Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B04862g3.164ON40840820740.0
TDEL0D045903.164ON3763085951e-72
SAKL0C07392g3.164ON3613054476e-51
Kwal_33.141793.164ON3743644391e-49
KLTH0F06512g3.164ON3703154214e-47
NCAS0I020703.164ON4233243913e-42
Suva_4.2223.164ON4163123894e-42
Skud_4.2243.164ON4083343772e-40
Smik_4.2083.164ON4173113608e-38
KAFR0F022103.164ON3573193428e-36
YDL027C3.164ON4203113292e-33
Kpol_1045.433.164ON3823902851e-27
TPHA0P006703.164ON3803182631e-24
KLLA0C03872g3.164ON3763401772e-13
KNAG0K017303.164ON3292731372e-08
CAGL0K01639g3.164ON403314940.005
TBLA0I017603.220ON163196722.8
KNAG0L009907.166ON74536704.1
NDAI0G034708.140ON82698704.3
ADR052W7.166ON75049704.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B04862g
         (408 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   803   0.0  
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   233   1e-72
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   176   6e-51
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...   173   1e-49
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   166   4e-47
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...   155   3e-42
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   154   4e-42
Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   149   2e-40
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   143   8e-38
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...   136   8e-36
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   131   2e-33
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...   114   1e-27
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....   105   1e-24
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    73   2e-13
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    57   2e-08
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    41   0.005
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    32   2.8  
KNAG0L00990 Chr12 (183931..186168) [2238 bp, 745 aa] {ON} Anc_7....    32   4.1  
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    32   4.3  
ADR052W Chr4 (802093..804345) [2253 bp, 750 aa] {ON} Non-synteni...    32   4.7  

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/408 (96%), Positives = 392/408 (96%)

Query: 1   MGDDGTLHLDINSLIHELHISPGFKVEMHSMMLRPGIGLGFIPRENPFLLAKGLTSLRPA 60
           MGDDGTLHLDINSLIHELHISPGFKVEMHSMMLRPGIGLGFIPRENPFLLAKGLTSLRPA
Sbjct: 1   MGDDGTLHLDINSLIHELHISPGFKVEMHSMMLRPGIGLGFIPRENPFLLAKGLTSLRPA 60

Query: 61  VPVVMTRKLCHLTRSPSPIVPPRYTRLNTIRFNKLSPSIFSRNFHFTSVRRSGRYPFGNR 120
           VPVVMTRKLCHLTRSPSPIVPPRYTRLNTIRFNKLSPSIFSRNFHFTSVRRSGRYPFGNR
Sbjct: 61  VPVVMTRKLCHLTRSPSPIVPPRYTRLNTIRFNKLSPSIFSRNFHFTSVRRSGRYPFGNR 120

Query: 121 PPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKNNTLFDQL 180
           PPLRVFKISPLVIFLASIGALTV                VVGISVYQFRKWKNNTLFDQL
Sbjct: 121 PPLRVFKISPLVIFLASIGALTVFFLILPFMLTFFLPLFVVGISVYQFRKWKNNTLFDQL 180

Query: 181 LNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNAN 240
           LNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNAN
Sbjct: 181 LNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNAN 240

Query: 241 NVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGF 300
           NVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGF
Sbjct: 241 NVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGF 300

Query: 301 KNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNM 360
           KNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNM
Sbjct: 301 KNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNM 360

Query: 361 AISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIRNTD 408
           AISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIRNTD
Sbjct: 361 AISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIRNTD 408

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  233 bits (595), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 119/308 (38%), Positives = 189/308 (61%), Gaps = 6/308 (1%)

Query: 101 SRNFHFTSVRRSGRYPFGNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXXXXV 160
           +R FH T+ R    YP  N+PP +V++ISP+V  L  IG L +                +
Sbjct: 75  NRLFHTTTPRYMPPYP--NQPPFKVYRISPIVAVLTGIGFLMLLFAVLPFIFTFFFPLII 132

Query: 161 VGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFE 220
            GI  YQF KWK   LF  +L  LK S M++N  T+ A++VKS+ K     Q  NA VFE
Sbjct: 133 AGICAYQFSKWKRKVLFQDILRHLKTSTMKVNYNTVKALHVKSLDKIVRLEQQ-NAKVFE 191

Query: 221 EIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWI 280
           ++ K  DA ++      +  + ++AD+LL F+  R++EAI+++EQGIR YFLGDDV  W+
Sbjct: 192 DLLKSFDADLRARL---DKFSSAKADKLLRFIDDRLLEAIETNEQGIRNYFLGDDVGRWV 248

Query: 281 KEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERN 340
           ++ Y  EL ++  ++  +    E+I  +V+P+YLKS+++P++HLA+VS+A+LQG     N
Sbjct: 249 EDNYQLELDTTQYKTNAQVGDGELIMLLVFPLYLKSNSNPRKHLANVSLALLQGLFEGTN 308

Query: 341 NYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHT 400
             ++    +++   +A+C M I+V+  ++   K FVI   G SGD+++KYD  E+SDGHT
Sbjct: 309 GANYLEFLSSISETDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHT 368

Query: 401 EYTIRNTD 408
           EYT+++ +
Sbjct: 369 EYTVKSNN 376

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  176 bits (447), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 168/305 (55%), Gaps = 10/305 (3%)

Query: 99  IFSRNFHFTSVRRSGRYPFGNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXXX 158
           + SRN H    RR+   P G RP +  F+ SP V+F A +G L+                
Sbjct: 65  LLSRNLHTHPPRRTPFRP-GPRPTIAPFRTSPWVMFFAGVGLLSALFVVLPLVFTLFFPL 123

Query: 159 XVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGV 218
            V G+  YQF++W++  L+D L   L+ +++ +  +++  +Y  +++   +  +   A +
Sbjct: 124 VVAGVIAYQFKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRA-GAEL 182

Query: 219 FEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSN 278
           F+ +   V+ +  RD +W + N+   + +LL+F++SRV+E+I+++E G+R +FLG DV +
Sbjct: 183 FDTV---VNGRKMRD-MWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDS 238

Query: 279 WIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAE 338
           WI++GYD +L +  C +  R    ++   + YP+YL SST+ +R LADVS+  L    A 
Sbjct: 239 WIRDGYDLQLDTRICGTTGRSIGGKLAMSVTYPLYLVSSTN-RRKLADVSIVFLDERLAA 297

Query: 339 RNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDG 398
            +    F    +L  Q+ +C M IS+    +++P+QF+I   G SG+  ++       DG
Sbjct: 298 GSG---FYPPGDLAGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQRTTRDG 354

Query: 399 HTEYT 403
           H EYT
Sbjct: 355 HREYT 359

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score =  173 bits (439), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/364 (31%), Positives = 178/364 (48%), Gaps = 27/364 (7%)

Query: 55  TSLRPAVPVVMTRKLCHLTRSPSPIV----PPRYTRLNTIRFNKLSPSIFSRNFHFTSVR 110
           +SL P VP+ +TR      R+ S ++    PP    L + R       I   N+    V 
Sbjct: 24  SSLHPRVPLTLTRYSRPEFRAFSSLISVSRPPTCPSLTSPRL------ITHSNYKHDGVL 77

Query: 111 RSGRYPF---------GNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXXXXVV 161
           +  + P             PP +  +ISP+   LA +G++++                + 
Sbjct: 78  KILKTPVPRINYRSLHSGPPPFKTVRISPIFGILAFLGSISLVFIVVPFVFTFFFPLIIA 137

Query: 162 GISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEE 221
           G++V+QF+KWK+ TL  QL   L  S+MR++  T+  +  +       + +N +A  F  
Sbjct: 138 GVAVFQFKKWKSATLMQQLHRRLLTSKMRIDRHTILGLQARMFESLLGSERN-SAIFFRR 196

Query: 222 IFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIK 281
               + A+   D  +      S AD ++SF+ SR++EA KS+EQGIR YFLG DV  W++
Sbjct: 197 AMDDMSARQMDDTSFK-----SGADDMISFLDSRILEAFKSNEQGIRDYFLGADVKTWVE 251

Query: 282 EGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNN 341
            GY+  L S   R+  +  +   +  I YP+YL SS   K+ LADV+VAVL G       
Sbjct: 252 NGYELSLDSDSPRTIGKSIEGTFVMTITYPLYLLSSNQRKKLLADVTVAVL-GDSTPGKP 310

Query: 342 YDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTE 401
             FFL+Q N    N  C M IS+K   ++   QF++ +  ++G+  ++Y V   SDGH E
Sbjct: 311 SPFFLMQENFA-DNKDCPMVISIKPARALNTNQFILDETDDNGNHPSRYTVKTTSDGHRE 369

Query: 402 YTIR 405
           +  R
Sbjct: 370 FRYR 373

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  166 bits (421), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 163/315 (51%), Gaps = 13/315 (4%)

Query: 99  IFSRNFHFTSVRRS----GRYPFGNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXX 154
           I  R+FH  ++ RS    GR+P   + P +++   PL+  +A IG + +           
Sbjct: 61  IQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVALIGTIALLLVVLPLVFTF 120

Query: 155 XXXXXVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNP 214
                + GI+V+QF++W+N TL  QL   L  ++M +N +T+  +  +       +    
Sbjct: 121 LFPLIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYKTVWGLQTQMFESLLGSD--- 177

Query: 215 NAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGD 274
             G     F+GV  +++   I   AN+   AD  L+F+  RV+EA K++E G+R +FLG 
Sbjct: 178 --GFAAGSFRGVMDEIRSQKI-DAANSKRRADEALAFLDRRVLEAFKNNELGLRDFFLGS 234

Query: 275 DVSNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQG 334
           D S W+K+GYD  L +   R   +   N ++  I YP+YL SS+  ++ +A V++ VL  
Sbjct: 235 DASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLSSSQERKLIAYVAIGVLDD 294

Query: 335 HHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGES-GDFWTKYDVH 393
             A +    F  V+  L  QN +C M IS++   S+  KQFV+ D GE+ G   + Y V 
Sbjct: 295 SMAGQTG-SFKFVE-ELASQNKECPMVISIRPARSLYAKQFVLKDYGEARGKPTSAYYVR 352

Query: 394 ENSDGHTEYTIRNTD 408
              DGH E+T R+ D
Sbjct: 353 TADDGHREFTYRDAD 367

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score =  155 bits (391), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 112/324 (34%), Positives = 175/324 (54%), Gaps = 36/324 (11%)

Query: 99  IFSRNFHFTSVRRSGRYPFGNRPP----LRVFKISPLVIFLASIGALTVXXXXXXXXXXX 154
           I  R FH T  ++      GN  P    +++ +I  +++  +S+G L +           
Sbjct: 118 ILIRKFHSTPQKKFN----GNEGPPNRRIKIIRIPSILLIFSSLGILIITLMILPLLISA 173

Query: 155 XXXXXVVGISVYQFRKWKNNTLFDQLLNGLK---KSEMRLNSQTLNAMYVKSISKFFDAA 211
                ++GI+++QFRKWK NTL+ QLL  LK   K  M +   TLN++  K ++   D +
Sbjct: 174 FFPFLILGIALFQFRKWKQNTLYKQLLAHLKNKSKGHMSIKYSTLNSLQYKILN---DIS 230

Query: 212 QNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYF 271
              N+  F+     ++ KM  D I  NA + SEA  LL+ +QSR+MEAI++DE GIRTYF
Sbjct: 231 FMKNSQGFKPDI--LNMKM-NDFINSNARD-SEA--LLNLLQSRIMEAIETDELGIRTYF 284

Query: 272 LG-----DDVSNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLAD 326
           LG     ++V++W+ EG DFEL + +  S  +    E+I  + Y +YLKS   PKR +A+
Sbjct: 285 LGAADNINNVTHWVNEGLDFELDTKNSISKGKLVNGEMILSVTYALYLKSLKSPKRRIAE 344

Query: 327 VSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTS---SIL--PKQFVIIDGG 381
           VS+ VL     E+N+   F+   +L + N  C M  ++K      S+L  P QF++ D G
Sbjct: 345 VSIVVLD-ESVEKNHV--FISINDLAKTNKSCPMVFAIKPVKIDLSLLLQPFQFILDDYG 401

Query: 382 ESGDFWTKYDVHENSDGHTEYTIR 405
            SG   + YDV+    G+ E+ +R
Sbjct: 402 RSG---SNYDVYNTKSGNREFRLR 422

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  154 bits (389), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 159/312 (50%), Gaps = 34/312 (10%)

Query: 118 GNRPPLRVFKISPLVIFLASIG----ALTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKN 173
           G++P ++++K+SPL+I   ++      LT                 ++ I   QF++W+ 
Sbjct: 114 GDKPIVKIYKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQFKRWQK 173

Query: 174 NTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKM-KR 232
           N  +  +LN L ++E+++   T+ ++ ++ + + +    +   G+  E  KG++  + K+
Sbjct: 174 NVFYKDILNSLPRTELKITVPTMRSLQMQPMIQSWKDISS-RMGIPNEFAKGLNVDLVKQ 232

Query: 233 DGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSD 292
           D             + LSF++ RV+E+   +E GIR+YFLGD+V  WIKE YD EL   +
Sbjct: 233 D---------ETRKQFLSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIEN 283

Query: 293 CRSFVRGFKNEIIFWIVYPIYLKSST----------HPKRHLADVSVAVLQGHHAE---- 338
           CRS +R F++ I   + Y +YL S              K+HLADV V +L     E    
Sbjct: 284 CRSELRKFQDSIFASVQYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFN 343

Query: 339 ---RNNYDFF--LVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVH 393
               +  DFF  L ++     N   N  I+VKS ++ L   F+I   G+SGDF++KY V 
Sbjct: 344 GGGYSKADFFKILQESETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVS 403

Query: 394 ENSDGHTEYTIR 405
           +    HTEYT+R
Sbjct: 404 KVDGKHTEYTLR 415

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  149 bits (377), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/334 (28%), Positives = 162/334 (48%), Gaps = 40/334 (11%)

Query: 102 RNFHFTSVRRSGRYPF-------GNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXX 154
           R FH +S R   ++ F       G++P ++++K+SP  I  A+    T            
Sbjct: 84  RTFH-SSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFATASLFTFILTSTIIVIPF 142

Query: 155 XXX----XXVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDA 210
                    ++ I   QF+KW+ N  +  +L+ L ++E+++   T+ ++ ++ + + +  
Sbjct: 143 VLHFFFPLLIIFIFFKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKD 202

Query: 211 AQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTY 270
             +   G+  E  KG++  + +              + LSF+Q RV+E+   +E G+R+Y
Sbjct: 203 ISS-RMGIPNEFAKGLNVDLVKQN--------ETRKQFLSFLQKRVLESFTKNEMGVRSY 253

Query: 271 FLGDDVSNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHP---------- 320
           FLGD+V  WI+  YD EL    CRS +R F+  I   + Y +YL S  +           
Sbjct: 254 FLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEG 313

Query: 321 KRHLADVSVAVLQGHHAE-------RNNYDFF--LVQTNLIRQNAKCNMAISVKSTSSIL 371
           KRH+ADV V +L     E        +  DFF  L ++     +   NM I++KS ++ L
Sbjct: 314 KRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPL 373

Query: 372 PKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIR 405
            K FVI   G+SGDF++KY +      HTEYT+R
Sbjct: 374 SKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  143 bits (360), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 155/311 (49%), Gaps = 33/311 (10%)

Query: 118 GNRPPLRVFKISPLVIFLASIGA----LTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKN 173
            N+P ++V+K+SP  I  A+       LT                 ++ +   QF+KW+N
Sbjct: 116 NNKPFVKVYKVSPFFILFATASIFTFILTSTIIVIPFIFHFFFPLLIMLVFFKQFKKWQN 175

Query: 174 NTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRD 233
           NT +  +L  L K+E+++   T+ ++ ++ + + +    +   G+  E  KG++  +++ 
Sbjct: 176 NTFYKDILISLPKTELKITVPTMRSLQLQPMIQSWREISS-RMGIPNEFAKGLNVDLEKQ 234

Query: 234 GIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDC 293
                        + LSF+Q RV+E+   +E GIR+YFLGD V  WI+E YD EL   +C
Sbjct: 235 D--------ETRKQFLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLELDIDNC 286

Query: 294 RSFVRGFKNEIIFWIVYPIYLKS----------STHPKRHLADVSVAVLQGHHAE----- 338
           RS +R F+N +   + Y +YL S              K+H+ADV V +L     E     
Sbjct: 287 RSELRKFQNFVFSSVRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFPEIMFSG 346

Query: 339 --RNNYDFF--LVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHE 394
              +  DFF  L ++     +   NM I++KS +  L   FVI   G+SG+F++KY + +
Sbjct: 347 EGYSKADFFKILRESETANSSKMLNMIIAIKSVNP-LSSHFVITANGDSGNFFSKYHITK 405

Query: 395 NSDGHTEYTIR 405
               +TEYT+R
Sbjct: 406 IDGKNTEYTLR 416

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score =  136 bits (342), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 98/319 (30%), Positives = 152/319 (47%), Gaps = 49/319 (15%)

Query: 93  NKLSPSIFSRNFHFTSVRRSGRYPFGNRPP-LRVFKISPLVIFLASIGALTVXXXXXXXX 151
           NKLS   F RN++ +        PF ++ P +R+++I+ L + L S   L +        
Sbjct: 78  NKLSFLRFKRNYNGS--------PFEDKEPRVRIYRITTLNLLLGSAVVLLLSTMILPIL 129

Query: 152 XXXXXXXXVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAA 211
                   ++GI +YQ+R WK   LFDQ+  GL ++ + +  +TLN++    + K    +
Sbjct: 130 LKLIFPMIILGIFIYQYRIWKRTKLFDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILKKS 189

Query: 212 QNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYF 271
             P +                   W    ++S+A+ LLSF++ RV+EA K +E GI  YF
Sbjct: 190 V-PKS-------------------WYTNEDISDAEILLSFIKLRVIEAFKKNEMGISDYF 229

Query: 272 LG-----DDVSNWI-KEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLA 325
           L      DD+S  I KE   F          +R      I  + + + LK+  +   +LA
Sbjct: 230 LRRGQNFDDLSLLIDKENSQF---------LIRRLAGNFIVTMRHQLLLKNE-NVDIYLA 279

Query: 326 DVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGD 385
           DV ++VL     + +    F+    L + N  C M ISV S S ILP+QFVI D GE+G 
Sbjct: 280 DVMISVLD----DSSQTGIFMPLKELAKSNKSCKMVISVVSNSDILPRQFVITDEGETGK 335

Query: 386 FWTKYDVHENSDGHTEYTI 404
           F+ K+ V    DGH E+ I
Sbjct: 336 FYGKFTVSHGKDGHREFRI 354

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  131 bits (329), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/311 (28%), Positives = 155/311 (49%), Gaps = 32/311 (10%)

Query: 118 GNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXX----XXVVGISVYQFRKWKN 173
           GN+P ++V+K+SP  I  A+    T                     ++     QF+KW+ 
Sbjct: 118 GNKPFVKVYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFFFPLLIMFFFFKQFKKWQK 177

Query: 174 NTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRD 233
           N  +  +L  L K+++++   T+ ++ ++ + + +    +   G+  E  KG++  + + 
Sbjct: 178 NIFYKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISS-RMGIPNEFAKGLNVDLVKQ 236

Query: 234 GIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDC 293
                        + LSF+Q RV+E+   +E GIR+YFLGD V  WIKE YD EL   +C
Sbjct: 237 E--------ETRKQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNC 288

Query: 294 RSFVRGFKNEIIFWIVYPIYLKS----------STHPKRHLADVSVAVLQG-------HH 336
           RS +R F+  I   + Y +YL S              K+H+ADV V +L         + 
Sbjct: 289 RSELRKFQTFIFSSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNG 348

Query: 337 AERNNYDFF--LVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDVHE 394
              +  DFF  L ++     +   N  I++KS +++L K FVI   G+SG+F++KY++ +
Sbjct: 349 GAYSKADFFKILQESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISK 408

Query: 395 NSDGHTEYTIR 405
            +D +TEYT++
Sbjct: 409 INDKNTEYTLK 419

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score =  114 bits (285), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/390 (25%), Positives = 172/390 (44%), Gaps = 36/390 (9%)

Query: 34  RPGIGLGFIPRENPFLLAKGLTSLRPAVPVVMTRKLCHLT-RSPSPIVPPRYTRLNTIRF 92
           R G G+G +P+          + ++P     + R L  L  + P   VP      +TI+ 
Sbjct: 8   RTGAGMGILPK----------SPVKPFQNYAVIRPLSKLMIQQPRTNVPLSIHNRDTIKL 57

Query: 93  ------------NKLSPSIFSRNFHFTSVRRSGRYPFGNRPPLRVFKISPLVIFLASIGA 140
                       N   P I   NFH      +    FG  P  RVF +  L+I       
Sbjct: 58  GLIRDVKRTNWINTRGPLILRNNFHQGRPLSNMFNDFGKPPKFRVFVVPNLIILAGMTLT 117

Query: 141 LTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMY 200
             +                ++ I  +QF++W+ N + ++  +GLK S +R    T+ A++
Sbjct: 118 FALFLMVIPILFSFFFPLLILFIGFHQFKRWRANRMINKWFDGLKNSHLRTRMSTMYAIH 177

Query: 201 VKSISKFF--DAAQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEA-DRLLSFVQSRVM 257
            K++ +    +A Q    G +  IF      MK + ++ N+   +E+ ++L +F++ RV+
Sbjct: 178 TKNLEEMLHNEAKQ---FGSYGGIFNETLNAMKMNPMYKNSIEFNESGEKLRNFIEYRVI 234

Query: 258 EAIKSDEQGIRTYFLGDDVSNWIKEGYD--FELGSSDCRSFVRGFKN-EIIFWIVYPIYL 314
           EAI  +E+GIRT  L  +    +    D  F L  ++  SF R  K+  +I  + YP+Y 
Sbjct: 235 EAIYKNEEGIRTT-LFHNYEKALDPNIDKPFRLDFNNVNSFQRFEKDGSLISSVTYPLYT 293

Query: 315 KSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQ 374
                P   +  VS+  +  H    N     + + +L   + K    IS++S S ++P  
Sbjct: 294 NLKDKPAVVVGYVSIVTMNDHPLRINLGSGDIPKVDL---SKKLKFIISIRSPSEMIPNY 350

Query: 375 FVIIDGGESGDFWTKYDVHENSDGHTEYTI 404
           F+I   GE+G  ++ Y V + +DGH EYT+
Sbjct: 351 FIIDTVGETGKIFSHYSVGKTTDGHNEYTL 380

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 142/318 (44%), Gaps = 39/318 (12%)

Query: 102 RNFHFTSVR--RSGRYPF-GNRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXXXXXXX 158
           R+FH +  +    G+ PF   R P+ +F+++P+ IFL ++    +               
Sbjct: 87  RHFHQSHYKLYSMGKRPFFEGRTPVTIFRLTPMKIFLFALTFYVMIFLLVPFILSILLPA 146

Query: 159 XVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSI--------SKFFDA 210
            ++G + +Q+RKW+ N      +N L K++M     T N +    I        S+ F  
Sbjct: 147 AILGYAFFQYRKWRLNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSVEKDARSQVFGF 206

Query: 211 AQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTY 270
              PN  +F  +       M RD       +   +D+   F+++RV+EA  SDE G+R+ 
Sbjct: 207 TNTPNGPIFRAM-----NDMTRDL------STEASDKFKKFIEARVLEAFVSDEDGVRSA 255

Query: 271 FLGDDV-SNWIKEG--YDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADV 327
              D      IK       E G    RSFV   K  + +   +P+ + S +  + HL  V
Sbjct: 256 LASDHTWKQAIKTSRPLGIEFGRMVERSFVARDKKYMTY--AFPLSINSPSGSQSHLGRV 313

Query: 328 SVAVLQGHHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFW 387
           S+       A  N  D    +TNL        + + ++S S + P  F+I   G +G+F+
Sbjct: 314 SIVACHPLSAGFNPPD----KTNL-------KLILCIESNSKLSPDLFIIDTNGMTGEFF 362

Query: 388 TKYDVHENSDGHTEYTIR 405
           +KYDV +  D HTEYT++
Sbjct: 363 SKYDVQKFKD-HTEYTVK 379

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/340 (26%), Positives = 147/340 (43%), Gaps = 31/340 (9%)

Query: 78  PIVPPRYTRLNTIRFNK---LSPSIFS-RNFHFT--SVRRSGRYPFGNRP---PLRVFKI 128
           P++     R+N + +N+   +SP   + RNFH T  ++   GR PF   P   P  +F I
Sbjct: 50  PLLAALNPRMNLLHYNQNILVSPVKMALRNFHSTPRNMVLGGRDPFRKSPFNNPRFIFSI 109

Query: 129 SPLVIFLASI---GALTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKNNTLFDQLLNGLK 185
           SP    L+++   G +T+                + GI  YQF+ ++   L   L +   
Sbjct: 110 SPFSFILSTLLFAGFITMIVFVLPFLLALLFPMVIFGIGWYQFKAFRTRKLMQLLDHAFN 169

Query: 186 KSEMRLNSQTLNAMYVKS-ISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSE 244
           +++M+L+S T   + +K  + KF    Q  +   F            + G +PNA     
Sbjct: 170 QTKMKLSSTTRRELIMKQMVPKFKSFTQLKDFSGFPFKLSQAFTDKFQSGEFPNA----- 224

Query: 245 ADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGFKNEI 304
            DR LSFV+SR+ E+   +E  I++  LG D + ++    +    S    S VR   NE 
Sbjct: 225 -DRFLSFVKSRLDESFYKNEHNIKSIVLGSDTA-YVPGHMELVTNSYSFVSSVRN--NEN 280

Query: 305 IFWIVYPIYLKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQTNLIRQNAKCN-MAIS 363
           I    + +    S   ++ +A V +        + N  D  L+ T     ++K + M I 
Sbjct: 281 IQAFSFMLLNMGSEGVRKPVALVYIV------TKANPGDELLMFTGDYIDDSKLSPMVIY 334

Query: 364 VKSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYT 403
           V++ S    K   I D GE+G    +Y V    DG  EYT
Sbjct: 335 VRALSP-FSKCCFITDVGETGA-NAQYSVKRKKDGSKEYT 372

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 111/273 (40%), Gaps = 54/273 (19%)

Query: 123 LRVFKIS--PLVIFLASIGALTVXXXXXXXXXXXXXXXXVVGISVYQFRKWKNNTLFDQL 180
           +R ++IS  PL+IF  S   L V                +V I VYQF+KW+ N L+ +L
Sbjct: 88  IRYYRISMVPLLIF--STVTLMVFVIVLPVLLKLFFPVILVAIIVYQFKKWQRNQLYSRL 145

Query: 181 LNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKGVDAKMKRD-GIWPNA 239
           +  L KS++               S+F                      ++R  G+  N 
Sbjct: 146 MKYLPKSDLYTTK-----------SQFMS--------------------LRRSFGLLSNE 174

Query: 240 NNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDVSNWIK-----EGYDFELGSSDCR 294
             V ++    +FV++R+MEA+  D   IR+  +     +WI      E Y   +G +  +
Sbjct: 175 AVVGKSVEFTNFVKTRIMEALAKDTMKIRSTLIKP---SWIPKNAAVEEYQLTIGLNRVK 231

Query: 295 SFVRGF--KNEIIFWIVYPIY----LKSSTHPKRHLADVSVAVLQGHHAERNNYDFFLVQ 348
            F +    +++ +F + YP++    L+  T     +  V +  L  + +   N       
Sbjct: 232 MFAKALQGQSKAVFSVEYPLFFVTKLEDRTKQSHLMGKVCLHFLYDYSSILKNSAKSFDP 291

Query: 349 TNLIRQ----NAKCNMAISVKSTSSILPKQFVI 377
             L +Q     +K    ISV  T ++ PK F++
Sbjct: 292 ETLFKQMNDTESKVQYVISVIQTGTLSPKPFIL 324

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/314 (18%), Positives = 123/314 (39%), Gaps = 51/314 (16%)

Query: 99  IFSRNFHFTSVRRSGRYPFG-----NRPPLRVFKISPLVIFLASIGALTVXXXXXXXXXX 153
           +  R F+ TS ++S ++ F      N   ++ + I   V+ L++IG   +          
Sbjct: 97  VLKRGFYTTS-KKSIKFIFSKGDKDNHNKMKYYSIPTPVVILSTIGGFVLLFTILPFLFT 155

Query: 154 XXXXXXVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQN 213
                 +  I  +QFR+WK + L+ ++   L+ S++ + +  L ++  + I +      N
Sbjct: 156 FGFPFLIGMIVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLKYRLIEQGLPMLTN 215

Query: 214 PNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFL- 272
            +    +++                    S  + L++ +Q R+ E+  +++  I   F+ 
Sbjct: 216 FSNKTTKQL-------------------SSRGETLINQLQQRIKESFANNDNNIANVFVP 256

Query: 273 -GDDVSNWIKEGYDFELGSSDCRSFVRGF-KNEIIFWIVYPIYLKSSTHPKRHLADVSVA 330
            G  +S      Y+  L     +S+ +    ++ I  +   +Y++   H    +A     
Sbjct: 257 QGHKLSE-----YELLLPHHTFKSYTKKLPHDQDIGLLSLSLYMRRRQHRNIKVAMPIPV 311

Query: 331 VLQGHHAERNNYDFF-------LVQTNLIRQNAKCNM-----------AISVKSTSSILP 372
            L   +   N Y  +       L+ T ++ + AK  +            IS+    S LP
Sbjct: 312 ELNLGNKVANVYFVYKGDTARGLLNTQILLEAAKAGVDLQEIKSSTQFLISIVPLDSWLP 371

Query: 373 KQFVIIDGGESGDF 386
            Q++I D G  G F
Sbjct: 372 TQYIIADAGSLGSF 385

>TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3.220
            YDR011W
          Length = 1631

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 175  TLFDQL--LNGLKKS-------EMRLNSQTLNAMYVKSISKFFDAAQNPNAGVFEEIFKG 225
            TLF+Q   L  LKK        ++  NS+TL   +  + ++  D ++NP   + E I  G
Sbjct: 1176 TLFEQFDRLLLLKKGGQTVYFGDIGKNSRTLLDYFEGNGARICDFSENPAEYILESIGAG 1235

Query: 226  VDAKMKRD--GIWPNA----NNVSEADRLLSFVQSR 255
              A +K D   IW N+    N  +E D+L+  +Q++
Sbjct: 1236 ATASVKEDWHEIWLNSPEYTNLANEVDKLILELQAK 1271

>KNAG0L00990 Chr12 (183931..186168) [2238 bp, 745 aa] {ON} Anc_7.166
           YER015W
          Length = 745

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 36  GIGLGFIPRENPFLLAKGLTSLRP----AVPVVMTR 67
           G+GLGF+ + +P LL + L  L+P     VP ++TR
Sbjct: 364 GVGLGFLNKPDPTLLVENLKLLKPDSLALVPRILTR 399

>NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {ON}
           Anc_8.140
          Length = 826

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 10/98 (10%)

Query: 31  MMLRPGIGLGFIPRENPFLLAKGLTSLRPAVPVVMTRKLCHLTRSPSPIVPPRYTRLNTI 90
           M   P   + F P +    L + L+   P++ +   RKL         I P   T LN++
Sbjct: 1   MAPSPNKNMHFSPLKESVSLQRSLSET-PSMQIRQRRKL---------ISPSSVTSLNSL 50

Query: 91  RFNKLSPSIFSRNFHFTSVRRSGRYPFGNRPPLRVFKI 128
           ++N  SP+ F  N   T+    G  P   +  L  ++I
Sbjct: 51  KYNSPSPTSFGNNVKETNKVLLGYDPISKKQILNNYEI 88

>ADR052W Chr4 (802093..804345) [2253 bp, 750 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YER015W (FAA2)
          Length = 750

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 24  FKVEMHSMMLRPGIGLGFIPRENPFLLAKGLTSLRPAVPVVMTRKLCHL 72
           ++ +M  + L    G+GF+ + NP L  + +  LRPA+  ++ R L  L
Sbjct: 353 YQRQMTGLNLMHAFGIGFLHKPNPDLFIEAMCVLRPAMVSLVPRVLTKL 401

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,772,607
Number of extensions: 1766352
Number of successful extensions: 4268
Number of sequences better than 10.0: 22
Number of HSP's gapped: 4338
Number of HSP's successfully gapped: 22
Length of query: 408
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 296
Effective length of database: 40,638,807
Effective search space: 12029086872
Effective search space used: 12029086872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)