIERL--HSLKFKPRNG 93

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              ++++P+RE+A+Q + V +E  +       ++ GG +   +   +    ++++ATPGR
Sbjct: 94  TGVIVITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKLAKGVNMLIATPGR 153

Query: 254 FL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNT 311
            L HL+       K+++  V DEADR+ E+GF +++ +++  LP + RQ++LFSAT    
Sbjct: 154 LLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDDRQSMLFSATQTTK 213

Query: 312 LVDFAKAGL-TNPVLVRLDAE--SKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
           + D A+  L   P+ + + +E  +  ++ LE  +V    D+R   LF  L+         
Sbjct: 214 VEDLARISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLFSFLKR-------N 266

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
           +++K+I+                                   L S N             
Sbjct: 267 QKKKVIV----------------------------------FLSSCNS------------ 280

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
               V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+DIP 
Sbjct: 281 ----VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPA 336

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 337 VDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 371

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/386 (29%), Positives = 195/386 (50%), Gaps = 44/386 (11%)

Query: 147 TPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVILSPS 202
           TPIQ + IP I+  RD++G+++TGSGKT +++LP++  +KA      ++ G   +IL+P+
Sbjct: 315 TPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLGLILAPT 374

Query: 203 REIAMQTYKVFKEF-SKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEM 261
           RE+A+Q +   + F     ++RS+  TGG  L+ Q   +     +VVATPGRF+ L    
Sbjct: 375 RELALQIHDEIERFIVHDENIRSICCTGGSELKKQINDLKRGVQIVVATPGRFIDLLTLN 434

Query: 262 NLNLKSVE---YAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKA 318
              L S E   + + DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L +FA  
Sbjct: 435 TGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLRNFAMR 494

Query: 319 GLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEG 378
            L +P+ + +++ + ++EN+E      + D  +       QE++           IL   
Sbjct: 495 ILNSPLSITINSNNLVNENVEQKVAICETDSAK------FQELL----------TILQNQ 538

Query: 379 NKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYISQ 438
           NK     E+ + E                            +K TI+FV ++   + +  
Sbjct: 539 NKQQDQCENDEDEEREDETTL--------------------DKKTIIFVASQQICDLLYS 578

Query: 439 LLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMP 498
            L   GY +  I+       R   L  F+    SIL+ T+V +RG+++P ++ VI +   
Sbjct: 579 QLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILICTEVLSRGLNVPEVSLVIIYNAV 638

Query: 499 SSSKIFVHRVGRTARAGNRGWAYSIV 524
            +   +VH  GRTAR    G A +++
Sbjct: 639 KTFAQYVHTTGRTARGNLHGIAITLL 664

>KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {ON}
           Anc_8.614 YOR204W
          Length = 607

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 193/405 (47%), Gaps = 75/405 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI-EKLKAHSSKI 192
           ++ N+    F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  K   S +
Sbjct: 160 LMENVKLARFTKPTPVQKYSIPIISIGRDLMACAQTGSGKTGGFLFPVLSESFKVGPSVV 219

Query: 193 GAR------------AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
                          AVI++P+RE+A Q +   K+F   S +   ++ GG  + +Q   M
Sbjct: 220 QGNEGYSYQRKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVNPCVVYGGAPIGNQLREM 279

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL--ASLP-- 296
               D++VATPGR   +     ++L +V+Y V DEADR+ +MGF  Q+ +++    +P  
Sbjct: 280 DRGCDLLVATPGRLSDMIERGKISLSNVKYLVLDEADRMLDMGFEIQIRQIVEGCDMPPS 339

Query: 297 EKRQTLLFSATLPNTLVDFAKAGL-TNPVLVRLDAESKISENLEMLFVSTKHDEREANLF 355
            +RQTL+FSAT P  +   A+  L  + + + +      SEN+    +  +  ++++ L 
Sbjct: 340 SERQTLMFSATFPADIQHLARDFLRPDYIFLSVGKVGSTSENITQRVMYVESMDKKSALL 399

Query: 356 YLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSAN 415
            L        LA+ E  + L                                        
Sbjct: 400 DL--------LASSEPGLTL---------------------------------------- 411

Query: 416 ELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILV 475
                    +FV T+   + ++  L       + I+G   Q  R R L  F++G  +ILV
Sbjct: 412 ---------IFVETKRMADQLTDFLIMQNLRATAIHGDRTQSERERALAAFKSGRANILV 462

Query: 476 VTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
            T VAARG+DIP + +VIN+ +P     +VHR+GRT RAGN G A
Sbjct: 463 ATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGLA 507

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 129/456 (28%), Positives = 211/456 (46%), Gaps = 76/456 (16%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  +N   F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   
Sbjct: 53  LKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+++SP+RE+AMQ Y+V  +    + L + L+ GG  ++ +    +S  ++++ TPG
Sbjct: 113 GLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLSKINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L HL   + LN  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   +
Sbjct: 172 RILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLT--------NPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           L D A+  LT        +P   + D  +   + LE  +V T+  ++   L+  ++  +K
Sbjct: 232 LGDLARLSLTDYKTVGTMDPSKDKTDEGAATPKTLEQSYVETELADKLDILYSFIKSHLK 291

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
                   KMI                                                 
Sbjct: 292 -------HKMI------------------------------------------------- 295

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
            VF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 296 -VFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXGK 541
           RG+D P +  VI    P  +  ++HRVGR AR G +G   S++                K
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKG--KSLIMLTPQECEPFLKRLASK 412

Query: 542 KILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSY 577
           KI L  +   T    K+K +        F+ P++ Y
Sbjct: 413 KIKLGKL---TIKQAKKKSIKPQLQSLLFKDPELKY 445

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  174 bits (441), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 187/398 (46%), Gaps = 62/398 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 125 VLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 184

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F + S +R+  + GG     Q   +    ++++AT
Sbjct: 185 GDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDLQRGVEILIAT 244

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L                          HD  + N+  L        LA   
Sbjct: 305 EVQQLARDYL--------------------------HDPIQVNIGSL-------ELAASH 331

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPS---EKATIVFV 427
               LGE    +SD +  D                     L    E+ S   +   I+  
Sbjct: 332 TITQLGE---VVSDFDKRD--------------------RLVKHLEIGSKDKDSKIIILH 368

Query: 428 PTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIP 487
            T+   + I+  L+  G+    I+G          L ++R G + I+V TDV ARG+D+ 
Sbjct: 369 STKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARGIDVK 428

Query: 488 MLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            +  VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 429 GINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 466

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  177 bits (450), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 109/393 (27%), Positives = 200/393 (50%), Gaps = 62/393 (15%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++  +KA      ++ G  A+I
Sbjct: 325 FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLALI 384

Query: 199 LSPSREIAMQTYK-VFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           ++P+RE+A+Q Y+   +       LR++  TGG  L+ Q   +    ++VVATPGRF+ L
Sbjct: 385 IAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVVATPGRFIDL 444

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + MN    ++ K + + V DEADRLF+MGF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 445 -LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPNKLR 503

Query: 314 DFAKAGLTNPVLVRLDAESKISENL--EMLFVSTKHDEREANLFYLLQEVIKIPLATEEQ 371
           +FA   L +P+ + +++ + ++EN+  ++   + + D+ +  L  L +   K+    +++
Sbjct: 504 NFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAKLVSPEQDE 563

Query: 372 KMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRH 431
           K+I+   ++ + D+  +  EN                                       
Sbjct: 564 KVIIFVASQQICDTLYAKLEN--------------------------------------- 584

Query: 432 HVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLAN 491
                        Y +  I+       R   L  F+    SIL+ T+V +RG+++P ++ 
Sbjct: 585 -----------YDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVPEVSL 633

Query: 492 VINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           V+ F    +   +VH  GRTAR  N G A +++
Sbjct: 634 VVIFNAIKTFAQYVHTTGRTARGNNHGDAITLL 666

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  174 bits (440), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 123/401 (30%), Positives = 194/401 (48%), Gaps = 71/401 (17%)

Query: 143 FRQPTPIQRKTIPLILQ-NRDIVGMARTGSGKTAAFVLPMIEKLK-------AHSSKIGA 194
           F  PTP+QR TIP I++ NRD VG+A TGSGKT AFVLPM+ +L        A     G 
Sbjct: 195 FDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVPPIALKKMNGP 254

Query: 195 RAVILSPSREIAMQTY----KVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             ++L P+RE+A Q      KV     +   ++   + GG SLE+    +    D+++AT
Sbjct: 255 IGLVLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEISSNLNEGCDILIAT 314

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR-------QTLL 303
           PG+ +       L + ++ Y V DEAD++ ++GF +QL  +L +L           +TL+
Sbjct: 315 PGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEVNNSNVSSLYRTLM 374

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           F+ATL + L   A   L NP+   + AE                    A+    +Q+V++
Sbjct: 375 FTATLSSPLEKIASGYLRNPIYASIKAEG-------------------ADAMPQIQQVVQ 415

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
               T++QK       KA+                            L   N + + +  
Sbjct: 416 Y-CPTDDQKF------KAIE-------------------------SILREKNTMDNPRV- 442

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F+  +   ++++    +  Y V+ ++G+  Q  R   +   R+G   IL+ T+VAARG
Sbjct: 443 IIFINYKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQILIATNVAARG 502

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +DIP +A VINF  P     +VHR+GRT RAGN G A +++
Sbjct: 503 LDIPNVALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLI 543

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  171 bits (434), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 122/396 (30%), Positives = 194/396 (48%), Gaps = 69/396 (17%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI----G 193
           + K GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP +E L  HS K     G
Sbjct: 43  VEKLGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPAVEML--HSLKFKPRNG 100

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              V+++P+RE+A+Q + V K   +       ++ GG +   +   +    ++++ATPGR
Sbjct: 101 TGVVVITPTRELALQIFGVAKSLMEFHSQTFGIVIGGANRRQEADKLAKGVNLLIATPGR 160

Query: 254 FL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNT 311
            L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQT+LFSAT    
Sbjct: 161 LLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIVKILPNEDRQTMLFSATQTTK 220

Query: 312 LVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIPLAT 368
           + D A+  L   P+ + +D+E + S  + LE  +V  + D+R   LF  L+         
Sbjct: 221 VEDLARISLRPGPLFINVDSEKENSTVDGLEQGYVVCESDKRFLLLFSFLKR-------N 273

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
           +++K+I+                                   L S N             
Sbjct: 274 QKKKVIV----------------------------------FLSSCNS------------ 287

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
               V Y ++LL      V  ++G   Q  R    + F       LV TDVAARG+DIP 
Sbjct: 288 ----VRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDVAARGLDIPA 343

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +  +I F  P   + ++HRVGRTAR G++G   S++
Sbjct: 344 VDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa]
           {ON} Anc_5.40 YMR290C
          Length = 496

 Score =  171 bits (434), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 196/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K  F + T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 44  LKAIGKLDFTEMTAVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKP 101

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   ++   ++++AT
Sbjct: 102 RNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNILIAT 161

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  V DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 162 PGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQ 221

Query: 309 PNTLVDFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  E+  S  + LE  +V  + D+R   LF  L+      
Sbjct: 222 TTKVEDLARISLRKGPLFINVVPENDTSTADGLEQGYVVCESDKRFLLLFSFLKR----- 276

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 277 --NQKKKIIV----------------------------------FLSSCNS--------- 291

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+D
Sbjct: 292 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLD 344

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 345 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 382

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 192/397 (48%), Gaps = 71/397 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  +++  F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   
Sbjct: 53  LKGLSEAAFLKLTDIQRESIPVSLKGYDVLGSAKTGSGKTLAFLIPVLEKLYRERWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +    +   + L+ GG  ++ +   + S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGSHTSFSAGLVIGGKDVKFELERI-SRINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L HL   + LN  +++  V DEADR  +MGF + L+ ++ +LP  RQTLLFSAT   +
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVGNLPPSRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTNPVLV--------RLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           L D A+  LT+   V        + DAE+     LE  ++  +  ++   LF  ++  +K
Sbjct: 232 LADLARLSLTDYKSVGTMDKANEKSDAEAATPATLEQSYIEVELADKLDVLFSFIKTHLK 291

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
                   KMI+                                                
Sbjct: 292 -------AKMIV------------------------------------------------ 296

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
             F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 --FLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  VI    P  +  ++HRVGR+AR G +G
Sbjct: 355 RGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKG 391

>KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {ON}
           Anc_5.40 YMR290C
          Length = 476

 Score =  171 bits (433), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 196/397 (49%), Gaps = 65/397 (16%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           +  I K GF + T +Q +TIP +L  +D++G A+TGSGKT AF++P IE L A   K   
Sbjct: 21  MKAIEKMGFTKMTTVQERTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIETLHALKFKPRN 80

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +    ++++ATPG
Sbjct: 81  GTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLAKGVNILIATPG 140

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPN 310
           R L HL+       K+++  V DEADR+ E+GF +++ +++  LP E+RQ++LFSAT   
Sbjct: 141 RLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIRILPNEERQSMLFSATQTT 200

Query: 311 TLVDFAKAGL-TNPVLVRLDAES--KISENLEMLFVSTKHDEREANLFYLLQEVIKIPLA 367
            + D A+  L   P+ + +  E+    ++ LE  +V  + D+R   LF  L+        
Sbjct: 201 KVEDLARISLRKGPLFINVVPETDHSTADGLEQGYVVCESDKRFLLLFSFLKR------- 253

Query: 368 TEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFV 427
            +++K+I+                                   L S N            
Sbjct: 254 NQKKKVIV----------------------------------FLSSCNS----------- 268

Query: 428 PTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIP 487
                V+Y ++LL      V  ++G   Q  R    + F      ILV TDVAARG+DIP
Sbjct: 269 -----VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIP 323

Query: 488 MLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
            +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 324 AVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 359

>YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON}
           HAS1ATP-dependent RNA helicase; localizes to both the
           nuclear periphery and nucleolus; highly enriched in
           nuclear pore complex fractions; constituent of 66S
           pre-ribosomal particles
          Length = 505

 Score =  171 bits (434), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 120/399 (30%), Positives = 196/399 (49%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 54  LKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKP 111

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 112 RNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIAT 171

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 172 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 231

Query: 309 PNTLVDFAKAGL-TNPVLVRL--DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  + ++  ++ LE  +V    D+R   LF  L+      
Sbjct: 232 TTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKRFLLLFSFLKR----- 286

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 287 --NQKKKIIV----------------------------------FLSSCNS--------- 301

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+D
Sbjct: 302 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLD 354

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 355 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  176 bits (445), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 116/396 (29%), Positives = 191/396 (48%), Gaps = 70/396 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + +  F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   
Sbjct: 53  LKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +    +   + L+ GG  ++ +   + S  +++V TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-SRINILVGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L H+   + LN  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   +
Sbjct: 172 RILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTNPVLVRL-------DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKI 364
           L D A+  LT+   V         D+E    E L+  ++  +  ++   LF  ++  +K 
Sbjct: 232 LADLARLSLTDYKSVGTADTVNGGDSEVSTPETLQQSYIVVELADKLDTLFSFIKTHLK- 290

Query: 365 PLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATI 424
                  KMI                                                  
Sbjct: 291 ------SKMI-------------------------------------------------- 294

Query: 425 VFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
           VF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L+ TDV AR
Sbjct: 295 VFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATDVVAR 354

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           G+D P +  V+    P     ++HRVGR+AR G +G
Sbjct: 355 GIDFPAVDWVVQVDCPEDVDTYIHRVGRSARYGKQG 390

>Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  171 bits (433), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 120/399 (30%), Positives = 195/399 (48%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 54  LKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKP 111

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 112 RNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIAT 171

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 172 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 231

Query: 309 PNTLVDFAKAGL-TNPVLVRL--DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  + ++  ++ LE  +V    D R   LF  L+      
Sbjct: 232 TTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLFSFLKR----- 286

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 287 --NQKKKIIV----------------------------------FLSSCNS--------- 301

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+D
Sbjct: 302 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLD 354

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G +G   S++
Sbjct: 355 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  171 bits (432), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 120/399 (30%), Positives = 195/399 (48%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 54  LKAIEKLGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKP 111

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 112 RNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIAT 171

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT 
Sbjct: 172 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQ 231

Query: 309 PNTLVDFAKAGL-TNPVLVRL--DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  + ++  ++ LE  +V    D+R   LF  L+      
Sbjct: 232 TTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDDRFLLLFSFLKR----- 286

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 287 --NQKKKIIV----------------------------------FLSSCNS--------- 301

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+D
Sbjct: 302 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLD 354

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  +I F  P   + ++HRVGRTAR G  G   S++
Sbjct: 355 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTEGKGKSLM 392

>Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  169 bits (428), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/399 (29%), Positives = 195/399 (48%), Gaps = 69/399 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-- 192
           L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K   
Sbjct: 54  LKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKP 111

Query: 193 --GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++AT
Sbjct: 112 RNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIAT 171

Query: 251 PGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATL 308
           PGR L HL+       K+++  + DEADR+ E+GF +++ +++  LP + RQ++LFSAT 
Sbjct: 172 PGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNDDRQSMLFSATQ 231

Query: 309 PNTLVDFAKAGL-TNPVLVRL--DAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
              + D A+  L   P+ + +  + ++  ++ LE  +V    D R   LF  L+      
Sbjct: 232 TTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLFSFLKR----- 286

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
              +++K+I+                                   L S N          
Sbjct: 287 --NQKKKIIV----------------------------------FLSSCNS--------- 301

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                  V+Y ++LL      V  ++G   Q  R    + F      IL+ TDVAARG+D
Sbjct: 302 -------VKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLD 354

Query: 486 IPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           IP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 355 IPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  170 bits (430), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 120/404 (29%), Positives = 202/404 (50%), Gaps = 77/404 (19%)

Query: 142 GFRQPTPIQRKTIPLILQN-----RDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI---- 192
           GF +PT IQR TIP  + +     RDI+G+A TGSGKT AF +P++ +L A  ++     
Sbjct: 190 GFDEPTAIQRITIPNAISSNKSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLK 249

Query: 193 ---GARAVILSPSREIAMQTY----KVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPD 245
              G  A++L P+RE+A Q      ++   +    +L +V + GG S+ D    + +  D
Sbjct: 250 TLDGPLALVLVPTRELAQQISQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCD 309

Query: 246 VVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP----EKRQT 301
           +++ATPGR L +     + L  ++  V DEADR+ ++GF +Q+  +L+ L       RQT
Sbjct: 310 ILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQT 369

Query: 302 LLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEV 361
           +LF+ATL +++   AK  L NP+ V                V ++ D  +          
Sbjct: 370 MLFTATLSSSVESIAKGYLKNPLHVS---------------VGSRWDSDK---------- 404

Query: 362 IKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEK 421
              PL T+  +   G+ +K LS  +D   +NG                 LP+        
Sbjct: 405 ---PLITQVVRHT-GDDDKKLSFLKDDLIKNG-----------------LPA-------- 435

Query: 422 ATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
             I+F+  +   ++++  L     +V+ ++G+  Q  R   +   ++G  ++L+ T+VAA
Sbjct: 436 --IIFINYKETADWLTLRLSDRFNIVT-LHGSKSQSQRESAIQKLKSGTANVLIATNVAA 492

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           RG+DIP +A V+NF M      ++HR+GRT RAG  G A + ++
Sbjct: 493 RGLDIPDVALVVNFQMSKKFDDYIHRIGRTGRAGKTGIAVTYLT 536

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 144/229 (62%), Gaps = 4/229 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 217 VMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVA 276

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  +  S+L   L  GG +L  Q  M+ + PD+V+ATP
Sbjct: 277 STRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIATP 336

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE+++ LP KRQTLLFSAT+ +
Sbjct: 337 GRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNS 396

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST-KHDEREANLFYLL 358
            +       L  PV + +D   + +  L   FV   K D  + +L + L
Sbjct: 397 RIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNL 445

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (60%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           +K  +VFV  +     +  +L   G  V+ ++G+L Q  R   +  F++    +L+ TD+
Sbjct: 454 QKRIVVFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDL 513

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           A+RG+DIP +  VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 514 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFV 558

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  171 bits (432), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/402 (27%), Positives = 194/402 (48%), Gaps = 68/402 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSK 191
           +L  +    + + T IQR +IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +  
Sbjct: 50  VLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRERWTEY 109

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
            G  A+I+SP+RE+AMQ Y+V  +        + L+ GG  ++ +    +S  ++++ TP
Sbjct: 110 DGVGALIISPTRELAMQIYEVLIKIGTHCSFSAGLVIGGKDVKFE-AERISKINILIGTP 168

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR L HL   + LN+ +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   
Sbjct: 169 GRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLFSATQSQ 228

Query: 311 TLVDFAKAGLTNPVLVRLDA-----ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
           +L D A+  LT+   V   A     + +  E L+  ++  +  ++   LF  ++  +K  
Sbjct: 229 SLNDLARLSLTDYKTVGTPANVSGSQPETPETLQQHYIVVELADKLDTLFSFIKTHLKC- 287

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
                 KMI+                                                  
Sbjct: 288 ------KMIV-------------------------------------------------- 291

Query: 426 FVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           F  +   V ++ +  +    G  + +++G   Q AR   L  F       L+ TDV +RG
Sbjct: 292 FFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVSRG 351

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +D P +  V+    P +   ++HRVGR+AR G +G +  +++
Sbjct: 352 IDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQGKSLIMLT 393

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  171 bits (432), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 147/227 (64%), Gaps = 11/227 (4%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++ ++KA      ++ G   +I
Sbjct: 271 FVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLRQIKAQRPLSKTETGPMGLI 330

Query: 199 LSPSREIAMQTYKVFKEFSKGS-DLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           L+P+RE+A+Q Y+   +F+ GS  +RS+  TGG  L+ Q   +    +VVVATPGRF+ L
Sbjct: 331 LAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQINDLKKGVEVVVATPGRFIDL 390

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    L+ + + + V DEADRLF++GF  Q+ +++ ++   +Q +LFSAT PN L 
Sbjct: 391 -LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKAVRPDKQCVLFSATFPNKLK 449

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEM-LFVSTKHDEREANLFYLLQ 359
           +FA   L  P+ + ++++S I+EN+E  L +    +E+ A +  +L+
Sbjct: 450 NFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAAMLEVLE 496

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  169 bits (429), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 143/233 (61%), Gaps = 5/233 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +KI 
Sbjct: 225 VLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 284

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L P+RE+A+Q   V K+ ++  S +   L  GG +L  Q  M+ S PD+V+ATP
Sbjct: 285 STRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATP 344

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE++  LP  RQ LLFSAT+ +
Sbjct: 345 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 404

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEV 361
            +       L  PV + +D   K +  L   FV  +  +  + A LF L++++
Sbjct: 405 KIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKL 457

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           +K  +VFV  +     +  ++   G  V  ++G+L Q  R   +  F+     +L+ TD+
Sbjct: 462 QKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDL 521

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           A+RG+DIP +  VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 522 ASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFV 566

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 143/233 (61%), Gaps = 5/233 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +KI 
Sbjct: 242 VLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIA 301

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L P+RE+A+Q   V K+ ++  S +   L  GG +L  Q  M+ S PD+V+ATP
Sbjct: 302 STRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATP 361

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE++  LP  RQ LLFSAT+ +
Sbjct: 362 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 421

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEV 361
            +       L  PV + +D   K +  L   FV  +  +  + A LF L++++
Sbjct: 422 KIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKL 474

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           +K  +VFV  +     +  ++   G  V  ++G+L Q  R   +  F+     +L+ TD+
Sbjct: 479 QKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDL 538

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           A+RG+DIP +  VIN+ MP S +I++HRVGRTARAG  G + + V
Sbjct: 539 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  169 bits (429), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 135/206 (65%), Gaps = 10/206 (4%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH----SSKIGARAVI 198
           F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ ++KA       + G   +I
Sbjct: 257 FTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIKAQRPLGGDETGPLGLI 316

Query: 199 LSPSREIAMQTYKVFKEFSKGS-DLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHL 257
           LSP+RE+A+Q ++   +F+ G   +RS+  TGG  L+ Q   +    ++V+ATPGRF+ L
Sbjct: 317 LSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIKRGVEIVIATPGRFIDL 376

Query: 258 KVEMN----LNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            + +N    +N K + + V DEADRLF++GF  Q+N+++  +   +Q +LFSAT PN L 
Sbjct: 377 -LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPNKLK 435

Query: 314 DFAKAGLTNPVLVRLDAESKISENLE 339
            FA   L +PV + ++++S I+EN+E
Sbjct: 436 SFASKILHDPVYITVNSKSLINENIE 461

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%)

Query: 419 SEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTD 478
           +++ TIVFV ++   + +   L+A G+    I+       R   L  F+     IL+ T+
Sbjct: 489 NDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTE 548

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           V +RG+++P ++ VI +    +   +VH  GRTAR  N+G A +++
Sbjct: 549 VLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 212/419 (50%), Gaps = 51/419 (12%)

Query: 138 INKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGAR 195
           +++ GF+  TP+Q+KTI  IL++   D++  A+TG+GKT AF+LP+ +KL    +    +
Sbjct: 178 VHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIESPNSAMVK 237

Query: 196 AVILSPSREIAMQT-YKVFKEFSKGSDLR---SVLLTGGDSLEDQFG-MMMSNPDVVVAT 250
           +VI++P+R++A+Q   ++ K +   S LR    + + GG +       +    P+++VAT
Sbjct: 238 SVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRERPNIIVAT 297

Query: 251 PGRFLHLKVEMNLNLKS-VEYAVFDEADRLFEMGFAEQLNELLASL-------PEKRQTL 302
           PGR L +  +      S V++ V DEADRL E+GF E L  +  SL        +  +TL
Sbjct: 298 PGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSNGADHIRTL 357

Query: 303 LFSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKHDEREANLFYLL 358
           LFSATL + +   A   +     + LD     E +  EN+    V +  D    +++ ++
Sbjct: 358 LFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVS--DAFSHSIYAVI 415

Query: 359 QEV------IKIPLA--TEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXX 410
           + +       ++P+A  T E++  +  G +++ ++E                        
Sbjct: 416 EHIRSRLHPTELPIAEVTTEEETKVEAGVESVEETE------------------VITKAT 457

Query: 411 LPSANELPSEKATIVFVPTRHHVEYISQLLK----ACGYLVSYIYGTLDQHARRRQLYNF 466
            P           I+F PT    +++SQL+K      G  +   +G +DQ+ R R +  F
Sbjct: 458 KPFDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRTRIVEKF 517

Query: 467 RAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +   + ILV TDV ARG+D P +  V+   +PS    +VHR+GRTARAG +G + + +S
Sbjct: 518 KRANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGISTAFLS 576

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 185/397 (46%), Gaps = 71/397 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + +  F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +    +   + L+ GG  ++ +   + S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-SRINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L HL   + LN  +++  V DEADR  +MGF + L+ ++++L   RQTLLFSAT   +
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTNPVLV--------RLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           + D A+  LT+   V         ++ E+   E L+  ++     ++   LF  ++  +K
Sbjct: 232 VADLARLSLTDYKTVGTHDVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLK 291

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
                   KMI                                                 
Sbjct: 292 C-------KMI------------------------------------------------- 295

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
            VF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 296 -VFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P     ++HRVGR AR G +G
Sbjct: 355 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 144/233 (61%), Gaps = 5/233 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 248 VLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLIYKPAKVA 307

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  K  + L   +  GG +L  Q  ++ + PD+V+ATP
Sbjct: 308 STRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVGGLNLRQQEQILKTRPDIVIATP 367

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF +++NE++  LP KRQT+LFSAT+ +
Sbjct: 368 GRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEINEIMHLLPSKRQTMLFSATMNS 427

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEV 361
            +       L  PV V  D   +    L+  FV  +  +  + + LFYL++++
Sbjct: 428 KIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKRDHLKPSTLFYLIKKL 480

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 68/106 (64%)

Query: 419 SEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTD 478
           ++K  +VFV  +  V  +  +L   G  V+ ++G+L+Q  R + +  F++    +L+ TD
Sbjct: 484 AQKRMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTD 543

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +A+RG+DIP +  VIN+ MP S +I++HRVGRTARAG  G + S V
Sbjct: 544 LASRGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFV 589

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  162 bits (410), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 107/354 (30%), Positives = 174/354 (49%), Gaps = 56/354 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 125 VLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 184

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q  K   +F + S +R+  + GG     Q   ++   ++V+AT
Sbjct: 185 GDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDLIRGAEIVIAT 244

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 245 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 304

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L +P+ V++ +          L +S  H          + +++++      
Sbjct: 305 EVQQLARDYLNDPIQVQIGS----------LELSASH---------TITQLVEV------ 339

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
                      +SD E  D  N                  L +A+E   E   ++F  T+
Sbjct: 340 -----------VSDFEKRDRLN----------------KHLVTASE-DKESKILIFASTK 371

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
              + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 372 RTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDVAARGI 425

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 93/235 (39%), Positives = 148/235 (62%), Gaps = 9/235 (3%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    +K+ 
Sbjct: 260 VLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLFKPAKVS 319

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSD-LRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V K+  K  + L   L  GG +L  Q  ++   PD+V+ATP
Sbjct: 320 STRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGLNLRQQEQILKQRPDIVIATP 379

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF E+LNE++  LP KRQT+LFSAT+ +
Sbjct: 380 GRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNEIMQLLPTKRQTMLFSATMNS 439

Query: 311 TLVDFAKAGLTNPVLVRLD----AESKISENLEMLFVSTKHDEREANLFYLLQEV 361
            +       L  PV + ++    A SK+++  E + + T+   + A LF L++++
Sbjct: 440 KIKQLINLSLKKPVRIMINPPKQAASKLTQ--EFVRIRTRDHLKPALLFNLIKKL 492

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 65/106 (61%)

Query: 419 SEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTD 478
           S+K  +VFV  +     +  +L   G  V+ ++G+L Q  R   +  F++    +L+ TD
Sbjct: 496 SQKRMVVFVARKETAHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVLICTD 555

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +A+RG+DIP +  VIN+ MP S  I++HRVGRTARAG  G + S+V
Sbjct: 556 LASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLV 601

>ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL033W (HCA4)
          Length = 763

 Score =  167 bits (422), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 116/396 (29%), Positives = 186/396 (46%), Gaps = 71/396 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           +  + +  + + T IQR  IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   
Sbjct: 53  VKGLKEAAYIKMTDIQRAAIPVALKGHDVLGAAKTGSGKTLAFLVPVLEKLYHERWTELD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGM-MMSNPDVVVATP 251
           G  A+++SP+RE+AMQ Y+V  +  K     + L+ GG  +  +F M  +S  ++++ TP
Sbjct: 113 GLGALVISPTRELAMQIYEVLVKIGKYMSFSAGLVIGGKDV--KFEMERVSKINILIGTP 170

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR L H+   + LN  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   
Sbjct: 171 GRLLQHMDQSVGLNTSNLQILVLDEADRCLDMGFKKALDAIVSNLPPSRQTLLFSATQSQ 230

Query: 311 TLVDFAKAGLTNPVLV-RLDAESK-----ISENLEMLFVSTKHDEREANLFYLLQEVIKI 364
           +L D A+  L +   V  +D  S        ENLE  ++     ++   LF  ++  +K 
Sbjct: 231 SLADLARLSLADYKTVGTMDGPSSKNKPATPENLEQFYIQVALPDKLDILFSFIKSHLK- 289

Query: 365 PLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATI 424
                  KMI                                                  
Sbjct: 290 ------SKMI-------------------------------------------------- 293

Query: 425 VFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
           VF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV AR
Sbjct: 294 VFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVAR 353

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           G+D P +  VI    P     ++HR GR+AR G  G
Sbjct: 354 GIDFPSVDWVIQTDCPEDVDTYIHRAGRSARYGKTG 389

>Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  166 bits (421), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 184/397 (46%), Gaps = 71/397 (17%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + +  F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +    +   + L+ GG  ++ +   + S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERV-SRINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L HL   + LN  +++  V DEADR  +MGF + L+ ++++L   RQTLLFSAT   +
Sbjct: 172 RILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTNPVLV--------RLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           + D A+  LT+   V         +  ES   E L+  ++     ++   LF  ++  +K
Sbjct: 232 VADLARLSLTDYKTVGTHDVMDGSVSNESSTPETLQQSYIEVTLADKLDILFSFIKSHLK 291

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
                   KMI+                                                
Sbjct: 292 C-------KMIV------------------------------------------------ 296

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
             F+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 --FLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P     ++HRVGR AR G +G
Sbjct: 355 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON}
           DBP5Cytoplasmic ATP-dependent RNA helicase of the
           DEAD-box family; involved in mRNA export from the
           nucleus; involved in translation termination; ATP/ADP
           cycling is regulated by Gle1p and Nup159p
          Length = 482

 Score =  162 bits (409), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 195/400 (48%), Gaps = 71/400 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKLKAHSSK 191
           +L  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M+ ++    + 
Sbjct: 103 LLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDA- 161

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
              +A+ L+PSRE+A QT +V +E  K + + S L+   DS E    +   N  V+V TP
Sbjct: 162 -SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NAQVIVGTP 216

Query: 252 GRFLHLKVEMNLNLKSVEYAVFDEADRLF-EMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           G  L L     + L+ ++  V DEAD +  + G  +Q   +   LP+  Q +LFSAT  +
Sbjct: 217 GTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFAD 276

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +  +AK  + N   + L       + ++ L++  K+   EA+ F +L E+  +      
Sbjct: 277 AVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFDVLTELYGL------ 327

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
             M +G                                             ++I+FV T+
Sbjct: 328 --MTIG---------------------------------------------SSIIFVATK 340

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
                +   LK+ G+ VS ++G L    R R + +FR G + +L+ T+V ARG+DIP ++
Sbjct: 341 KTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVS 400

Query: 491 NVINFTMPSSSK------IFVHRVGRTARAGNRGWAYSIV 524
            V+N+ +P+ +        ++HR+GRT R G +G A S V
Sbjct: 401 MVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 142/233 (60%), Gaps = 5/233 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L     KI 
Sbjct: 234 VLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPGKIA 293

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L P+RE+A+Q   V K+ ++  S +   L  GG +L  Q  ++ S PD+V+ATP
Sbjct: 294 STRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGGLNLRQQEQLLKSRPDIVIATP 353

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GRF+ H++   + N+ SVE  V DEADR+ E GF ++LNE++  LP  RQ LLFSAT+ +
Sbjct: 354 GRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNS 413

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE--REANLFYLLQEV 361
            +       L  PV + +D   + +  L   FV  +  +  + A LF L++++
Sbjct: 414 KIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPALLFNLIRKL 466

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 62/105 (59%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           +K  +VFV  +     +  ++   G  V  ++G+L Q  R   +  F+     +LV TD+
Sbjct: 471 QKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVCTDL 530

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           A+RG+DIP +  V+N+ MP S +I++HRVGRTARA   G + ++V
Sbjct: 531 ASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLV 575

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score =  163 bits (412), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/401 (29%), Positives = 200/401 (49%), Gaps = 74/401 (18%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKA-----HSSKI 192
           I K  + +PTPIQR TIP +   RD +G+A TGSGKT AF++P+I KL         +K+
Sbjct: 179 IRKLHYTEPTPIQRVTIPNVDNGRDFLGVAVTGSGKTLAFLIPIIIKLNTLPPLTEITKL 238

Query: 193 -GARAVILSPSREIAMQ----TYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVV 247
            G  ++IL+P+RE+A Q      K+ + +S+  ++ S++  GG ++E+    +    +++
Sbjct: 239 NGPYSLILAPTRELAQQIEAEARKLTQYWSRPCNVVSIV--GGHAIEEISYNLSRGCEIL 296

Query: 248 VATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLA--SLPEKRQTLLFS 305
           VATPGR +       L L+ V   V DEADR+ + GF +QL  +L+  S   KRQT++F+
Sbjct: 297 VATPGRLIDCLENHVLVLEQVNILVLDEADRMIDYGFEDQLTTILSKTSSSNKRQTMMFT 356

Query: 306 ATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
           AT+  T+   A   L  P                  +V+   +E +  +  +L+      
Sbjct: 357 ATMSPTIEKIADGYLNKPA-----------------YVTIGGEETKPQITQILEY----- 394

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKA-TI 424
           L +EE++         L  S+D                             LP   A  I
Sbjct: 395 LPSEEKRF--------LKLSKDI----------------------------LPHYPAPII 418

Query: 425 VFVPTRHHVEYISQLLK-ACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           +F+  +   +++++  +    Y  + ++G+  Q  R   L   R+G   I++ T+VA RG
Sbjct: 419 IFINYKRTADWLAKKFQDETKYRTTTLHGSKSQEQRENSLNLLRSGKADIMIATNVAGRG 478

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +DIP ++ V+NF M +  + ++HR+GRT RAG  G++ + +
Sbjct: 479 IDIPNVSLVVNFQMATKLEDYIHRIGRTGRAGKEGYSITFL 519

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 166/355 (46%), Gaps = 58/355 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 124 VLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 184 GDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIRELSRGAEIVIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVRLDA-ESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATE 369
            +   A   L +P+ V++ + E   S N+  L       E+   L   L+          
Sbjct: 304 EVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE---------- 353

Query: 370 EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPT 429
                        + SED D++                                +VF  T
Sbjct: 354 -------------TASEDKDSK-------------------------------ILVFAST 369

Query: 430 RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
           +   + +++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 370 KRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARGI 424

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 176/354 (49%), Gaps = 56/354 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L+ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  + A    S 
Sbjct: 123 VLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSP 182

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q      +F K S +R+  + GG     Q   +    ++V+AT
Sbjct: 183 GDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELSRGAEIVIAT 242

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 243 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 302

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A+  L +P+ V          N+  L ++  H+         +++V+++    ++
Sbjct: 303 EVQQLARDYLHDPIQV----------NVGSLELAASHN---------IKQVVEVVSEMDK 343

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +L     A   SED D++                                ++F  T+
Sbjct: 344 RDRLLKHLETA---SEDKDSK-------------------------------ILIFASTK 369

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGV 484
              + ++++L+  G+    I+G   Q+ R   L  FR+G + I+V TDVAARG+
Sbjct: 370 RTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAARGI 423

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  160 bits (404), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 112/400 (28%), Positives = 194/400 (48%), Gaps = 71/400 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKLKAHSSK 191
           +L  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M+ ++    + 
Sbjct: 98  LLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDA- 156

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
              +A+ L+PSRE+A QT +V +E  K + + S L+   DS E    +   N  ++V TP
Sbjct: 157 -SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NSQIIVGTP 211

Query: 252 GRFLHLKVEMNLNLKSVEYAVFDEADRLF-EMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           G  L L     + L+ ++  V DEAD +  + G  +Q   +   LP+  Q +LFSAT  +
Sbjct: 212 GTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFAD 271

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +  +AK  + N   + L       + ++ L++  K+   EA+ F +L E+  +      
Sbjct: 272 AVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFDVLTELYGL------ 322

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
             M +G                                             ++I+FV T+
Sbjct: 323 --MTIG---------------------------------------------SSIIFVATK 335

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
                +   LK  G+ VS ++G L    R R + +FR G + +L+ T+V ARG+DIP ++
Sbjct: 336 KTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVS 395

Query: 491 NVINFTMPSSSK------IFVHRVGRTARAGNRGWAYSIV 524
            V+N+ +P+ +        ++HR+GRT R G +G A S V
Sbjct: 396 MVVNYDLPTLANGKADPATYIHRIGRTGRFGRKGVAISFV 435

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  159 bits (402), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 194/400 (48%), Gaps = 71/400 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKLKAHSSK 191
           +L  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M+ ++    + 
Sbjct: 103 LLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGKTAAFSLTMLTRVNPEDA- 161

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
              +A+ L+PSRE+A QT +V +E  K + + S L+   DS E    +   N  V+V TP
Sbjct: 162 -SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NAQVIVGTP 216

Query: 252 GRFLHLKVEMNLNLKSVEYAVFDEADRLF-EMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           G  L L     + L+ ++  V DEAD +  + G  +Q   +   LP+  Q +LFSAT  +
Sbjct: 217 GTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFAD 276

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +  +AK  + N   + L       + ++ L++  K+   EA+ F +L E+  +      
Sbjct: 277 AVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFEVLTELYGL------ 327

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
             M +G                                             ++I+FV T+
Sbjct: 328 --MTIG---------------------------------------------SSIIFVATK 340

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
                +   LK  G+ VS ++G L    R R + +FR G + +L+ T+V ARG+DIP ++
Sbjct: 341 KTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVS 400

Query: 491 NVINFTMPSSSK------IFVHRVGRTARAGNRGWAYSIV 524
            V+N+ +P+ +        ++HR+GRT R G +G A S V
Sbjct: 401 MVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  163 bits (413), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 145/233 (62%), Gaps = 5/233 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    ++I 
Sbjct: 234 VLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQIA 293

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSDLRSV-LLTGGDSLEDQFGMMMSNPDVVVATP 251
           + R ++L+P+RE+A+Q   V  + +K  +  S  L  GG +L  Q   + S PD+V+ATP
Sbjct: 294 STRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQTLRSRPDIVIATP 353

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR + H++   + N+ SVE  V DEADR+ E GF ++LNE+++ +P KRQTLLFSAT+ +
Sbjct: 354 GRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIPSKRQTLLFSATMNS 413

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST-KHDE-REANLFYLLQEV 361
            +       L  PV + +D   + +  L   FV   K DE + A LF+L++++
Sbjct: 414 KINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPALLFHLIRKL 466

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 65/106 (61%)

Query: 419 SEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTD 478
           S+K  +VFV  +     +  +L   G  V+ ++G+L Q  R + +  F++    +L+ TD
Sbjct: 470 SQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQVPVLICTD 529

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           +A+RG+DIP +  VIN+ MP +  I++HRVGRTARAG  G + S V
Sbjct: 530 LASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFV 575

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  159 bits (401), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 193/400 (48%), Gaps = 71/400 (17%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKLKAHSSK 191
           +L  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M+ ++    + 
Sbjct: 103 LLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNPEDA- 161

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
              +A+ L+PSRE+A QT  V +E  K +++ S L+   DS E    +   N  V+V TP
Sbjct: 162 -SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIV-PDSFEKNKQI---NAQVIVGTP 216

Query: 252 GRFLHLKVEMNLNLKSVEYAVFDEADRLF-EMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           G  L L     + L+ ++  V DEAD +  + G  +Q   +   LP+  Q +LFSAT   
Sbjct: 217 GTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQLVLFSATFAE 276

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +  +AK  + N   + L       + ++ L++  K+   EA+ F +L E+  +      
Sbjct: 277 AVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFEVLTELYGL------ 327

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
             M +G                                             ++I+FV T+
Sbjct: 328 --MTIG---------------------------------------------SSIIFVATK 340

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
                +   LK  G+ VS ++G L    R R + +FR G + +L+ T+V ARG+DIP ++
Sbjct: 341 KTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVS 400

Query: 491 NVINFTMPSSSK------IFVHRVGRTARAGNRGWAYSIV 524
            V+N+ +P+ +        ++HR+GRT R G +G A S V
Sbjct: 401 MVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  157 bits (397), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 174/367 (47%), Gaps = 62/367 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 124 VLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q      +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 184 GDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
            +   A   L +P+ V++ +          L +S  H          + +V+++    E+
Sbjct: 304 EVKQLAADYLNDPIQVQVGS----------LELSASH---------TITQVVEVVSDFEK 344

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
           +  +    NK L  +   D                              E  T+VF  T+
Sbjct: 345 RDRL----NKHLETASQDD------------------------------EYKTLVFASTK 370

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
              + I++ L+  G+    I+G  DQ  R   L  FR G + ++V TDVAARG+      
Sbjct: 371 RMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVAARGI------ 424

Query: 491 NVINFTM 497
            ++NF+ 
Sbjct: 425 GMLNFSF 431

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 198/407 (48%), Gaps = 80/407 (19%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL---KAHSSKIGA---R 195
           GF   TP+Q  TIPL  +N+D+V  + TGSGKT +FV+P+ EK+   +A+++K+      
Sbjct: 26  GFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANTTKMKKGHFH 85

Query: 196 AVILSPSREIAMQTYKVFKEFSKGSD-----LRSVLLTGGD--SLEDQFGMMMSN-PDVV 247
           ++I+SP++E+A Q + VF+ F +        +RS LL G +  ++ D     M N P ++
Sbjct: 86  SLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSDFMENKPQIL 145

Query: 248 VATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSAT 307
           + TPGR L      ++        + DEADRL ++ F + +  ++  LP++R+T LFSAT
Sbjct: 146 IGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQRRTGLFSAT 205

Query: 308 LPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLA 367
           + +   +  K GL NPV V ++++S+   +L++     + D++       L++VI I   
Sbjct: 206 ITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK-------LEQVISIINN 258

Query: 368 TEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFV 427
            + +K I                                                   + 
Sbjct: 259 YKFKKCI--------------------------------------------------AYF 268

Query: 428 PTRHHVEYIS---QLLKACGYL-----VSYIYGTLDQHARRRQLYNFRAGLT-SILVVTD 478
           PT H V Y     Q L   G +     +  ++G L   AR + L  F   ++ ++L+ TD
Sbjct: 269 PTCHSVTYFYSFMQYLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAVLLTTD 328

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           VAARG+DIP +  V+    P+  ++F+HR GRT RA   G A + ++
Sbjct: 329 VAARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLT 375

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  161 bits (408), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 211/412 (51%), Gaps = 70/412 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKL--KAHS 189
           + ++I++ GF Q TP+Q+KTI  I+ N   DI+  A+TG+GKT AF+LP+ + L      
Sbjct: 170 LYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLLNTKID 229

Query: 190 SKIGARAVILSPSREIAMQTY-KVFKEFSKGSDLRS---VLLTGGDSLEDQFGMMMS-NP 244
           S+   ++VI++P+R++A+Q   +V K  SK   L++   V L GG + +     +   +P
Sbjct: 230 SQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRYIEKVSP 289

Query: 245 DVVVATPGRFLHLKVEM-NLNLKSVEYAVFDEADRLFEMGFAEQL---NELLASL----P 296
            +V+ TPGR + +  +  N   K V++ V DEADRL E+GF E L   N++L +L     
Sbjct: 290 SIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNTLNTNST 349

Query: 297 EKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
           E  +TLLFSATL     D     L+N ++             E L++ T  DE E     
Sbjct: 350 EHIRTLLFSATL-----DHKVQSLSNDIM----------NKEECLYIDTI-DENE----- 388

Query: 357 LLQEVIKIPLATE--EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSA 414
                   P A E  +Q +++GE     +D+  +  E+                      
Sbjct: 389 --------PQAHEKIDQTLVVGE---TFADNLYAAIEHIREF-----------------G 420

Query: 415 NELPSEKATIVFVPTRHHVEYISQLLKACGYLVSY-IYGTLDQHARRRQLYNFRAGLTSI 473
            + P+ K+ I+F+PT    ++++ +LK    L  Y  +G +DQ  R R +  F+     +
Sbjct: 421 TKTPNYKS-ILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNEFKTMKKGL 479

Query: 474 LVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G + + +S
Sbjct: 480 LVCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTFIS 531

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  160 bits (406), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 197/403 (48%), Gaps = 76/403 (18%)

Query: 138 INKKGFRQPTPIQRKTIPLILQN-RDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARA 196
           +  +GF + TP+Q+KT+  ILQ   D+V  A+TG+GKT AF++P+ ++L         +A
Sbjct: 141 LQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKA 200

Query: 197 VILSPSREIAMQTYKVFKEFSKGS----DLRSVLLTGGDSLEDQF-GMMMSNPDVVVATP 251
           V+++P+R++A Q +    E    +       +V++ GG S  + F  +    P++VVATP
Sbjct: 201 VVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATP 260

Query: 252 GRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFA---EQLNELLASLPEKR----QTLL 303
           GR +  L+         V++ V DEAD L E+GF    EQ+N++L  L +K     +TLL
Sbjct: 261 GRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLL 320

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKH--DEREANLFYL 357
            SATL + +   A + + +   + +D     E   +EN+    V +K   D   A+L+ +
Sbjct: 321 VSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKI 380

Query: 358 LQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANEL 417
            +E                                                    SAN  
Sbjct: 381 REEA---------------------------------------------------SAN-- 387

Query: 418 PSEKATIVFVPTRHHVEYISQLLKA-C-GYLVSYIYGTLDQHARRRQLYNFRAGLTSILV 475
           P  KA IVF+PT   VEY  +LL++ C G  V   +G L Q  R   +  FRA  + ILV
Sbjct: 388 PKLKA-IVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILV 446

Query: 476 VTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
            TDVAARG+D+  + +V    +P+S   ++HR+GRT RAG +G
Sbjct: 447 CTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 194/403 (48%), Gaps = 63/403 (15%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSS------K 191
           I+  GF   TP+Q  TIP+  +N+D+V  + TGSGKT AFV+P++EK+ A  +      K
Sbjct: 22  IDVMGFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKK 81

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKG-----SDLRSVLLTGGD--SLEDQFGMMMSN- 243
               ++I++P+RE++ Q   V + F +        +RS LL G +  S+ D     + N 
Sbjct: 82  GHFHSLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNR 141

Query: 244 PDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLL 303
           P ++V TPGR L       +  KS    V DEADRL ++ F   + ++L +LP++R+T L
Sbjct: 142 PQILVGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGL 201

Query: 304 FSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK 363
           FSAT+ +      K GL NPV + + +++K   +L + +      E EA     +Q+++ 
Sbjct: 202 FSATIGSAGSQIFKTGLRNPVKITVSSKTKAPTSLGLFYTVI---EPEAK----IQQLLS 254

Query: 364 IPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKAT 423
           I    + +K I+                                          P+  + 
Sbjct: 255 IMNNYKFKKCIV----------------------------------------YFPTCISV 274

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGL-TSILVVTDVAAR 482
             F     +++   +LL       S ++G L   +R++ L +F      ++L  TDVAAR
Sbjct: 275 TYFYSFMQYLQRDKKLLDEEVEFFS-LHGKLQTSSRQKTLDSFGKSFGKAVLFTTDVAAR 333

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           G+DIP +  VI    PS + +F+HR GRT RA   G A + ++
Sbjct: 334 GIDIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLN 376

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  157 bits (396), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 197/407 (48%), Gaps = 64/407 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEK-----LKAH 188
           I   I+  G+   TP+Q  TIPL   N+D+V  + TGSGKT AFV+P++EK     +   
Sbjct: 18  IRTAIDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIINGV 77

Query: 189 SSKIGA-RAVILSPSREIAMQTYKVFKEF-----SKGSDLRSVLLTG--GDSLEDQFGMM 240
           S K G   ++I+SP+RE++ Q   VF  F     S    ++S LL G    S+ D     
Sbjct: 78  SLKKGHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNAF 137

Query: 241 MSN-PDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR 299
             N P ++V TPGR         +   S    + DEADRL ++ F +++  +L  LP++R
Sbjct: 138 TENKPQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQR 197

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQ 359
           +T LFSAT+ +      + G+ NPV + + A+ +  E+L++ ++  K +++       LQ
Sbjct: 198 RTGLFSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDK-------LQ 250

Query: 360 EVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPS 419
           +++ I      +K I+                                          P+
Sbjct: 251 QLLNILNNFRYRKCIV----------------------------------------YFPT 270

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGL-TSILVVTD 478
            +A   F     H+  +  ++ A   + S ++G L  ++R   L  F   L +S+L+ TD
Sbjct: 271 CQAVTYFYSFIKHLCELG-IIGASLQIFS-LHGKLQTNSRLGTLTKFSQSLDSSVLLTTD 328

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           VAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + ++
Sbjct: 329 VAARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVTFLN 375

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  156 bits (395), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 194/407 (47%), Gaps = 64/407 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEK-----LKAH 188
           I   I+  GF   TP+Q  TIP+   N+D+V  + TGSGKT AF +P++EK     L   
Sbjct: 18  IRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVKEVLSGS 77

Query: 189 SSKIGA-RAVILSPSREIAMQTYKVFKEF-----SKGSDLRSVLLTGGDS--LEDQFGMM 240
             K G   ++I+SP+RE++ Q   V + F     S+   ++S L+ G  S  + D     
Sbjct: 78  PLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVRDDVSKF 137

Query: 241 MSN-PDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR 299
           + N P +++ TPGR L       +   S    V DEADRL ++ F + +  +L  LP++R
Sbjct: 138 LENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILGMLPKQR 197

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQ 359
           +T LFSAT+ +      + G+ NPV + + ++ +  E+L++ ++  K +E+  +L  ++ 
Sbjct: 198 RTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHHLLNIIN 257

Query: 360 EVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPS 419
            +         +K I+                                          P+
Sbjct: 258 NM-------RYRKCIV----------------------------------------YFPT 270

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGL-TSILVVTD 478
            +A   F     H+  IS+        V  ++G L  ++R   L  F   L  ++L+ TD
Sbjct: 271 CQAVTYFYSFLKHLSDISKTRDDLE--VYSLHGKLQTNSRIGTLAKFSTSLNIAVLLTTD 328

Query: 479 VAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           VAARG+DIP +  V+ F  P+++++F+HR GRT RA   G A + ++
Sbjct: 329 VAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFIN 375

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  154 bits (390), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 131/230 (56%), Gaps = 7/230 (3%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGA 194
            +N+N   F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ KL         
Sbjct: 90  CHNLN---FSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNKLWEDQQPY-- 144

Query: 195 RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRF 254
            A IL+P+RE+A Q  + F        +RSV + GG ++ DQ   +M  P +++ATPGR 
Sbjct: 145 YACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRKPHIIIATPGRL 204

Query: 255 L-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTL 312
           + HL+     +L+ +++ V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +
Sbjct: 205 MDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTTYLFSATMTSKI 264

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
               +A LTNPV   +  + +  E L    +      +   L YLL E I
Sbjct: 265 EKLQRASLTNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEFI 314

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K+ IVF  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG   ILV  DVA
Sbjct: 316 KSIIVFTRTKANAERLSALSNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVA 375

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 376 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 435

Query: 541 KKI 543
           KK+
Sbjct: 436 KKL 438

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  152 bits (385), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 166/360 (46%), Gaps = 66/360 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHS---S 190
           +L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A +    
Sbjct: 121 VLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQALLQP 180

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++L+P+RE+A+Q  K   +F   S +R+  + GG     Q   +    ++V+AT
Sbjct: 181 GDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLNRGSEIVIAT 240

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 241 PGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 300

Query: 311 TLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIP 365
            +   A   L++P+ V+     L A   I++ +E++    K D         L + ++  
Sbjct: 301 EVKQLAADYLSDPIQVQIGSLELAASHTITQRVEVVSGFEKRDR--------LAKHVETA 352

Query: 366 LATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIV 425
               E K+++    K + D                                         
Sbjct: 353 SQNPESKILVFASTKRMCDD---------------------------------------- 372

Query: 426 FVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVD 485
                     I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDVAARG+D
Sbjct: 373 ----------ITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGID 422

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  157 bits (396), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 117/409 (28%), Positives = 190/409 (46%), Gaps = 74/409 (18%)

Query: 134 ILNNINKKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH--SS 190
           +  +I++ GF   TP+Q+KTI P++    D++  A+TG+GKT AF++PM E L A+   S
Sbjct: 131 LYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLANRTDS 190

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGS----DLRSVLLTGGDSLEDQF-GMMMSNPD 245
           +   + V+++P+R++A+Q     ++  K +      +SV L GG + +     M    P+
Sbjct: 191 QYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFKERPN 250

Query: 246 VVVATPGRFLHLKVEMNLN-LKSVEYAVFDEADRLFEMGF-------AEQLNELLASLPE 297
           ++VATPGR   +  + +    K V++ + DEADRL E+GF       + QLN +    PE
Sbjct: 251 IIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINEKGPE 310

Query: 298 KRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKHDEREAN 353
             +TLLFSATL + + + A   +     + LD     E +  E ++   V +   E+ A+
Sbjct: 311 HIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVIS---EKFAH 367

Query: 354 LFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPS 413
             Y   E IK  LA  E                                           
Sbjct: 368 NLYAPIEEIKSQLAENEN------------------------------------------ 385

Query: 414 ANELPSEKATIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLT 471
                     I+FVPT    ++  + L+     + +   +G ++Q  R R +  F+    
Sbjct: 386 -------LKAILFVPTVKFAKFFCRSLEQILPDFPILEFHGKIEQRRRTRIVQEFKRAKR 438

Query: 472 SILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
            +LV TDV ARG+D P +  V    +PS    ++HR+GRTAR G  G A
Sbjct: 439 GLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  156 bits (394), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 194/409 (47%), Gaps = 69/409 (16%)

Query: 137 NINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           +I++ GF   T +Q+KTI  IL+N  RD++  A+TG+GKT AF++P+ E L      S  
Sbjct: 129 SISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPD 188

Query: 193 GARAVILSPSREIAMQT-YKVFKEFSKGSDLR---SVLLTGGDSL-EDQFGMMMSNPDVV 247
             +AV+L+P+R++A+Q   +V K  S    L+    + + GG    +  F +  + P+++
Sbjct: 189 MVKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNII 248

Query: 248 VATPGRFLHLKVEMNLN-LKSVEYAVFDEADRLFEMGFAEQLNELLASL-------PEKR 299
           +ATPGRF+     +     K V++ V DEADRL E+GF + L  +  SL        +  
Sbjct: 249 IATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDHI 308

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVST-KHDEREANLFYLL 358
           +TLLFSATL   +   A                 +    E LF+ T   +E E+      
Sbjct: 309 RTLLFSATLDEKVQTLA---------------DDVMNKSECLFLDTVDKNEPES------ 347

Query: 359 QEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELP 418
            E I+  L   +      E   A+ D                          L     +P
Sbjct: 348 HEKIEQSLVVSQN---FAESTYAVIDH------------------------LLKQTKNVP 380

Query: 419 SEKATIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
           + KA I+F PT    +++S LLK     Y V   +G +DQ  R R + +F+     +LV 
Sbjct: 381 NYKA-ILFTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGLLVC 439

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           TDV ARG+D P +  V+   +PS    +VHR+GRTAR G  G +   +S
Sbjct: 440 TDVGARGMDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGASVIFLS 488

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 198/415 (47%), Gaps = 80/415 (19%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL---KAHSS 190
           I   ++  GF   TP+Q  TIP++  N+D+V  + TGSGKTAAFV+P++EK+   +A++S
Sbjct: 18  IRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVKEEANTS 77

Query: 191 KIGA---RAVILSPSREIAMQTYKVFKEFSKG--SDL---RSVLLTGGD--SLEDQFGMM 240
           K       ++I++P+RE++ Q   V   F +   SDL   +  LL G +  ++ D     
Sbjct: 78  KFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVRDDVSNF 137

Query: 241 MSN-PDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR 299
           + N P +++ TPGR L       +   +    V DEADRL +M F +   ++L  LP++R
Sbjct: 138 LRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILRLLPKQR 197

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQ 359
           +T LFSAT+ +   D  K GL NPV + ++++++   +L++ +      E+       LQ
Sbjct: 198 RTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCVVNPAEK-------LQ 250

Query: 360 EVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPS 419
            ++ I                                                  N    
Sbjct: 251 LLVSI-------------------------------------------------LNNYKF 261

Query: 420 EKATIVFVPTRHHVEYISQLLKACG---YLVSYI-----YGTLDQHARRRQLYNFRAGLT 471
           +K  + F PT   V Y    ++  G    LV+ +     +G L   AR + L  F   L+
Sbjct: 262 KKCIVYF-PTCVSVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTDSLS 320

Query: 472 -SILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            S+L  TDVAARG+DIP +  VI    P+++ +F+HR GRT RA   G A + ++
Sbjct: 321 NSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLN 375

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  152 bits (385), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 126/220 (57%), Gaps = 4/220 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++  L     ++   A ILSP+
Sbjct: 87  YEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILNSL--WHDQLPYYACILSPT 144

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +R+V + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 204

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ + Y V DEADRL +M F   L+ +L  LP E R T LFSAT+ + +    +A L
Sbjct: 205 GFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTTYLFSATMTSKIDKLQRASL 264

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE 360
           TNPV   +  + +  + L    +      +   L YLL E
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 541 KKI 543
           KK+
Sbjct: 428 KKL 430

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  152 bits (385), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 104 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 161

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RSV + GG ++ DQ   +M  P V++ATPGR + HL+   
Sbjct: 162 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHVIIATPGRLMDHLENTK 221

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ ++Y V DEADRL +M F   L+ +L  LP + R T LFSAT+ + +    +A L
Sbjct: 222 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 281

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 282 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEYI 323

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 541 KKI 543
           KK+
Sbjct: 445 KKL 447

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 143

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEK-RQTLLFSATLPNTLVDFAKAGL 320
             +L+ + + V DEADRL +M F   L+ +L ++P K R T LFSAT+ + +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFI 305

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 74/123 (60%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K+TIVF  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 541 KKI 543
           KK+
Sbjct: 427 KKL 429

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG S+ DQ   +M  P +++ATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             NL+ ++Y V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score =  102 bits (253), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 74/123 (60%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K+TIVF  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 541 KKI 543
           KK+
Sbjct: 428 KKL 430

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score =  152 bits (383), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 120/406 (29%), Positives = 189/406 (46%), Gaps = 74/406 (18%)

Query: 134 ILNNI-NKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLK------ 186
           +LN I N   + +PT IQR TIP ++ NRD +G+A TGSGKT AF+LP++ KL       
Sbjct: 148 LLNIITNDLHYNEPTSIQRSTIPNVINNRDFIGVASTGSGKTLAFLLPILIKLHGIPPLN 207

Query: 187 AHSSKIGARAVILSPSREIAMQTYK----VFKEFSKGSDLRSVLLTGGDSLEDQFGMMMS 242
           + +   G  A++L+P+RE+A Q       + K + +  ++ S++  GG SLE+    +  
Sbjct: 208 SITKHDGPLALVLAPTRELAQQIQHEGQSITKLWKRPCNIVSIV--GGHSLEEISANLRD 265

Query: 243 NPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTL 302
             D++VATPGR L       L LK V   V DEAD++                       
Sbjct: 266 GCDILVATPGRLLDCLDSHLLFLKQVNTLVLDEADKM----------------------- 302

Query: 303 LFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHD--EREANLFYLLQE 360
                     +DF   G  + +   L     IS    M+F +T     E+ AN +  L++
Sbjct: 303 ----------IDF---GFEDQLTTILAKTETISNRQTMMFTATFSPTIEKVANGY--LKK 347

Query: 361 VIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSE 420
              + +  EE K  + +  + + D E+                       +   + LP+ 
Sbjct: 348 PSYVTVGGEESKPKIKQIVRYVPDEEEK--------------------LKILVKDFLPNY 387

Query: 421 KA-TIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           KA  I+F+  +   +++   L+   +  + ++G+  Q  R   L   R G   IL+ TDV
Sbjct: 388 KAPIIIFINYKRTADWLFDKLREARFRATTLHGSKSQEQREHSLSLLRNGKVDILIATDV 447

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           A RG+DIP ++ V+N   P S   FVHRVGRT RAG  G A + ++
Sbjct: 448 AGRGIDIPNVSLVVNLQFPKSFDSFVHRVGRTGRAGKTGTALTFLT 493

>ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38112 Saccharomyces cerevisiae YBR142W MAK5
           Essential nucleolar protein putative DEAD-box RNA
           helicase required for maintenance of M1 dsRNA virus
           involved in biogenesis of large (60S) ribosomal subunits
          Length = 751

 Score =  154 bits (389), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 131/434 (30%), Positives = 207/434 (47%), Gaps = 92/434 (21%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL---KAHSS 190
           +LN ++++GF +PT IQ++ +PL L+N DI+G A TGSGKT A+ +P++E L     HS 
Sbjct: 196 VLNGLSQQGFTKPTDIQKEVLPLALKNEDIMGKAATGSGKTLAYGIPLLESLVHEPDHSK 255

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFS----KGSDLRSVLLTGGDSLEDQFGMMM--SNP 244
            IG   +I +P+RE+A Q  +  K+      + S    + LTGG S++ Q  ++   ++ 
Sbjct: 256 SIG---LIFTPTRELAQQVTQHLKKLGQLIIQKSKFAILPLTGGLSIQKQERILKYENSA 312

Query: 245 DVVVATPGRFLHLKVEMNLNL----KSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR- 299
            +VVATPGRFL L +E N++L      +   V DEADRL + G  ++  ++L  L   R 
Sbjct: 313 RIVVATPGRFLEL-IEKNIDLIPRFARINTLVLDEADRLLQDGHFDEFEKILKLLGGARK 371

Query: 300 -------QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREA 352
                  QT++FSAT   +L  F+K    +   ++ D                  DE E 
Sbjct: 372 SFDKTGWQTMIFSATFSLSL--FSKLATASWKSLKKD-----------------EDEMEQ 412

Query: 353 NLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLP 412
            L +L+Q   KI   ++   +      K  S   +S  E G                  P
Sbjct: 413 VLKHLMQ---KIRFKSKPVIVDTNSEEKIKSQIRESLIECG------------------P 451

Query: 413 SANELPS-------EKATIVFVPTRHHVEYISQLLKACGYLVSY------IYGTLDQHAR 459
              +L S          T++F  +      I  + K C Y  +       I+ ++ Q  R
Sbjct: 452 MERDLYSYYFLAMYPGTTLIFCNS------IDSVKKLCAYFNNLKIDAFQIHSSMTQKNR 505

Query: 460 RRQL--------YNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRT 511
            R L         N      ++LV +DVAARG+DIP + +V+++ +P ++  ++HR GRT
Sbjct: 506 LRSLERYLQKSAQNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTYIHRSGRT 565

Query: 512 ARAGNRGWAYSIVS 525
           ARA N G +  I S
Sbjct: 566 ARADNEGVSVMICS 579

>TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {ON}
           Anc_1.211 YJL138C
          Length = 396

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 176/374 (47%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +E++   SS   
Sbjct: 34  LLKGVYGYGFEEPSAIQQRAILPIVEKHDVLAQAQSGTGKTGTFSIAALERID--SSIKS 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A+IL+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALILAPTRELALQIQKVVIALALHMDVKVHACIGGTSFVEDSEGL--RDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             +++  + DEAD +   GF EQ+ ++   LP   Q +L SATLPN +
Sbjct: 150 RVSDNIQRRRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPNDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +++ + D+ + +                   
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYINVEEDDYKFD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L+D  DS                              S    ++F  TR  
Sbjct: 251 --------CLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQKLTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  150 bits (379), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ +L     K    A +L+P+
Sbjct: 92  FDKPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPT 149

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A QT + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 150 RELAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTK 209

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ + + V DEADRL +M F   L+++L  +P + R T LFSAT+ + +    +A L
Sbjct: 210 GFSLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASL 269

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           T PV   +  + +  + L    +      +   L YLL E I
Sbjct: 270 TEPVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNENI 311

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 541 KKI 543
           KK+
Sbjct: 433 KKL 435

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 106 FAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 163

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 164 RELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YL+ E I
Sbjct: 284 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEFI 325

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  IVF  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 327 KTIIVFTRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVA 386

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 541 KKI 543
           KK+
Sbjct: 447 KKL 449

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  150 bits (378), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 102 YTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 159

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 160 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 219

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ ++Y V DEADRL +M F   L+ +L  LP + R T LFSAT+ + +    +A L
Sbjct: 220 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 279

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      ++  L YLL E I
Sbjct: 280 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEFI 321

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 541 KKI 543
           KK+
Sbjct: 443 KKL 445

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 196/404 (48%), Gaps = 71/404 (17%)

Query: 138 INKKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFVLPMIEKL---KAHSSKIG 193
           +++  F   TP+Q+KTI P++    D++  A+TG+GKT AF++P+ E L   +  S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSD----LRSVLLTGGDSLEDQFGMMMSN-PDVVV 248
            + VI++P+R++A+Q     ++  K +      +S+ L GG + +     M  + P++VV
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 249 ATPGRFLHLKVEMNLN-LKSVEYAVFDEADRLFEMGFAEQ-------LNELLASLPEKRQ 300
           ATPGR + +  + +    K V++ V DEADRL E+GF E        LN + A+ PE  +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 301 TLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE 360
           TLLFSATL + +   A AG+ N                E LF+ T               
Sbjct: 297 TLLFSATLGDNVQKLA-AGIMN--------------RKESLFLDTVD------------- 328

Query: 361 VIKIPLATE--EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELP 418
            +  P A E  +Q++++ E   +   +  S  +N                  L + NE P
Sbjct: 329 -VNEPEAHEKIDQRLVISENFASNLYAPISAIKN-----------------RLATNNE-P 369

Query: 419 SEKATIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVV 476
            +   I+FVPT    ++   +L+       V   +G +DQ  R + +  F+     I V 
Sbjct: 370 FK--AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVC 427

Query: 477 TDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
           TDV ARG+D P +  V+   +PS    ++HR+GRTAR G  G A
Sbjct: 428 TDVGARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P ++R T LFSAT+ + +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 320

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 541 KKI 543
           KK+
Sbjct: 442 KKL 444

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ +L    S     A ILSP+
Sbjct: 101 FTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILNRLWHDQSPY--YACILSPT 158

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F         R+  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 278

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           T+PV   +  + +  + L    +      +   L YLL E I
Sbjct: 279 TDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 320

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 541 KKI 543
           KK+
Sbjct: 442 KKL 444

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 127/223 (56%), Gaps = 4/223 (1%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P
Sbjct: 104 GFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAP 161

Query: 202 SREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVE 260
           +RE+A Q  + F        +R+  + GG ++ DQ   +M  P +++ATPGR + HL+  
Sbjct: 162 TRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENT 221

Query: 261 MNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAG 319
              +L+ + + V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A 
Sbjct: 222 RGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRAS 281

Query: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           LTNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 282 LTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 324

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  IVF  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 326 KTVIVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 385

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 386 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 445

Query: 541 KKI 543
           KK+
Sbjct: 446 KKL 448

>KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa]
           {ON} Anc_8.402 YDR194C
          Length = 623

 Score =  150 bits (380), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 123/413 (29%), Positives = 197/413 (47%), Gaps = 71/413 (17%)

Query: 138 INKKGFRQPTPIQRKTI-PLILQNR-DIVGMARTGSGKTAAFVLPMIEKL--KAHSSKIG 193
           I++ GF   TP+Q+KTI P I+ N  DI+  A+TG+GKT AF++P+ + L      S+  
Sbjct: 92  IDRMGFPNLTPVQQKTIKPTIMNNENDIIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 151

Query: 194 ARAVILSPSREIAMQ----TYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMS-NPDVVV 248
            +++I++P+R++A+Q      K++K        + V L GG +L +    M    P++++
Sbjct: 152 VKSIIITPTRDLALQIEDEAKKLYKNNYGLKKFQCVSLIGGTNLNESIRRMKKLRPNIII 211

Query: 249 ATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNE---LLASLPEKRQ---- 300
           ATPGR +  L    N   + V++ V DEADRL E+GF E L E   +L  + E+ +    
Sbjct: 212 ATPGRLIDVLNRYGNEFFRFVDFKVLDEADRLLEIGFKEDLREISNILNEISERDENHIR 271

Query: 301 TLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQE 360
           T+LFSATL   +       L+N ++             + LF+ T  D+ E         
Sbjct: 272 TMLFSATLDENV-----QNLSNDIM----------NKEKCLFIDTI-DKNE--------- 306

Query: 361 VIKIPLATE--EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELP 418
               P A E  +Q M+L           D  A N                  L   +E+ 
Sbjct: 307 ----PEAHEKIDQSMVLS----------DHFAHN-------IYAAANHIQSRLSQDSEMK 345

Query: 419 SEKATIVFVPTRHHVEYISQLL------KACGYLVSYIYGTLDQHARRRQLYNFRAGLTS 472
                I+F PT    ++I+ +L      K     +   +G +DQ  R R +  F+   + 
Sbjct: 346 DNYKAILFTPTVKFTKFITGVLYDKLHSKYRDLPIIEFHGQIDQKKRTRLVEQFKRLKSG 405

Query: 473 ILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           IL+ TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G +   +S
Sbjct: 406 ILICTDVGARGMDFPDVKEVLQIGVPSELSNYIHRIGRTARSGKDGISTLFIS 458

>TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   S+   
Sbjct: 33  LLRGVFGYGFEDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--SALKS 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSL-EDQFGMMMSNPDVVVATPG 252
            +A+IL+P+RE+A+Q  KV    +   D++     GG S  ED  G+   +  +VV TPG
Sbjct: 91  PQALILAPTRELALQIQKVVIALAFHMDIKVHACIGGTSFQEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             S++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 149 RVFDNIQRRKFKTDSIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPKDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +++ +            QE+ K         
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIQQFYINVE------------QELYK--------- 247

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L+D  DS                              S    ++F  TR  
Sbjct: 248 ------YDCLTDLYDS-----------------------------ISVTQAVIFCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q LKA  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTQKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPTNKENYIH 346

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  148 bits (373), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P ++R T LFSAT+ + +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 320

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 541 KKI 543
           KK+
Sbjct: 442 KKL 444

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  145 bits (366), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 177/374 (47%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF  P+ IQ++ I  I+++ D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVYGYGFENPSAIQQRAIMPIIESHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    S   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALSFHMDVKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             +++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P+ +
Sbjct: 149 RVFDNIQRRKFKTDNIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPSDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ + ++ +                     
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQYKY-------------------- 248

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 249 -------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L A  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTQKLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPTNKENYIH 346

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 125/222 (56%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ KL          A +L+P+
Sbjct: 93  FTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILNKLWEDQQPY--YACVLAPT 150

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +R+  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 151 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 210

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEK-RQTLLFSATLPNTLVDFAKAGL 320
             +LK++++ V DEADRL +M F   L+ +L  +P K R T LFSAT+ + +    +A L
Sbjct: 211 GFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTTYLFSATMTSKIDKLQRASL 270

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 271 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 312

 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 541 KKI 543
           KK+
Sbjct: 434 KKL 436

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P ++R T LFSAT+ + +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNESI 322

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 68/105 (64%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 and highly similar to
           uniprot|P10081 Saccharomyces cerevisiae YJL138C
           TIF2translation initiation factor eIF4A
          Length = 396

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 170/374 (45%), Gaps = 60/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ++ I  I +  D++  A++G+GKT  F +  ++K+     KI 
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQKI---DPKIK 89

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           A +A++L+P+RE+A+Q  KV    +   D++     GG S  +    +     +VV TPG
Sbjct: 90  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDGAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R   +          ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 150 RVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPQDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NP+ + +  +    E ++  F++ + ++ + +                   
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYKYD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    LSD  DS                              S    ++F  TR  
Sbjct: 251 --------CLSDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L A  + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  147 bits (371), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RS  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL +M F   L+ +L  +P ++R T LFSAT+ + +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E I
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 322

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 541 KKI 543
           KK+
Sbjct: 444 KKL 446

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 131/231 (56%), Gaps = 8/231 (3%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGA 194
            +N+N   F +PTPIQ K IP  LQ +DI+G+A+TGSGKTAAF +P++ +L  H  +   
Sbjct: 81  CDNLN---FTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PY 135

Query: 195 RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRF 254
            A IL+P+RE+A Q  + F        +R+  + GG ++ DQ   +M  P +++ATPGR 
Sbjct: 136 YACILAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRL 195

Query: 255 L-HLKV-EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEK-RQTLLFSATLPNT 311
           + HL+V +    L+  ++ V DEADRL  M F   L+ +L ++P K R T LFSAT+ + 
Sbjct: 196 MDHLEVHKRGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRTTYLFSATMTSK 255

Query: 312 LVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           +    +A LTN V   +  + +  + L    +      +   L YLL E I
Sbjct: 256 IDKLQRASLTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEFI 306

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 73/123 (59%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K TIVF  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KTTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKKSILVATDVA 367

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDLVINYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 427

Query: 541 KKI 543
           KK+
Sbjct: 428 KKL 430

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  147 bits (370), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 119/195 (61%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 54  LLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIPTLEKIKPKLNKI- 112

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +  +  V+V TPGR
Sbjct: 113 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNESVHVLVGTPGR 171

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L   +  + DEAD++    F   + ++L  LP+K Q+LLFSAT P T+ 
Sbjct: 172 VLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQSLLFSATFPLTVK 231

Query: 314 DFAKAGLTNPVLVRL 328
           +F    LTNP  + L
Sbjct: 232 EFMVKHLTNPYEINL 246

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 385

>KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059W TIF1 translation initiation factor eIF4A
          Length = 396

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 173/374 (46%), Gaps = 60/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF +P+ IQ++ I  I++ +D++  A++G+GKT  F +  ++ +     KI 
Sbjct: 33  LLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTFSIAALQNI---DEKIK 89

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           A + +IL+P+RE+A+Q  KV    +   D++     GG SL++    +     ++V TPG
Sbjct: 90  APQGLILAPTRELALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIIVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R   +         +++  + DEAD +   GF EQ+  +   LP   Q +L SAT+P  +
Sbjct: 150 RVFDMIDRRIFKTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + +PV + +  +    E +   +V+ + ++ + +                   
Sbjct: 210 LEVTSKFMKDPVRILVKKDELTLEGIGQYYVNVEEEQYKYD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L+D  DS                              S    ++F  TR  
Sbjct: 251 --------CLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE +++ L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTERLRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +PS+ + ++H
Sbjct: 334 INYDLPSNKENYIH 347

>Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa]
           {ON} complement(135570..136760) [1191 nt, 397 aa]
          Length = 396

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   SS   
Sbjct: 34  LLKGVYGYGFEEPSAIQQRAILPIVEEHDVLAQAQSGTGKTGTFSIAALQRID--SSIKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A+IL+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALILAPTRELALQIQKVVIALAFHMDVKVHACIGGTSFVEDTEGL--KDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             +++  + DEAD +   GF EQ+ ++   LP   Q +L SATLP  +
Sbjct: 150 RVSDNIQRHRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPGDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NP+ + +  +    E ++  +++ + ++ + +                   
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEQYKFD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    LSD  DS                              S    ++F  TR  
Sbjct: 251 --------CLSDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQKLTESNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 188/403 (46%), Gaps = 69/403 (17%)

Query: 138 INKKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH--SSKIGA 194
           +++  F   TP+Q+KT+ P++    D++  A+TG+GKT AF++P+ E L      S    
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYMV 178

Query: 195 RAVILSPSREIAMQ----TYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMM-SNPDVVVA 249
           + VI++P+R++A+Q      K+ K        +S+ L GG + +     M    P++VVA
Sbjct: 179 KCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVVA 238

Query: 250 TPGRFLHLKVEMNLN-LKSVEYAVFDEADRLFEMGFAEQLNELLASL-------PEKRQT 301
           TPGR + +  + +    K V++ V DEADRL E+GF E L E+  +L       PE  +T
Sbjct: 239 TPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIRT 298

Query: 302 LLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEV 361
           LLFSATL + +   A               S I +  + LF+ T  D+ E          
Sbjct: 299 LLFSATLGDNVQKLA---------------SGIMDRKQCLFLDTV-DKNE---------- 332

Query: 362 IKIPLATE--EQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPS 419
              P A E  EQ +++           D+ A N                    + N+ P 
Sbjct: 333 ---PEAHERIEQSLVI----------SDTFAHNMYAPISAIKDRI--------AENDKPF 371

Query: 420 EKATIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVT 477
           +   I+FVPT    ++   +L+       V   +G +DQ  R + +  F+     I V T
Sbjct: 372 K--AILFVPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCT 429

Query: 478 DVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
           DV ARG+D P +  V    +PS    ++HR+GRTAR G  G A
Sbjct: 430 DVGARGMDFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKA 472

>Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii ADR260C
          Length = 438

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/389 (27%), Positives = 177/389 (45%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L   + ++    V+L  
Sbjct: 73  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVAGEVSV--VVLCN 130

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG        ++ +    P +VVATPGR   L
Sbjct: 131 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIELLKNKETAPHIVVATPGRLKAL 190

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             + N++L  V+  V DE D++ E +     + ++  + P  +Q ++FSATL   +    
Sbjct: 191 VRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 250

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 251 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 283

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 284 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTLRANEL 314

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 315 TKLLNASNFPAITVHGHMKQEKRIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 374

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           MPS +  ++HRVGR  R G +G A S+VS
Sbjct: 375 MPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar to
           Ashbya gossypii AGL112C
          Length = 658

 Score =  148 bits (374), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 191/405 (47%), Gaps = 75/405 (18%)

Query: 138 INKKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFVLPMIEKL----KAHSSKI 192
           +  + F   TP+Q++TI P+++ + D+V  A+TG+GKT AF++PM ++L      +S K+
Sbjct: 130 VKMQNFESLTPVQQRTIKPILMTSNDVVARAKTGTGKTMAFLIPMFQRLFMTQNEYSDKV 189

Query: 193 GARAVILSPSREIAMQT-YKVFKEFSKGSDLR---SVLLTGGDSLEDQFGMMMSN-PDVV 247
             + V+++P+R++A Q  ++V K       LR   S+ L GG SL +    M  + P +V
Sbjct: 190 --KCVVVAPTRDLAEQIQFEVLKLQKANKALRKFSSICLIGGTSLVNSMRRMDRHAPSIV 247

Query: 248 VATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASL-------PEKR 299
           +ATPGR L  +    +    +V++ V DEAD L ++GF   L  + ++L        E  
Sbjct: 248 IATPGRLLDVMGNSGDKYFNAVDFKVLDEADTLLDIGFKADLQRISSTLNSLNQKGAEHI 307

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKH-DEREANLFYLL 358
           +TLLFSAT+ + + + A               + I      LF+ T H DE EA+     
Sbjct: 308 RTLLFSATISSNVQELA---------------NNIMNGDTCLFIDTVHKDEPEAH----- 347

Query: 359 QEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELP 418
            E I        Q +I+ E          S A N                        L 
Sbjct: 348 -EKIT-------QNLIVSE----------SYAHNLVAPVETIEK-------------HLK 376

Query: 419 SEK-ATIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILV 475
             K   I+F+PT   VE+   LLK       +S  +G + Q  R R +  F+A    + +
Sbjct: 377 KRKFKAILFLPTVKSVEFYGNLLKKLFRSLPISLFHGKVSQQRRSRLVKEFKASKHGLFI 436

Query: 476 VTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
            TDV ARG+D P + +V    +PS    +VHR+GRTAR G  G A
Sbjct: 437 CTDVGARGMDFPEVDHVYQLGVPSGLSNYVHRIGRTARGGREGEA 481

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  146 bits (368), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ KL          A I++P+
Sbjct: 106 YEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIPILNKLWEDQQPY--YACIMAPT 163

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +RSV + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 164 RELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +L+ +++ V DEADRL ++ F   L+ +L  LP + R T LFSAT+ + +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YL+ E +
Sbjct: 284 TNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLINEFV 325

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K+ I+F  T+ + E +S L     +    ++G L+Q+ R   L  F+AG  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSXXXXXXXXXXXXXXG 540
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 541 KKI 543
           KK+
Sbjct: 447 KKL 449

>TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {ON}
           Anc_8.402 YDR194C
          Length = 676

 Score =  148 bits (374), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 194/408 (47%), Gaps = 78/408 (19%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNR--DIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGA- 194
           +N  GF   TP+Q+KTI  IL+N   D++  A+TG+GKT AF+LP++E L   S+  G+ 
Sbjct: 148 VNAMGFPSLTPVQQKTIKPILENDKVDVITRAKTGTGKTFAFLLPIMEHL-MRSNVAGSD 206

Query: 195 --RAVILSPSREIAMQTYKVFKE-FSKGSDLR---SVLLTGGDSLEDQFGMMMS-NPDVV 247
             R+VI++P+R++A+Q  +  ++ +SK  +LR   S+ L GG        +++   P +V
Sbjct: 207 SVRSVIVAPTRDLALQIEEELRKIYSKNRELRKFGSLSLVGGTDYRRAIRILLDKQPSIV 266

Query: 248 VATPGRFLHLKVEMNLN-LKSVEYAVFDEADRLFEMGF-------AEQLNELLASLPEKR 299
           + TPGR +    E      K V++ V DEADRL E+GF       +  LN+L +      
Sbjct: 267 IGTPGRLIQTLDEYGEQCFKDVDFKVLDEADRLLEIGFKTDLEYISSTLNKLNSKGEAHI 326

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESK----ISENLEMLFVSTKHDEREANLF 355
           +TLLFSATL + +   A   +     + LD   K      EN++   V T  D    +LF
Sbjct: 327 RTLLFSATLDDKVQILANDIMNKDECLFLDTVDKNAPEAHENIDQSVVMT--DSYADSLF 384

Query: 356 YLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSAN 415
             +Q  IK  + TE                                              
Sbjct: 385 ATIQH-IKNKVDTE---------------------------------------------- 397

Query: 416 ELPSEKATIVFVPTRHHVEYIS-QLLKACG--YLVSYIYGTLDQHARRRQLYNFRAGLTS 472
             P  KA I+F PT     YI  +L K  G  + +   +G + Q  R   + +F+   + 
Sbjct: 398 --PEYKA-ILFSPTVKLTTYICNRLYKVFGRSFPILEFHGKISQARRTYLVKDFKKIKSG 454

Query: 473 ILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
           +LV TDV ARG+D P +  V+   +P+    +VHR+GRTARAG  G +
Sbjct: 455 LLVCTDVGARGMDFPNVGEVLQLGVPTELANYVHRIGRTARAGKEGAS 502

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 125/191 (65%), Gaps = 4/191 (2%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  +N+  F Q T IQR +IP+ L+  D++G ARTGSGKT AF++P++EKL  +  ++  
Sbjct: 53  LKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEKLYREKWTAFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +  + +   + L+ GG  ++ +    +S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERISKINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L HL   + L+  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT  N+
Sbjct: 172 RVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQTLLFSATQSNS 231

Query: 312 LVDFAKAGLTN 322
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  VI    P     ++HRVGRT R G +G
Sbjct: 355 RGIDFPAVNWVIQVDCPEDVDTYIHRVGRTGRYGKKG 391

>NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 34  LLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             S++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 150 RVFDNIQRRRFRTDSIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPRDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +                      EEQ 
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----------------------EEQF 247

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 248 -----KYECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L A  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQKLTADDFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa]
           {ON} Anc_8.402
          Length = 716

 Score =  148 bits (373), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 185/410 (45%), Gaps = 85/410 (20%)

Query: 138 INKKGFRQPTPIQRKTIPLILQ---NRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           I++ GF   +P+Q++TI  IL    N D++  A+TG+GKT AF++PM + L      S+ 
Sbjct: 176 ISRMGFPGLSPVQQRTIKPILSSTTNDDVIARAKTGTGKTFAFLIPMFQHLINTQLDSRY 235

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGS----DLRSVLLTGGDSLEDQFGMMMS-----N 243
             + VI++P+R++A+Q     K+    +        V L GG +    FGM M       
Sbjct: 236 MVKCVIVAPTRDLALQIEAEVKKIHDHNYGLKKFGCVSLVGGTN----FGMAMRRMDQIR 291

Query: 244 PDVVVATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQ-------LNELLASL 295
           P++V+ATPGR +  L+   N   K V++ + DEADRL E+GF E        LN++ A  
Sbjct: 292 PNIVIATPGRLIDVLQKYGNKFFKYVDFKILDEADRLLEIGFKEDLEFVSGYLNDINAKA 351

Query: 296 PEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKHDERE 351
            +  +TLLFSATL   +   A   +     + LD     E +  E ++   V T H    
Sbjct: 352 KDHIRTLLFSATLDEKVQVLANEIMNKDQCLFLDTVDKNEPEAHEKIDQAVVVTNH---- 407

Query: 352 ANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXL 411
                   E +   L   +++++   G K                               
Sbjct: 408 ------FAESVYATLDHLQKQIVADPGYKG------------------------------ 431

Query: 412 PSANELPSEKATIVFVPTRHHVEYISQLLK---ACGYLVSYIYGTLDQHARRRQLYNFRA 468
                       I+F PT     +I++LL+        V   +G LDQ  R   + NF+ 
Sbjct: 432 ------------ILFAPTVKFTRFIAKLLQKEFTNDLPVLEFHGQLDQRRRTNLVNNFKK 479

Query: 469 GLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
               +LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G
Sbjct: 480 MEKGLLVCTDVGARGMDFPNVKEVLQVGVPSELPNYIHRIGRTARSGKEG 529

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  145 bits (365), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 99  YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 156

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +R+  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 157 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 216

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +++ ++Y V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 217 GFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 276

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E +
Sbjct: 277 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFL 318

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 68/105 (64%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 320 KTVIIFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVA 379

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS
Sbjct: 380 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059w TIF1 or uniprot|P10081 Saccharomyces cerevisiae
           YJL138c TIF2
          Length = 396

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 174/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++        
Sbjct: 34  LLRGVFGYGFNKPSAIQQRAIMPIIEGNDVLAQAQSGTGKTGTFSIAALQRIDPAIK--A 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV        D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALMLAPTRELALQIQKVVMALGFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R           + +++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 150 RVFDNIQRRKFKVDNIKMFILDEADEMLSTGFKEQIYQIFTMLPPTTQVVLLSATMPRDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ + ++ + +                   
Sbjct: 210 LEVTAKFMQNPVRILVKKDELTLEGIKQFYVNVEEEQFKYD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L+D  DS                              S    ++F  TR  
Sbjct: 251 --------CLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L A  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQRLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL138C
           (TIF2) and YKR059W (TIF1)
          Length = 396

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 169/373 (45%), Gaps = 58/373 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++    S   
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--ESIKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+IL+P+RE+A+Q  KV    +   D++     GG    +    + +   +VV TPGR
Sbjct: 91  PQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVGTPGR 150

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
              +    N     ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  ++
Sbjct: 151 VFDMIERRNFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMPKEVL 210

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
           D     +  PV + +  ++   E ++  +++ + +E + +                    
Sbjct: 211 DVTDKFMNKPVRILVKKDALTLEGIQQYYINVESEEYKYD-------------------- 250

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
                   LSD  DS                              S    ++F  TR  V
Sbjct: 251 -------CLSDLYDS-----------------------------ISVTQAVIFCNTRRKV 274

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
           E +++ L    + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ VI
Sbjct: 275 EELTKRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVI 334

Query: 494 NFTMPSSSKIFVH 506
           N+ +P++ + ++H
Sbjct: 335 NYDLPNNKENYIH 347

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  147 bits (371), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 191/408 (46%), Gaps = 76/408 (18%)

Query: 137 NINKKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           +I++  F   T +Q+KTI  I+Q+  +D++  A+TG+GKT AF++P+ + L      S+ 
Sbjct: 112 SISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLINTRRDSQY 171

Query: 193 GARAVILSPSREIAMQ----TYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMS-NPDVV 247
             + VI++P+R++A+Q     +K+ +          V L GG +       M S  P++V
Sbjct: 172 MVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTNFGSAMRKMSSVRPNIV 231

Query: 248 VATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQ-------LNELLASLPEKR 299
           +ATPGR +  L    +   K V++ + DEADRL E+GF E        LNE+    P+  
Sbjct: 232 IATPGRLMAVLDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDTLNEINDKSPDHI 291

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKHDEREANLF 355
           +TLLFSATL + +   A   +     V LD     E +  E +E   V +   ER A+  
Sbjct: 292 RTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMVIS---ERMAHSI 348

Query: 356 YLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSAN 415
           Y   + IK       QKM+          SE                             
Sbjct: 349 YAAVDHIK-------QKMV----------SE----------------------------- 362

Query: 416 ELPSEKATIVFVPTRHHVEYISQLLK---ACGYLVSYIYGTLDQHARRRQLYNFRAGLTS 472
             P+ KA I+F PT     ++S +L+        V   +G +DQ  R   +  F+   + 
Sbjct: 363 --PNYKA-ILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVNQFKRDKSG 419

Query: 473 ILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
           +LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR G  G +
Sbjct: 420 LLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSS 467

>YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON}
           TIF2Translation initiation factor eIF4A, identical to
           Tif1p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  142 bits (358), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI--DTSVKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 149 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +                      EE K
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEE---------------------EEYK 247

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 248 Y------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPANKENYIH 346

>YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}
           TIF1Translation initiation factor eIF4A, identical to
           Tif2p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  142 bits (358), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI--DTSVKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 149 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +                      EE K
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEE---------------------EEYK 247

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 248 Y------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPANKENYIH 346

>Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059W
           (REAL)
          Length = 396

 Score =  142 bits (357), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 34  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSVAALQRI--DTSVKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--KDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 150 RVFDNMQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +    E +  Y                
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----EEDFKY---------------- 249

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 250 -------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +PS+ + ++H
Sbjct: 334 INYDLPSNKENYIH 347

>Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C
           (REAL)
          Length = 396

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 34  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSVAALQRI--DTSVKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--KDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 150 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +    E +  Y                
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----EEDFKY---------------- 249

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 250 -------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +PS+ + ++H
Sbjct: 334 INYDLPSNKENYIH 347

>NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 34  LLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--TSIKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R             +++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 150 RVFDNIQRGRFRTDAIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVLLSATMPRDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NP+ + +  +    E ++  +V+ +                      EE K
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFYVNVEE---------------------EEFK 248

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 249 Y------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++Q L A  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTQKLTADNFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL084W
           (SUB2)
          Length = 438

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/389 (27%), Positives = 176/389 (45%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V+L  
Sbjct: 73  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV--VVLCN 130

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG        ++ +    P +VVATPGR   L
Sbjct: 131 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIELLKNKDTAPHIVVATPGRLKAL 190

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             + N++L  V+  V DE D++ E +     + ++  + P  +Q ++FSATL   +    
Sbjct: 191 VRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 250

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  I++    EE+     
Sbjct: 251 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIRL----EER----- 283

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 284 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTLRANEL 314

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 315 TKLLNASNFPAITVHGHMRQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 374

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           MPS +  ++HRVGR  R G +G A S+VS
Sbjct: 375 MPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 translation initiation factor
           eIF4A and highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YJL138C TIF2
          Length = 397

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 168/373 (45%), Gaps = 58/373 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF  P+ IQ++ I  I +  D++  A++G+GKT  F +  ++++    +   
Sbjct: 34  LLRGVYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFTIAALQRID--ETIKA 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+IL+P+RE+A+Q  KV    +   D+      GG S  +    + +   +VV TPGR
Sbjct: 92  PQALILAPTRELALQIRKVVMALAFHMDINVHACIGGTSFVEDAEALRNGAQIVVGTPGR 151

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
              +          ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  ++
Sbjct: 152 VFDMIERRKFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPGDVL 211

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
           +     + NP+ + +  +    E ++  +++ + ++ + +                    
Sbjct: 212 EVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEDYKYD-------------------- 251

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
                   LSD  DS                              S    ++F  TR  V
Sbjct: 252 -------CLSDLYDS-----------------------------ISVTQAVIFCNTRRKV 275

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
           E ++Q L A  + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ VI
Sbjct: 276 EELTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVI 335

Query: 494 NFTMPSSSKIFVH 506
           N+ +P++ + ++H
Sbjct: 336 NYDLPTNKENYIH 348

>KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081)
           [1320 bp, 439 aa] {ON} similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 439

 Score =  142 bits (358), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 106/389 (27%), Positives = 179/389 (46%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 74  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV--VVICN 131

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMM---SNPDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++    + P +VVATPGR   L
Sbjct: 132 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPITKDAELLKNKETAPHIVVATPGRLKAL 191

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             +  ++L SV+  V DE D++ E +G  + + ++  + P  +Q ++FSATL   +    
Sbjct: 192 VRDKIIDLSSVKNFVIDECDKVLEELGMRKDVQDIFRATPRDKQVMMFSATLSQEMRPIC 251

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 252 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 284

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV + +    +
Sbjct: 285 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTNRANEL 315

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 316 TKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 375

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +PS +  ++HRVGR  R G +G A S V+
Sbjct: 376 LPSEADQYLHRVGRAGRFGTKGLAISFVA 404

>Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {ON}
           YKR059W (TIF1) - translation initiation factor eIF4A
           [contig 106] FULL
          Length = 396

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 169/374 (45%), Gaps = 60/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ++ I  I +  D++  A++G+GKT  F +  ++++     KI 
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQQI---DPKIK 89

Query: 194 A-RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           A +A++L+P+RE+A+Q  KV    +   D++     GG S  +    +     +VV TPG
Sbjct: 90  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDGAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R   +          ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  +
Sbjct: 150 RVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPQDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NP+ + +  +    E ++  F++ + ++ + +                   
Sbjct: 210 LEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYKYD------------------- 250

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    LSD  DS                              S    ++F  TR  
Sbjct: 251 --------CLSDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L A  + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTSRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  143 bits (361), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 114/195 (58%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 40  LLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIPTLEKIKPKVNKI- 98

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+IL P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 99  -QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLHEPVHVLVGTPGR 157

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      V DEAD++    F   + ++L+  P+ RQ+LLFSAT P T+ 
Sbjct: 158 VLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQSLLFSATFPLTVK 217

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L  P  + L
Sbjct: 218 EFMVNHLNKPYEINL 232

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 128/222 (57%), Gaps = 4/222 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPS 202
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 125 YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 182

Query: 203 REIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL-HLKVEM 261
           RE+A Q  + F        +R+  + GG ++ DQ   +M  P +++ATPGR + HL+   
Sbjct: 183 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 242

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLVDFAKAGL 320
             +++ +++ V DEADRL +M F   L+ +L  +P + R T LFSAT+ + +    +A L
Sbjct: 243 GFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 302

Query: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVI 362
           TNPV   +  + +  + L    +      +   L YLL E +
Sbjct: 303 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFL 344

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 68/105 (64%)

Query: 421 KATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           K  IVF  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 450

>Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI--DTSVKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 149 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +    E +  Y                
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----EEDFKY---------------- 248

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 249 -------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPANKENYIH 346

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  143 bits (361), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 126/223 (56%), Gaps = 8/223 (3%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAH---SS 190
           +LN +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  + A    + 
Sbjct: 124 VLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAP 183

Query: 191 KIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVAT 250
             G   ++LSP+RE+A+Q  K   +F K S +R+  + GG     Q   +    ++V+AT
Sbjct: 184 GDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDLSRGSEIVIAT 243

Query: 251 PGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           PGR + +      NLK V Y V DEADR+ +MGF  Q+ +++  +   RQTL++SAT P 
Sbjct: 244 PGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPK 303

Query: 311 TLVDFAKAGLTNPVLVR-----LDAESKISENLEMLFVSTKHD 348
            + + A+  L +P+ V+     L A   I++ +E++    K D
Sbjct: 304 EVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRD 346

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           E   +VF  T+   + I++ L+  G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 360 ESKILVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDV 419

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           AARG+D+  +  VIN+ MP + + +VHR+GRT RAG  G A S  +
Sbjct: 420 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 123/191 (64%), Gaps = 4/191 (2%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           +  +N+  F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EKL  +  S   
Sbjct: 53  VKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEKLYREKWSEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQTY+V  +    +   + L+ GG  ++ +    +S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARISKINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L H+   + L+  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   +
Sbjct: 172 RILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTN 322
           L D A+  LT+
Sbjct: 232 LTDLARLSLTD 242

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P     ++HRVGR+AR G +G
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQG 391

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score =  143 bits (360), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 117/195 (60%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P +E++K + +KI 
Sbjct: 48  LLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIPTLERIKPNLNKI- 106

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 107 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHVLVGTPGR 165

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LP+K Q+LLFSAT P T+ 
Sbjct: 166 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILIFLPKKHQSLLFSATFPLTVK 225

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L NP  + L
Sbjct: 226 EFMVKHLNNPYEINL 240

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 338 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 379

>Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}
           similar to Ashbya gossypii ACR253C
          Length = 396

 Score =  140 bits (352), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 168/373 (45%), Gaps = 58/373 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++    S   
Sbjct: 33  LLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--ESIKS 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+IL+P+RE+A+Q  KV    +   D++     GG    +    + +   +VV TPGR
Sbjct: 91  PQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVGTPGR 150

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
              +          ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+P  ++
Sbjct: 151 VFDMIERRFFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMPKEVL 210

Query: 314 DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM 373
           D     +  PV + +  ++   E ++  F++ + +E + +                    
Sbjct: 211 DVTDKFMNKPVRILVKKDALTLEGIQQYFINVESEEYKYD-------------------- 250

Query: 374 ILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHV 433
                   LSD  DS                              S    ++F  TR  V
Sbjct: 251 -------CLSDLYDS-----------------------------ISVTQAVIFCNTRRKV 274

Query: 434 EYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 493
           E +++ L    + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ VI
Sbjct: 275 EELTKRLTEDDFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVI 334

Query: 494 NFTMPSSSKIFVH 506
           N+ +P++ + ++H
Sbjct: 335 NYDLPNNKENYIH 347

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 121/191 (63%), Gaps = 4/191 (2%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + +  F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAFLIPVIEKLYREKWTEHD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQTY+V  +  + +   + L+ GG  ++ +   + S  +V++ TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKFELERI-SKINVLIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L H+   + LN   ++  V DEADR  +MGF   L+ ++++LP  RQTLLFSAT   +
Sbjct: 172 RILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSNLPPTRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTN 322
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDVVA 352

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P     ++HR GR+AR G +G
Sbjct: 353 RGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQG 389

>KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 437

 Score =  140 bits (354), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 103/389 (26%), Positives = 177/389 (45%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V+L  
Sbjct: 72  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVQGEVSV--VVLCN 129

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG   ++   ++      P ++VATPGR   L
Sbjct: 130 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTEYKNDIDLLSKKETVPHIIVATPGRLKAL 189

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             + +++L  V+  V DE D++ E +     + ++  + P  +Q ++FSATL   +    
Sbjct: 190 VRDKHIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 249

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    E++K    
Sbjct: 250 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL---NEKEK---- 284

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
             N+ L+   D    N                               I+FV +      +
Sbjct: 285 --NRKLAQLLDDLEFN-----------------------------QVIIFVKSTVRANEL 313

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 314 TKLLNASNFPAITVHGHMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 373

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           MP+ +  ++HRVGR  R G +G A S++S
Sbjct: 374 MPNEADQYLHRVGRAGRFGTKGLAISMIS 402

>Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059W
           (REAL)
          Length = 429

 Score =  140 bits (353), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 175/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 67  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRID--TSVKA 124

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 125 PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 182

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 183 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTVLPPTTQVVLLSATMPNDV 242

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ +    E +  Y                
Sbjct: 243 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVE----EEDFKY---------------- 282

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                              S    ++F  TR  
Sbjct: 283 -------ECLTDLYDS-----------------------------ISVTQAVIFCNTRRK 306

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 307 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 366

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 367 INYDLPANKENYIH 380

>Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  139 bits (351), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 176/374 (47%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI--DTSVKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 149 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ + ++ +                     
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKY-------------------- 248

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                            +   +A I F  TR  
Sbjct: 249 -------ECLTDLYDS----------------------------ISVTQAVI-FCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPANKENYIH 346

>Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059W
           (REAL)
          Length = 395

 Score =  139 bits (351), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 176/374 (47%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   +S   
Sbjct: 33  LLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRI--DTSVKA 90

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A++L+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 91  PQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGL--RDAQIVVGTPG 148

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R              ++  + DEAD +   GF EQ+ ++   LP   Q +L SAT+PN +
Sbjct: 149 RVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDV 208

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + NPV + +  +    E ++  +V+ + ++ +                     
Sbjct: 209 LEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKY-------------------- 248

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                  + L+D  DS                            +   +A I F  TR  
Sbjct: 249 -------ECLTDLYDS----------------------------ISVTQAVI-FCNTRRK 272

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE ++  L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 273 VEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLV 332

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 333 INYDLPANKENYIH 346

>KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69
           YHR169W
          Length = 432

 Score =  140 bits (352), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 113/403 (28%), Positives = 169/403 (41%), Gaps = 66/403 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           + +++       PT +Q   IP IL+ R+ +G ARTGSGKT AF  PM+ +     + + 
Sbjct: 19  LCDSLQAMRIHTPTDVQTHCIPPILKGRNCIGGARTGSGKTLAFAGPMLTEWSRDPAALF 78

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
              V+L+P+RE+A+Q ++         ++R  L+ GG     Q   +   P  +VATPGR
Sbjct: 79  G--VVLTPTRELAVQIHEQLCALGAQLNIRCALVVGGGDFVQQSLELQGRPHFIVATPGR 136

Query: 254 FLHLKVE-------MNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSA 306
             H  +         +L  +   Y V DEAD L                           
Sbjct: 137 LAHHIISDTPEAALSSLLKRYTRYLVLDEADFLLT------------------------- 171

Query: 307 TLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDE----REANLFYLLQEVI 362
             P    D A         V L A    +    +LF +T  D+    RE + F       
Sbjct: 172 --PTFASDLA---------VILGALPDKTHRRTLLFTATVTDQVLQLREGDAF------- 213

Query: 363 KIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKA 422
              +   E    L  G + L D+  ++                     +  +NE     A
Sbjct: 214 ---VYNAEDDSQLAPGRRQLPDTLTAE------YLLVPEHVKEAYLYHILVSNEFEDSTA 264

Query: 423 TIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
            +VFV      E + + L   G  V+ ++  + Q  R   L+ FRA    +LV TDVAAR
Sbjct: 265 -VVFVNRTRTAELLRRTLYQLGVRVTSLHSQMPQSERANSLHRFRARAARVLVATDVAAR 323

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           G+DIP ++ V+N+ +PS    FVHRVGRTARAG  G +   V+
Sbjct: 324 GLDIPQVSLVVNYDVPSDPDTFVHRVGRTARAGRHGESVLFVT 366

>TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.336
           YDL160C
          Length = 502

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 117/195 (60%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K+  +KI 
Sbjct: 43  LLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIPTLEKVKSKINKI- 101

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K  ++  ++ TGG +L D    +     ++V TPGR
Sbjct: 102 -QALIMVPTRELALQTSQVVRTLGKRCEISCMVTTGGTNLRDDIIRLNETVHILVGTPGR 160

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LPE+ Q+LLFSAT P T+ 
Sbjct: 161 VLDLASRGIADLSGCGLFIMDEADKMLSRDFKSIIEQILTFLPEQHQSLLFSATFPLTVK 220

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L  P  + L
Sbjct: 221 EFMVKHLHKPYEINL 235

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   G+   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 273 IIFCNSTNRVELLAKKITDLGFSCYYSHARMKQQERNRVFHEFRHGKVRTLVCSDLLTRG 332

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 333 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 374

>Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii ACR040W
          Length = 775

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 122/192 (63%), Gaps = 6/192 (3%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + + GF + T IQR +IP+ L+  DI+G A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLKESGFIKLTDIQRDSIPMALKGHDILGAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGM-MMSNPDVVVATP 251
           G  A+I+SP+RE+AMQ Y+V  +  K +   + L+ GG  +  +F M  +S  ++++ TP
Sbjct: 113 GLGALIISPTRELAMQIYEVLIKIGKHTSFSAGLVIGGKDV--KFEMDRISKINILIGTP 170

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR L H+   + L   +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   
Sbjct: 171 GRILQHMDQAVGLTSSNLQILVLDEADRCLDMGFKKTLDAIVSNLPPDRQTLLFSATQSQ 230

Query: 311 TLVDFAKAGLTN 322
           +L D A+  L +
Sbjct: 231 SLADLARLSLVD 242

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 423 TIVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVA 480
           T+VF+ +   V ++ +  +    G  + +++G   Q AR   L  F     + L  TDV 
Sbjct: 291 TVVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHACLFSTDVV 350

Query: 481 ARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           ARG+D P +  V+    P     ++HR GR+AR G  G
Sbjct: 351 ARGIDFPTVDWVVQVDCPEDVDTYIHRAGRSARYGKSG 388

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 190/406 (46%), Gaps = 75/406 (18%)

Query: 137 NINKKGFRQPTPIQRKTIPLILQNR--DIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           +I++ GF + T +Q+KTI  IL+++  D++  A+TG+GKT AF++P+ + L      S+ 
Sbjct: 146 SISRMGFPELTSVQQKTIKPILEDKENDVIARAKTGTGKTFAFLIPIFQHLINTQFDSQY 205

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGS----DLRSVLLTGGDSLEDQFGMMMS-NPDVV 247
             ++VI++P+R++A+Q     ++    +      + + L GG         M    P++V
Sbjct: 206 MVKSVIVAPTRDLALQIEAEVRKIHDNNYGLKKFQCISLVGGTDFRRAMDKMHKLRPNIV 265

Query: 248 VATPGRFLHLKVEMNLNLKS-VEYAVFDEADRLFEMGFA---EQLNELLASL----PEKR 299
           +ATPGR + +  +        V++ V DEADRL E+GF    EQ++E+L SL     +  
Sbjct: 266 IATPGRLIDVMEKFGKKFFGWVDFKVLDEADRLLEIGFKEDLEQISEMLNSLNGHSKDHI 325

Query: 300 QTLLFSATLPNTLVDFAKAGLTNPVLVRLDA----ESKISENLEMLFVSTKHDEREANLF 355
           +TLLFSATL   +   A   +  P  + +D     E +  E +E   V TK  E   N++
Sbjct: 326 RTLLFSATLDEKVQGLANQIMNKPKCLFIDTVDKNEPETHEKIEQSLVVTK--EFGHNIY 383

Query: 356 YLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSAN 415
             + E IK  L  +                                              
Sbjct: 384 AAI-EHIKAELLED---------------------------------------------- 396

Query: 416 ELPSEKATIVFVPTRHHVEYISQLL--KACGYL-VSYIYGTLDQHARRRQLYNFRAGLTS 472
             P     I+F PT    ++IS++L  +  G L V   +G + Q  R   +  F+     
Sbjct: 397 --PKNYKAILFTPTVKFTKFISRILDRELRGKLRVLEFHGQISQSRRTNLVKEFKQDRPG 454

Query: 473 ILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           +LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G
Sbjct: 455 LLVCTDVGARGMDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSG 500

>Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}
           YJL033W (HCA4) - putative RNA helicase [contig 246] FULL
          Length = 764

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/196 (40%), Positives = 124/196 (63%), Gaps = 9/196 (4%)

Query: 135 LNNINKKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KA 187
           L+   +KG R       T IQ+K+IP+ L+  D++  A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  LSQHTQKGLRDSAFVKMTEIQQKSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 188 HSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVV 247
            +   G  A+I+SP+RE+AMQTY+V  +  + S   + L+ GG  ++ +   + S  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQTYEVLTKIGRYSSFSAGLVIGGKDVKFELERI-SKINIL 166

Query: 248 VATPGRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSA 306
           V TPGR L H+   + LN  +V+  V DEADR  +MGF + L+ ++++LP  RQTLLFSA
Sbjct: 167 VGTPGRILQHMDQAVGLNTSNVQVLVLDEADRCLDMGFKKTLDAIVSNLPPVRQTLLFSA 226

Query: 307 TLPNTLVDFAKAGLTN 322
           T   +L D A+  LT+
Sbjct: 227 TQSQSLADLARLSLTD 242

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P S   ++HRVGR+AR G +G
Sbjct: 353 RGIDFPAVDWVVQADCPESVDTYIHRVGRSARYGKQG 389

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 116/198 (58%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 45  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 103

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 104 -QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNLRDDILRLNDTIHILVGTPGR 162

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      V DEAD++    F   + ++LA LP+  Q+LLFSAT P T+ 
Sbjct: 163 VLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILAFLPKNHQSLLFSATFPLTVK 222

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F +  L  P  + L  E
Sbjct: 223 EFMEKHLNKPYEINLMEE 240

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 122/192 (63%), Gaps = 6/192 (3%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  +N   F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EKL  +  +   
Sbjct: 53  LKGLNDSAFLKLTDIQRDSIPMSLKGYDILGAAKTGSGKTLAFLIPVLEKLYRERWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGM-MMSNPDVVVATP 251
           G  A+I+SP+RE+AMQ Y+V  +    +   + L+ GG  +  +F M  +S  ++++ TP
Sbjct: 113 GLGALIISPTRELAMQIYEVLLKIGTSTSFSAGLVIGGKDV--KFEMERISKINILIGTP 170

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR L H+   + LN  +++  V DEADR  +MGF + L+ ++++LP  RQTLLFSAT   
Sbjct: 171 GRILQHMDQAIGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPTRQTLLFSATQSQ 230

Query: 311 TLVDFAKAGLTN 322
           +L D A+  LT+
Sbjct: 231 SLEDLARLSLTD 242

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 356

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           RG+D P +  V+    P     ++HRVGR AR G +G
Sbjct: 357 RGIDFPAIDWVVQVDCPEDVDTYIHRVGRCARYGKQG 393

>TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON}
           Anc_1.211 YJL138C
          Length = 401

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 174/374 (46%), Gaps = 61/374 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++        
Sbjct: 34  LLRGVFAYGFEEPSAIQQRAILPIVEGNDVLAQAQSGTGKTGTFSIAALQRINPEIK--A 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDS-LEDQFGMMMSNPDVVVATPG 252
            +A+IL+P+RE+A+Q  KV    +   D++     GG S +ED  G+   +  +VV TPG
Sbjct: 92  PQALILAPTRELALQIQKVVISLALYLDIKVHACIGGTSFVEDTEGL--RDAQIVVGTPG 149

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTL 312
           R         L    ++  + DEAD +   GF EQ+ ++   +P   Q +L SAT+P  +
Sbjct: 150 RVFDNIQRHRLRTDKIKMFISDEADEMLSSGFKEQIYQIFTMMPPTTQVVLLSATMPRDV 209

Query: 313 VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQK 372
           ++     + +PV + +  +    E ++  +++ + ++ + ++                  
Sbjct: 210 LEVTTKFMRDPVRILVKKDELTLEGIKQFYINVEEEDYKYDV------------------ 251

Query: 373 MILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHH 432
                    L+D  DS                              S    ++F  TR  
Sbjct: 252 ---------LTDLYDS-----------------------------ISVTQAVIFCNTRRK 273

Query: 433 VEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANV 492
           VE +++ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  ++ V
Sbjct: 274 VEELTKKLTEADFTVSAIYSDLPQQERETIMKEFRSGSSRILISTDLLARGIDVQQVSLV 333

Query: 493 INFTMPSSSKIFVH 506
           IN+ +P++ + ++H
Sbjct: 334 INYDLPTNKENYIH 347

>KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} similar
           to uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 514

 Score =  140 bits (353), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 112/190 (58%), Gaps = 2/190 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  +DI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 47  LLMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 105

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 106 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLNEPVHILVGTPGR 164

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F     ++L  LPE+RQ LLFSAT P T+ 
Sbjct: 165 VLDLASRRVTDLSECHLFIMDEADKMLSRDFKVLAEQILGFLPERRQLLLFSATFPVTVK 224

Query: 314 DFAKAGLTNP 323
           +F    L NP
Sbjct: 225 EFMVKHLKNP 234

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   G+   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 277 IIFCNSTNRVELLAKKITELGFSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 336

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 337 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 378

>Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {ON}
           similar to Ashbya gossypii AER408W
          Length = 398

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 109/397 (27%), Positives = 185/397 (46%), Gaps = 66/397 (16%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ + I  I++ +D++  A++G+GKTA F + M++ +   S    
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIIKGKDVIAQAQSGTGKTATFTIAMLQIIDMKSKD-- 91

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A++LSP+RE+A+Q  +V        ++ +   TGG +L+           VV  TPGR
Sbjct: 92  CQALVLSPTRELAVQISQVVTNLGGYMNVVAHACTGGKALQQDINKFNKGCHVVSGTPGR 151

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLA-SLPEKRQTLLFSATLPNTL 312
            L       LN + ++  V DEAD            ELL+ SL  K+Q       LP ++
Sbjct: 152 VLDTIKRRALNTRHIKMLVLDEAD------------ELLSDSLGFKQQIYDIFTKLPTSV 199

Query: 313 -VDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIK---IPLAT 368
            V    A ++  VL   +   K+  +   L V  K D+       +  +VIK   + +  
Sbjct: 200 QVVLISATISKDVL---EVVKKLMTDPVKLLV--KRDQ-------ISLDVIKQYHVNVEK 247

Query: 369 EEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVP 428
           EE K         L D  DS   N                               ++F  
Sbjct: 248 EEWKF------DTLCDLYDSLTIN-----------------------------QCVIFCN 272

Query: 429 TRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPM 488
           T+  V+++S+ L    + VS I+G + Q  R + + +FR+G + +L+ TDV ARG+D+  
Sbjct: 273 TKKKVDWLSRKLLQTNFAVSSIHGDMQQDEREKVMNDFRSGSSRLLISTDVWARGIDVQQ 332

Query: 489 LANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           ++ VIN+ +P   + ++HR+GR+ R G +G A + ++
Sbjct: 333 ISLVINYDIPELLENYIHRIGRSGRFGRKGIAINFIT 369

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  139 bits (351), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 115/195 (58%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAFV+P +EK+K+  +KI 
Sbjct: 45  LLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIPTLEKVKSKHNKI- 103

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 104 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 162

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LP+  Q+LLFSAT P ++ 
Sbjct: 163 VLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQSLLFSATFPLSVK 222

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L  P  + L
Sbjct: 223 EFMVNHLHKPYEINL 237

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {ON}
           Anc_7.336 YDL160C
          Length = 479

 Score =  139 bits (349), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 116/198 (58%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 42  LLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIPALEKVKPKLNKI- 100

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L+D    +     ++V TPGR
Sbjct: 101 -QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDIMRLNETVHILVGTPGR 159

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LP+  Q+LLFSAT P T+ 
Sbjct: 160 VLDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSHQSLLFSATFPLTVK 219

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 220 EFMVKHLHKPYEINLMEE 237

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNRVFHEFRQGKVRTLVCSDLLTRG 331

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score =  140 bits (354), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 137/242 (56%), Gaps = 17/242 (7%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMI----------- 182
           +L NI    F +PTP+Q+ +IP++ +NRD++G A+TGSGKT  F+ P++           
Sbjct: 148 LLENIKLARFTKPTPVQKYSIPIVSKNRDLMGCAQTGSGKTGGFLFPILSEMFINGPLNV 207

Query: 183 -EKLKAHSSKIG-ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMM 240
            +K + H  + G   A++L+P+RE+A Q ++  ++F+  S +R  ++ GG  + +Q   +
Sbjct: 208 PDKSRNHYMRKGYPTALVLAPTRELATQIFEESRKFTYRSWVRPCVVYGGAPIGNQMREL 267

Query: 241 MSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL--ASLPE- 297
               D++VATPGR   L     ++L +V Y + DEADR+ +MGF  Q+  ++    +PE 
Sbjct: 268 DRGCDLLVATPGRLNDLLERGKISLMNVRYLILDEADRMLDMGFEPQIRHIVEDCDMPEV 327

Query: 298 -KRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFY 356
             RQTL+FSAT P  +   A+  L N V + +      SEN+    +  +  ++++ L  
Sbjct: 328 QDRQTLMFSATFPRDIQHLARDFLKNYVFLSVGRVGSTSENITQKIIMVEDMDKKSALLD 387

Query: 357 LL 358
           LL
Sbjct: 388 LL 389

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           E  T++FV T+   + ++  L    +  + I+G   Q  R R L  F+AG   ILV T V
Sbjct: 394 EGLTLIFVETKRMADQLTDFLIMQNFNATAIHGDRTQEERERALGAFKAGRADILVATAV 453

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           AARG+DIP +  VINF +PS    +VHR+GRT RAGN G A S  +
Sbjct: 454 AARGLDIPNVTLVINFDLPSDIDDYVHRIGRTGRAGNTGVAISFFN 499

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  139 bits (350), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 115/198 (58%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 41  LLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKI- 99

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 100 -QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGR 158

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      V DEAD++    F   + ++L  LP + Q+LLFSAT P T+ 
Sbjct: 159 VLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQSLLFSATFPITVK 218

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 219 EFMVKHLHKPYEINLMEE 236

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleolar
           protein required for maturation of 18S rRNA, member of
           the eIF4A subfamily of DEAD-box ATP-dependent RNA
           helicases
          Length = 399

 Score =  137 bits (344), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 108/395 (27%), Positives = 185/395 (46%), Gaps = 61/395 (15%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++ +      + 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDL- 92

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSN-PDVVVATPG 252
            +A+ILSP+RE+A Q  +V K      ++ +  +TGG +L+D    M  +    V  TPG
Sbjct: 93  -QALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPG 151

Query: 253 RFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLA-SLPEKRQTLLFSATLP-N 310
           R L +  +  L  ++V+  V DEAD            ELL+ +L  K+Q     A LP N
Sbjct: 152 RVLDMIKKQMLQTRNVQMLVLDEAD------------ELLSETLGFKQQIYDIFAKLPKN 199

Query: 311 TLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEE 370
             V    A +   +   L+   K   +   + V  K DE   +L  + Q V+ +    EE
Sbjct: 200 CQVVVVSATMNKDI---LEVTRKFMNDPVKILV--KRDE--ISLEGIKQYVVNVD--KEE 250

Query: 371 QKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTR 430
            K         L D  DS                              +    ++F  T+
Sbjct: 251 WKF------DTLCDIYDS-----------------------------LTITQCVIFCNTK 275

Query: 431 HHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLA 490
             V+++SQ L    + V  ++G + Q  R + + +FR G + +L+ TDV ARG+D+  ++
Sbjct: 276 KKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVS 335

Query: 491 NVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
            VIN+ +P   + ++HR+GR+ R G +G A + ++
Sbjct: 336 LVINYDLPEIIENYIHRIGRSGRFGRKGVAINFIT 370

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/191 (39%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  + +  F + T IQR++IPL L+  D++G A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIPVIEKLYREKWTDMD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQ Y+V  +  K +   + L+ GG  +  +    +S  ++++ TPG
Sbjct: 113 GLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFE-KERISRINILIGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L H+   +  N  +++  V DEADR  +MGF   L+ ++ +LP  RQTLLFSAT   +
Sbjct: 172 RILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPASRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTN 322
           L D A+  LT+
Sbjct: 232 LDDLARLSLTD 242

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (1%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVA 352

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           RG+D P +  VI    P     ++HRVGR AR G  G +  +++
Sbjct: 353 RGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEGKSLIMLT 396

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  139 bits (349), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 134/229 (58%), Gaps = 7/229 (3%)

Query: 138 INKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI--GAR 195
           I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE L +   K   G  
Sbjct: 66  IEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIELLYSLKFKPRNGTG 125

Query: 196 AVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFL 255
            ++++P+RE+A+Q + V +E  +       ++ GG +   +   +M   ++++ATPGR L
Sbjct: 126 IIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNILIATPGRLL 185

Query: 256 -HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLP-EKRQTLLFSATLPNTLV 313
            HL+       K+++  + DEADR+ E+GF +++ +++  LP E RQ++LFSAT    + 
Sbjct: 186 DHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDRQSMLFSATQTTKVE 245

Query: 314 DFAKAGL-TNPVLVRLDAESKIS--ENLEMLFVSTKHDEREANLFYLLQ 359
           D A+  L   P+ + +++E   S  + LE  +V    D+R   LF  L+
Sbjct: 246 DLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFSFLK 294

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           ++ ++ F  + + V+Y ++LL      V  ++G   Q  R    + F      ILV TDV
Sbjct: 298 KRKSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDV 357

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIV 524
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 358 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 401

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  139 bits (350), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 114/197 (57%), Gaps = 3/197 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL-KAHSSKIGARAVILSP 201
           F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P +  L  A + K G + +++SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVVGVAETGSGKTFAFGVPAVNNLMSADAKKKGIQVLVISP 200

Query: 202 SREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEM 261
           +RE+A QTY      +K + +    + GG   ++Q   +     VVVATPGR L L  E 
Sbjct: 201 TRELASQTYDNLISLTKKAGVNCCCVYGGVPKDEQRAQL-KKAHVVVATPGRLLDLIEEG 259

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEK-RQTLLFSATLPNTLVDFAKAGL 320
           +  L +V+Y V DEADR+ E GF E +  ++ S     RQTL+F+AT P  + + A   +
Sbjct: 260 SARLSNVDYLVLDEADRMLEKGFEEDIKRIIGSTKSAGRQTLMFTATWPKEVRELASTFM 319

Query: 321 TNPVLVRLDAESKISEN 337
            NPV V +    ++S N
Sbjct: 320 NNPVKVSIGNRDELSAN 336

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 65/102 (63%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           ++F   +     + + LK  GY V+ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 373 LIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAARG 432

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DIP +  VIN T P + + +VHR+GRT RAG  G A+++ +
Sbjct: 433 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 474

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score =  138 bits (348), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 112/195 (57%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAFV+P +E +K   +KI 
Sbjct: 41  LLMGIFEAGFEKPSPIQEEAIPIALTRRDILARAKNGTGKTAAFVIPTLEIVKPKVNKI- 99

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   L  ++ TGG +L D    +     V+V TPGR
Sbjct: 100 -QALIMVPTRELALQTSQVVRTLGKHCGLSCMVTTGGTNLRDDIMRLNEPVHVLVGTPGR 158

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L+ LP   Q+LLFSAT P T+ 
Sbjct: 159 VLDLASRKVADLSECSLFIMDEADKMLSRDFKSLIEQILSFLPSSHQSLLFSATFPLTVK 218

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L  P  + L
Sbjct: 219 EFMVKHLNKPYEINL 233

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  137 bits (345), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 175/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 81  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAV--VVICN 138

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++ +    P +VVATPGR   L
Sbjct: 139 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKAL 198

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             E  ++L  V+  V DE D++ E +     + E+  + P  +Q ++FSATL   +    
Sbjct: 199 VREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 258

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 259 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 291

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV + +    +
Sbjct: 292 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTNRANEL 322

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 323 TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 382

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +  ++HRVGR  R G +G A S VS
Sbjct: 383 LTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.336
           YDL160C
          Length = 585

 Score =  139 bits (351), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 116/198 (58%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 48  LLMGIFEAGFEKPSPIQEESIPIAIAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKI- 106

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 107 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLNETIHVLVGTPGR 165

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LP+  Q+LLFSAT P T+ 
Sbjct: 166 VLDLASRKVADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPKHHQSLLFSATFPLTVK 225

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    LT P  + L  E
Sbjct: 226 EFMVKHLTKPYEINLMDE 243

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 338 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 379

>SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [1407
           bp, 468 aa] {ON} highly similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 468

 Score =  137 bits (346), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 104/389 (26%), Positives = 176/389 (45%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 103 GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV--VVICN 160

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMM---SNPDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  ++    ++    + P +VVATPGR   L
Sbjct: 161 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIQKDAELLKNKETAPHIVVATPGRLKAL 220

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             +  +NL  V+  V DE D++ E +     + ++  + P  +Q ++FSATL   +    
Sbjct: 221 VRDKLINLGHVKNFVIDECDKVLEALDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 280

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  +K+    EE+     
Sbjct: 281 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYVKL----EER----- 313

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 314 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTLRANEL 344

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 345 TKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 404

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +P+ +  ++HRVGR  R G +G A S VS
Sbjct: 405 LPNEADQYLHRVGRAGRFGTKGLAISFVS 433

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score =  138 bits (347), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 113/195 (57%), Gaps = 2/195 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAFV+P +E +K   +KI 
Sbjct: 40  LLMGIFEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIPTLEIVKPKVNKI- 98

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 99  -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRLNEPVHVLVGTPGR 157

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      V DEAD++    F   + ++L+ LP+  Q+LLFSAT P T+ 
Sbjct: 158 VLDLASRKVADLSECSLFVMDEADKMLSRDFKSLVEQILSFLPQNHQSLLFSATFPLTVK 217

Query: 314 DFAKAGLTNPVLVRL 328
           +F    L  P  + L
Sbjct: 218 EFMVKHLNKPYEINL 232

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}
           YDL160C (REAL)
          Length = 506

 Score =  138 bits (348), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 115

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 174

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L+ LP   Q+LLFSAT P T+ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPSSHQSLLFSATFPLTVK 234

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 115/198 (58%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P ++K+K   +KI 
Sbjct: 56  LLMGIFEAGFEKPSPIQEESIPVAITGRDILARAKNGTGKTAAFVIPTLQKIKPKVNKI- 114

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 115 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNDTVHVLVGTPGR 173

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L  LP+  Q+LLFSAT P T+ 
Sbjct: 174 VLDLASRKIADLSECALFIMDEADKMLSRDFKTIIEQILIFLPKNHQSLLFSATFPLTVK 233

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 234 EFMVKHLNKPYEINLMEE 251

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 286 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 345

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 346 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 387

>YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}
           MSS116DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns; non-polar RNA
           helicase that also facilities strand annealing
          Length = 664

 Score =  140 bits (353), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 120/405 (29%), Positives = 180/405 (44%), Gaps = 75/405 (18%)

Query: 138 INKKGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKIG 193
           I +  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + L      S+  
Sbjct: 121 ITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYM 180

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLR-------SVLLTGGDSLEDQFGMMMS-NPD 245
            +AVI++P+R++A+Q   +  E  K  D+         V L GG         M    P+
Sbjct: 181 VKAVIVAPTRDLALQ---IEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPN 237

Query: 246 VVVATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR----- 299
           +V+ATPGR +  L+   N   + V+Y V DEADRL E+GF + L  +   L EK      
Sbjct: 238 IVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSAD 297

Query: 300 --QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFVSTKHDEREANLFY 356
             +TLLFSATL + +   A   +     + LD   K   E  E +  S    E+ AN  +
Sbjct: 298 NIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIF 357

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
              E IK        K I                                         E
Sbjct: 358 AAVEHIK--------KQI----------------------------------------KE 369

Query: 417 LPSEKATIVFVPTRHHVEYISQLLK---ACGYLVSYIYGTLDQHARRRQLYNFRAGLTSI 473
             S    I+F PT     ++  +LK        +   +G + Q+ R   +  F+   + I
Sbjct: 370 RDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGI 429

Query: 474 LVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRG 518
           LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G
Sbjct: 430 LVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEG 474

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score =  138 bits (347), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 115

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 174

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L+ LP   Q+LLFSAT P T+ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVK 234

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160c DHH1
          Length = 507

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 42  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKIKPKLNKI- 100

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   +   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 101 -QALIMVPTRELALQTSQVIRTLGRHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGR 159

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      V DEAD++    F   + ++L  LP+  Q+LLFSAT P T+ 
Sbjct: 160 VLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQVLTFLPKAHQSLLFSATFPLTVK 219

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 220 EFMVKHLHKPYEINLMEE 237

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 60/102 (58%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  ++FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQDRNKVFHDFRQGKVRTLVCSDLLTRG 331

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 373

>Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 174/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 81  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAV--VVICN 138

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++ +    P +VVATPGR   L
Sbjct: 139 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKAL 198

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             E  ++L  V+  V DE D++ E +     + E+  + P  +Q ++FSATL   +    
Sbjct: 199 VREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 258

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 259 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 291

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 292 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTTRANEL 322

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 323 TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 382

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +  ++HRVGR  R G +G A S VS
Sbjct: 383 LTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON}
           YDR194C (REAL)
          Length = 665

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/407 (28%), Positives = 180/407 (44%), Gaps = 75/407 (18%)

Query: 138 INKKGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKIG 193
           I +  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + L      S+  
Sbjct: 121 ITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLMNTKFDSQYM 180

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLR-------SVLLTGGDSLEDQFGMMMS-NPD 245
            +AVI++P+R++A+Q   +  E  K  D+         V L GG         M    P+
Sbjct: 181 VKAVIVAPTRDLALQ---IESEVKKIHDMNYGLKKYGCVSLVGGTDFRAAMNKMNKLRPN 237

Query: 246 VVVATPGRFLH-LKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKR----- 299
           +V+ATPGR +  L+   N   + V+Y V DEADRL E+GF + L  +   L EK      
Sbjct: 238 IVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSVD 297

Query: 300 --QTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKIS-ENLEMLFVSTKHDEREANLFY 356
             +TLLFSATL + +   A   +     + LD   K   E  E +  S    E+ AN  +
Sbjct: 298 NIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIF 357

Query: 357 LLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANE 416
              E IK  +   E                                              
Sbjct: 358 AAVEHIKKQIKERE---------------------------------------------- 371

Query: 417 LPSEKATIVFVPTRHHVEYISQLLK---ACGYLVSYIYGTLDQHARRRQLYNFRAGLTSI 473
             S    I+F PT     ++  +L+        +   +G + Q+ R   +  F+   + I
Sbjct: 372 --SNYKAIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGI 429

Query: 474 LVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWA 520
           LV TDV ARG+D P +  V+   +PS    ++HR+GRTAR+G  G +
Sbjct: 430 LVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSS 476

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +EK+K   +KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKI- 115

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     V+V TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHVLVGTPGR 174

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L+ LP   Q+LLFSAT P T+ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVK 234

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Component
           of the TREX complex required for nuclear mRNA export;
           member of the DEAD-box RNA helicase superfamily and is
           involved in early and late steps of spliceosome
           assembly; homolog of the human splicing factor hUAP56
          Length = 446

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 174/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 81  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAV--VVICN 138

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++ +    P +VVATPGR   L
Sbjct: 139 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKAL 198

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             E  ++L  V+  V DE D++ E +     + E+  + P  +Q ++FSATL   +    
Sbjct: 199 VREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 258

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 259 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 291

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 292 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTTRANEL 322

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 323 TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 382

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +  ++HRVGR  R G +G A S VS
Sbjct: 383 LTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  139 bits (350), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 136/244 (55%), Gaps = 19/244 (7%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL-------- 185
           + +N+ + GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F+ P++ ++        
Sbjct: 147 LFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSEMFTAGPAPK 206

Query: 186 -------KAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFG 238
                   ++  K+   A++L+P+RE+A Q ++  ++F+  S +R  ++ GG  +  Q G
Sbjct: 207 PQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPVGAQMG 266

Query: 239 MMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELL--ASLP 296
            +    D++VATPGR   L     ++L +++Y   DEADR+ +MGF  Q+  ++    +P
Sbjct: 267 ELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIRHIVEDCDMP 326

Query: 297 --EKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANL 354
              +RQTL+FSAT P  +   A+  L + + + +      SEN+    +     ++++ L
Sbjct: 327 PVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYVDDMDKKSAL 386

Query: 355 FYLL 358
             LL
Sbjct: 387 LDLL 390

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%)

Query: 423 TIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAAR 482
           T++FV T+   + ++  L       + I+G   Q  R R L  F++G   +LV T VAAR
Sbjct: 398 TLIFVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFKSGTADVLVATAVAAR 457

Query: 483 GVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSI 523
           G+DIP +  VIN+ +P     +VHR+GRT RAGN G A S 
Sbjct: 458 GLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISF 498

>KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {ON}
           Anc_5.241 YJL033W
          Length = 762

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 120/192 (62%), Gaps = 4/192 (2%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSK 191
           +L  ++   F + T IQR++IP+ LQ  D++  A+TGSGKT AF++P++EKL  +  +  
Sbjct: 52  VLKGLSASAFVKLTAIQRESIPVSLQGHDVLAAAKTGSGKTLAFLVPVLEKLYRERWTEF 111

Query: 192 IGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATP 251
            G  A+I+SP+RE+AMQ Y+V  +        + L+ GG  ++ +    +S  ++++ TP
Sbjct: 112 DGLGALIISPTRELAMQIYEVLVKVGSQCSFSAGLVIGGKDVKYE-SERISKINILIGTP 170

Query: 252 GRFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPN 310
           GR L HL   + LN  +++  V DEADR  +MGF + L+ ++ +LP  RQTLLFSAT   
Sbjct: 171 GRILQHLDQAVGLNASNLQMLVLDEADRCLDMGFKKTLDAIVGNLPPMRQTLLFSATQSA 230

Query: 311 TLVDFAKAGLTN 322
           +L D A+  LT+
Sbjct: 231 SLADLARLSLTD 242

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V +I +  +    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 IVFLSSGKQVHFIYETFRKMQPGISLMHLHGRQKQTARTDTLDKFVRAQQVCLFATDVVA 356

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           RG+D P +  V+    P  +  ++HRVGR+AR G +G A  +++
Sbjct: 357 RGIDFPAVDWVVQVDCPEDADTYIHRVGRSARYGKKGKALIMLT 400

>Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  136 bits (342), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 174/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 81  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVAV--VVICN 138

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMM---SNPDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++    + P +VVATPGR   L
Sbjct: 139 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKAL 198

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             E  ++L  V+  V DE D++ E +     + E+  + P  +Q ++FSATL   +    
Sbjct: 199 VREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 258

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 259 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 291

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 292 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTTRANEL 322

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 323 TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 382

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +  ++HRVGR  R G +G A S VS
Sbjct: 383 LTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 764

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 120/191 (62%), Gaps = 4/191 (2%)

Query: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKL--KAHSSKI 192
           L  +    F + T IQ+ +IP+ L+  D++  A+TGSGKT AF++P+IEKL  +  +   
Sbjct: 53  LKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEKLYREKWTEFD 112

Query: 193 GARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPG 252
           G  A+I+SP+RE+AMQTY+V  +  + +   + L+ GG  ++ +   + S  +++V TPG
Sbjct: 113 GLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGKEVKFELDRI-SKINILVGTPG 171

Query: 253 RFL-HLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNT 311
           R L H+   + LN  +++  V DEADR  +MGF + L+ ++ +LP  RQTLLFSAT   +
Sbjct: 172 RILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPVRQTLLFSATQSQS 231

Query: 312 LVDFAKAGLTN 322
           L D A+  LT+
Sbjct: 232 LADLARLSLTD 242

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 424 IVFVPTRHHVEYISQLLKAC--GYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAA 481
           IVF+ +   V ++ +  +    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 482 RGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           RG+D P +  V+    P +   ++HRVGR+AR G +G +  +++
Sbjct: 353 RGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQGKSLVMLT 396

>CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa]
           {ON} highly similar to uniprot|Q07478 Saccharomyces
           cerevisiae YDL084w SUB2
          Length = 439

 Score =  135 bits (340), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 105/389 (26%), Positives = 174/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 74  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV--VVICN 131

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMMSN---PDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+R+ +  GG  +     ++ +    P +VVATPGR   L
Sbjct: 132 ARELAYQIRNEYLRFSKYMPDVRTAVFYGGTPIAKDAELLKNKDTAPHIVVATPGRLKAL 191

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             +  ++L  V+  V DE D++ E +     + E+  + P  +Q ++FSATL   +    
Sbjct: 192 VRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 251

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q  IK+    EE+     
Sbjct: 252 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL----EER----- 284

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV +      +
Sbjct: 285 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTSRANEL 315

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL A  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 316 TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 375

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           + + +  ++HRVGR  R G +G A S VS
Sbjct: 376 LLNEADQYLHRVGRAGRFGTKGLAISFVS 404

>KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.204
           YGL078C
          Length = 533

 Score =  137 bits (345), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 112/197 (56%), Gaps = 3/197 (1%)

Query: 143 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKI-GARAVILSP 201
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   S  + G +A+I+SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVIGVAETGSGKTLAFGVPAVNHIIETSKTVSGIQALIISP 200

Query: 202 SREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEM 261
           +RE+A Q Y      +    L    + GG   ++Q  M +    +VVATPGR L L  E 
Sbjct: 201 TRELASQIYDNLIPLTDKVGLECCCVYGGVPKDEQ-RMKLRKCHIVVATPGRLLDLLQEG 259

Query: 262 NLNLKSVEYAVFDEADRLFEMGFAEQLNELL-ASLPEKRQTLLFSATLPNTLVDFAKAGL 320
           ++NL  V Y V DEADR+ E GF E +  ++  + P  RQTL+F+AT P  + + A   +
Sbjct: 260 SVNLSKVNYLVLDEADRMLEKGFEEDIKNIIRETAPHGRQTLMFTATWPKEVRELAATFM 319

Query: 321 TNPVLVRLDAESKISEN 337
             PV V +    ++S N
Sbjct: 320 NQPVKVSIGNRDELSAN 336

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%)

Query: 420 EKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDV 479
           ++  ++F   +     + + LK  GY V  I+G L Q  R   L  F+ G +++L+ TDV
Sbjct: 369 DEKVLIFALYKKEAARVERNLKYNGYNVVAIHGDLTQQQRTHALNEFKTGSSNLLLATDV 428

Query: 480 AARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           AARG+DIP +  VIN T P + + +VHR+GRT RAG  G A+++ +
Sbjct: 429 AARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGVAHTLFT 474

>Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}
           YDL160C (REAL)
          Length = 507

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 114/198 (57%), Gaps = 2/198 (1%)

Query: 134 ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG 193
           +L  I + GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAFV+P +E++K   +KI 
Sbjct: 57  LLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLERVKPKLNKI- 115

Query: 194 ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR 253
            +A+I+ P+RE+A+QT +V +   K   +  ++ TGG +L D    +     ++V TPGR
Sbjct: 116 -QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGR 174

Query: 254 FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV 313
            L L      +L      + DEAD++    F   + ++L+ LP   Q+LLFSAT P T+ 
Sbjct: 175 VLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPTTHQSLLFSATFPLTVK 234

Query: 314 DFAKAGLTNPVLVRLDAE 331
           +F    L  P  + L  E
Sbjct: 235 EFMVKHLHKPYEINLMEE 252

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 424 IVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARG 483
           I+F  + + VE +++ +   GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 484 VDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 388

>KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.384
           YDL084W
          Length = 449

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 102/389 (26%), Positives = 175/389 (44%), Gaps = 63/389 (16%)

Query: 142 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSP 201
           GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++    V++  
Sbjct: 84  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPIPGEVSV--VVICN 141

Query: 202 SREIAMQTYKVFKEFSK-GSDLRSVLLTGGDSLEDQFGMMM---SNPDVVVATPGRFLHL 257
           +RE+A Q    +  FSK   D+++ +  GG  +     ++    ++P +VVATPGR   L
Sbjct: 142 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAELLKNKETSPHIVVATPGRLKAL 201

Query: 258 KVEMNLNLKSVEYAVFDEADRLFE-MGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFA 316
             +  ++L  V+  V DE D++ E +     + ++  + P  +Q ++FSATL   +    
Sbjct: 202 VRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRPIC 261

Query: 317 KAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILG 376
           +  L NP+ + +D                  DE +  L  L Q   K+    EE+     
Sbjct: 262 RRFLQNPLEIFVD------------------DEAKLTLHGLQQYYTKL----EER----- 294

Query: 377 EGNKALSDSEDSDAENGXXXXXXXXXXXXXXXXXLPSANELPSEKATIVFVPTRHHVEYI 436
           E N+ L+   D    N                               I+FV + +    +
Sbjct: 295 EKNRKLAQLLDDLEFN-----------------------------QVIIFVKSTNRANEL 325

Query: 437 SQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFT 496
           ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   IN+ 
Sbjct: 326 TKLLNESNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYD 385

Query: 497 MPSSSKIFVHRVGRTARAGNRGWAYSIVS 525
           +PS +  ++HRVGR  R G +G A S +S
Sbjct: 386 LPSEADQYLHRVGRAGRFGTKGLAISFIS 414

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,062,370
Number of extensions: 3576352
Number of successful extensions: 14632
Number of sequences better than 10.0: 659
Number of HSP's gapped: 13852
Number of HSP's successfully gapped: 1146
Length of query: 979
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 860
Effective length of database: 39,836,145
Effective search space: 34259084700
Effective search space used: 34259084700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)