Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B04840g3.165ON47647625400.0
TDEL0D045803.165ON48248419950.0
YOL062C (APM4)3.165ON49149117110.0
Suva_15.1033.165ON49149116930.0
Skud_15.913.165ON49149116820.0
Smik_15.963.165ON49149116790.0
Kpol_1045.443.165ON46947816680.0
NCAS0C035803.165ON49149616580.0
CAGL0C05203g3.165ON47549016320.0
SAKL0C07414g3.165ON48249116240.0
NDAI0G029203.165ON48649116110.0
Kwal_33.141823.165ON46748515630.0
KLTH0F06534g3.165ON46648215540.0
TPHA0P006603.165ON47348515350.0
TBLA0F008403.165ON48148114580.0
Ecym_52393.165ON46448514070.0
KNAG0K011503.165ON47449214000.0
KLLA0C03894g3.165ON47548612421e-168
ADR315W3.165ON49245111901e-159
KAFR0C010203.165ON42848911251e-151
SAKL0F05346g7.127ON4474905127e-59
KLTH0F12584g7.127ON4414894995e-57
Kwal_55.208437.127ON4414874986e-57
KLLA0D14311g7.127ON4434924943e-56
Ecym_83507.127ON4454824934e-56
NDAI0E036807.127ON4444834795e-54
KAFR0L004707.127ON4655044781e-53
ADL017C7.127ON4434904715e-53
YPL259C (APM1)7.127ON4755084721e-52
Smik_6.4667.127ON4765164702e-52
CAGL0K00539g7.127ON4564964682e-52
TBLA0A009507.127ON4695084666e-52
TPHA0C043207.127ON4544934622e-51
KNAG0L009507.127ON4614964612e-51
Suva_16.457.127ON4785104605e-51
NCAS0E021407.127ON4814944581e-50
ZYRO0C05236g7.127ON4474874524e-50
TDEL0H028907.127ON4424884515e-50
Kpol_1062.567.127ON4504974491e-49
Skud_16.197.127ON4765144474e-49
Kwal_26.81462.555ON5054752461e-21
KLTH0D07502g2.555ON5044912433e-21
SAKL0D13090g2.555ON4994812292e-19
Ecym_45912.555ON5015262193e-18
KLLA0F25432g2.555ON5073412033e-16
KAFR0A020602.555ON5403351972e-15
ZYRO0E05874g2.555ON5493251892e-14
TPHA0I023902.555ON5593451855e-14
TDEL0B064302.555ON5254991802e-13
ABR047W2.555ON4982831793e-13
TBLA0B067602.555ON6572351696e-12
SAKL0A09218g2.522ON4735211661e-11
CAGL0K03223g2.555ON5983641661e-11
Skud_8.262.555ON5963581661e-11
KLLA0E18789g2.522ON4971371652e-11
KAFR0D035602.522ON4553131632e-11
Kpol_1056.132.555ON5413381633e-11
NCAS0A126502.555ON5883711624e-11
NDAI0B016102.555ON6722271616e-11
KNAG0C055502.555ON5823471607e-11
Suva_8.332.555ON5963791543e-10
KLTH0D06556g2.522ON4563091517e-10
TBLA0I006202.522ON6092081492e-09
YHL019C (APM2)2.555ON6053601473e-09
Smik_8.232.555ON6033611464e-09
Kwal_26.79572.522ON4563101411e-08
AGL061W2.522ON4113001331e-07
TDEL0A029702.522ON4961401241e-06
Kpol_1018.422.522ON5751471242e-06
NCAS0A048702.522ON4891561223e-06
ZYRO0B01738g2.522ON4921511161e-05
NDAI0K019302.522ON6121631125e-05
TPHA0C041302.522ON5331461108e-05
Smik_2.4302.522ON4841351044e-04
Ecym_72662.522ON517259990.002
CAGL0L02145g2.522ON543286980.002
Skud_2.4192.522ON484135890.025
YBR288C (APM3)2.522ON483133860.057
Suva_4.5482.522ON484155840.11
KNAG0F010602.44ON42861830.12
KNAG0A069702.522ON50552800.33
TBLA0C031405.274ON501110761.1
KAFR0A077602.44ON42589751.1
TPHA0C036102.336ON54375741.7
Ecym_42128.362ON74575732.2
NCAS0F040103.575ON547251713.4
NDAI0F036002.44ON42189704.1
Kpol_507.73.575ON53361714.4
NDAI0F012206.279ON96051705.4
TDEL0D064303.575ON536103705.5
NDAI0B063203.575ON54058705.7
YEL025C1.464ON118873689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B04840g
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   983   0.0  
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   773   0.0  
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   663   0.0  
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   656   0.0  
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   652   0.0  
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   651   0.0  
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   647   0.0  
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   643   0.0  
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   633   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   630   0.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   625   0.0  
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   606   0.0  
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   603   0.0  
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   595   0.0  
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   566   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   546   0.0  
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   543   0.0  
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   483   e-168
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   462   e-159
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   437   e-151
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   201   7e-59
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   196   5e-57
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   196   6e-57
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   194   3e-56
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   194   4e-56
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   189   5e-54
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   188   1e-53
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   186   5e-53
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   186   1e-52
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   185   2e-52
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   184   2e-52
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   184   6e-52
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   182   2e-51
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   182   2e-51
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   181   5e-51
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   181   1e-50
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   178   4e-50
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   178   5e-50
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   177   1e-49
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   176   4e-49
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...    99   1e-21
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...    98   3e-21
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...    93   2e-19
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...    89   3e-18
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    83   3e-16
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    80   2e-15
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    77   2e-14
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    76   5e-14
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...    74   2e-13
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    74   3e-13
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    70   6e-12
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    69   1e-11
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    69   1e-11
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    69   1e-11
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    68   2e-11
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    67   2e-11
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    67   3e-11
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    67   4e-11
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    67   6e-11
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    66   7e-11
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    64   3e-10
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    63   7e-10
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    62   2e-09
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    61   3e-09
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    61   4e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    59   1e-08
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    56   1e-07
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    52   1e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    52   2e-06
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    52   3e-06
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    49   1e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    48   5e-05
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    47   8e-05
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    45   4e-04
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    43   0.002
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    42   0.002
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    39   0.025
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    38   0.057
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    37   0.11 
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    37   0.12 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    35   0.33 
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    34   1.1  
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    33   1.1  
TPHA0C03610 Chr3 (783935..785566) [1632 bp, 543 aa] {ON} Anc_2.3...    33   1.7  
Ecym_4212 Chr4 (443277..445514) [2238 bp, 745 aa] {ON} similar t...    33   2.2  
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    32   3.4  
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    32   4.1  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    32   4.4  
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    32   5.4  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    32   5.5  
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    32   5.7  
YEL025C Chr5 complement(102581..106147) [3567 bp, 1188 aa] {ON} ...    31   9.5  

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/476 (100%), Positives = 476/476 (100%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM 180
           GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM 180

Query: 181 SQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLS 240
           SQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLS
Sbjct: 181 SQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLS 240

Query: 241 GTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNK 300
           GTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNK
Sbjct: 241 GTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNK 300

Query: 301 ERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTVEYRITLKSLFPNKLSAKDV 360
           ERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTVEYRITLKSLFPNKLSAKDV
Sbjct: 301 ERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTVEYRITLKSLFPNKLSAKDV 360

Query: 361 ALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQLT 420
           ALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQLT
Sbjct: 361 ALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQLT 420

Query: 421 LQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVRY 476
           LQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVRY
Sbjct: 421 LQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVRY 476

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/484 (77%), Positives = 422/484 (87%), Gaps = 10/484 (2%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+AI I+S+RGELIV+K   +SLK+SISDIFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           GSDSLW+V VSR+NANSGAIWEFLYK N I+D Y LTKE  LKE+FM CYEILD V+  G
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 121 GIPMDTELGSIASKISVKPPK--SGGTSSEPKSSTVANF----PGSNLSTSNLSMPKFLT 174
           GIP+DTEL S+ SK++VKPPK  SG     P   T+++     PG   S+S LSMPKFLT
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGD--SSSTLSMPKFLT 178

Query: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           RNNRSMSQDLG+NYPSN  WRP+GIKYKKNEV L VNEKI+ILVSRDGSILK+YVDGTID
Sbjct: 179 RNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTID 238

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS 294
           +TTHLSG PICQFGLNDS SVEFGD    + ++F NKKA+PKAAAG VMLEDCKFHQCVS
Sbjct: 239 LTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVS 298

Query: 295 LDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRITLKSLFP 352
           LDKFNK+R+IKFVPPDG+MELMKYCVRDNLNLPFK+TP+VT    G+T++YR+TLKSLFP
Sbjct: 299 LDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFP 358

Query: 353 NKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVP 412
            KLSAKDV+L IPVPPGTVDC+IN+SNGKCKF  EE+AM+W+F KY GLTENTLSAVTVP
Sbjct: 359 GKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVP 418

Query: 413 TSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSY 472
           +SDTTQLT+QQWPRPPMSL FEIMMFSNSGLVVRYF+VSDKDE+YR  KWIKYISKSGSY
Sbjct: 419 SSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSGSY 478

Query: 473 EVRY 476
           E+RY
Sbjct: 479 EIRY 482

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/491 (66%), Positives = 399/491 (81%), Gaps = 15/491 (3%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +YS+RGEL+++K F NSLKRSISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
             D+LW+VT++R+NANS AIWEFLYK +A+++AY L +EE LKE+FMI +E+LD+++G  
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPMDTELGSIASKISVKPPKS-GGTSSEPKSSTVANFPGSNLSTSN-LSMPKFLTRNNR 178
           GIP+DTEL S+ +++SVKP ++ GG    P  + V +   S  S++  L  PKFLT+ + 
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS 180

Query: 179 S-MSQDLGTN--YPSN-FPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           S + Q   T+  Y +N   WRP GI +KK+EVFLYVNE+INILVSRDGSILK+YVDGTID
Sbjct: 181 SFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTID 240

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSL-WLDTQEFH------NKKAVPKAAAGSVMLEDC 287
           +TTHLSGTPIC+FGLNDS  ++  D   WL  Q+ H      NK  +PKAAAGSV+LEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLEDC 300

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRI 345
           KFH+CVSLDKFN+  II+FVPPDG+MELMKY VRDN+NLPFK+TP+VT     + ++YRI
Sbjct: 301 KFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRI 360

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
           TLKSLFP KLSAKDV LHIPVPP TVDCKI++SNG CKF  EENAM+WRFNKY+GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSAVTV TSDTTQL LQQW RPP+SL FE+MMFSNSGLVVRYF +S KD K+R VKWIKY
Sbjct: 421 LSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY 480

Query: 466 ISKSGSYEVRY 476
           ISK+GSYEVRY
Sbjct: 481 ISKAGSYEVRY 491

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/491 (65%), Positives = 393/491 (80%), Gaps = 15/491 (3%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +YS+RGELI++K F NSLKRSISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
             D+LW+VT++R+NANS AIWEFLYK +++++AY L +EE LKE+FMI +E+LD+++G  
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPMDTELGSIASKISVKPPKS-GGTSSEPKS-STVANFPGSNLSTSNLSMPKFLTRNNR 178
           GIP+DTEL S+ +++SVKP ++ GG    P S   +++    +     L  PKFL + + 
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKRSS 180

Query: 179 SM--SQDLGTNYP--SNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           S     D  +++   +   WRP GI +KK+EVFLYVNE++NILVSRDGSILK+YVDGTID
Sbjct: 181 SFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSL-WLDTQE------FHNKKAVPKAAAGSVMLEDC 287
           +TTHLSGTP+C+FGLNDS  ++  D   WL  Q+      F NK   PKAAAGSV+LEDC
Sbjct: 241 ITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVLLEDC 300

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCG--STVEYRI 345
           KFH+CVS+DKFNK  II+FVPPDG+MELMKY VRDN+NLPFKITP+V      + V+YRI
Sbjct: 301 KFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDYRI 360

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
           TLKSLFP KLSAKDV LHIPVPP TVDCKI++SNG CKF  EENAM+WRFNK++GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENT 420

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSAVTV TSDTTQL+LQQW RPPMSL FE+MMFSNSGLVVRYF +S +D K+R VKWIKY
Sbjct: 421 LSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKWIKY 480

Query: 466 ISKSGSYEVRY 476
           ISKSGSYEVRY
Sbjct: 481 ISKSGSYEVRY 491

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/491 (64%), Positives = 393/491 (80%), Gaps = 15/491 (3%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + +YS+RGELI++K F NSLKRSISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
             D+LW+VT++R+NANS AIWEFLYK +A+++AY L +EE LKE+FMI +E+LD+++G  
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPMDTELGSIASKISVKPPKSGG--TSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNR 178
           GIP+DTEL S+ +++SVKP ++ G        S  +++    + +   L  PKFL +++ 
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKSSS 180

Query: 179 S-MSQDLGTN--YPSN-FPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           S + Q   T+  Y SN   WR  GI +KK+EVFLYVNE++NILVSRDGSILK+YVDGTID
Sbjct: 181 SFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSL-WLDTQ------EFHNKKAVPKAAAGSVMLEDC 287
           + THL+GTP+C+FGLNDS  ++  D   WL  Q      +F NK  +PKAAAGSV+LEDC
Sbjct: 241 IVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDC 300

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRI 345
           KFH+CVS++KFNK  II+F+PPDG+MELMKY VRDN+NLPFKITP+V+     + ++YRI
Sbjct: 301 KFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDYRI 360

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
           TLKSLFP KLSAKDV LHIPVPP TVDCKI++SNG CKF  EENAM+WRFNKY+GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSA TV TSDTTQL+ QQW RPPMSL FE+MMFSNSGLVVRYF +S KD K+R VKWIKY
Sbjct: 421 LSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKY 480

Query: 466 ISKSGSYEVRY 476
           ISKSGSYEVRY
Sbjct: 481 ISKSGSYEVRY 491

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/491 (64%), Positives = 392/491 (79%), Gaps = 15/491 (3%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ + IYS+RGEL+++K F NSLKRSISDIFR+QVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
             D+LW+VT++R+NANS AIWEFLYK + +++AY L +EE LKE+FMI +E+LD+++G  
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 121 GIPMDTELGSIASKISVKPPK-SGGTSSEPKSS-TVANFPGSNLSTSNLSMPKFLTRNNR 178
           GIP+DTEL S+ +++SVKP + +GG    P  +  +++    +  +  L  PKFL +++ 
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 179 SM--SQDLGTNY--PSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           S     D  +++   +   WRP GI +KK+EVFLYVNE++NILVSRDGSILK+YVDGTID
Sbjct: 181 SFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSL-WLDTQEFHN------KKAVPKAAAGSVMLEDC 287
           +TTHLSGTPIC+FGLNDS  ++  D   WL  Q+ H+      K  + KAAAGSV+LEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GSTVEYRI 345
           KFH+CVSLDKFNK   I+FVPPDG+MELMKY VRDN+NLPFKITP+VT     + ++YRI
Sbjct: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
           TLKSLFP KLSAKDV LHIPVPP TVDCKI++SNG CKF  EENAM+WRFNKY+GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSAVTV TSDTTQL LQQW RPPMSL FE+MMFSNSGLVVRYF +  KD K+R VKWIKY
Sbjct: 421 LSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKY 480

Query: 466 ISKSGSYEVRY 476
           IS+SGSYEVRY
Sbjct: 481 ISRSGSYEVRY 491

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/478 (65%), Positives = 386/478 (80%), Gaps = 11/478 (2%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIN + +Y+ +GELIVSK   ++ KRSISDIFR+QVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
             D LW+V V+R+NANSGAIWEFLYKF+++L+A+ L  E  LKE+FM CYE+LD+++   
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM 180
           G+P+DTEL S+++K+S KP  S  + S+              S+S LS+ KFL RNNRSM
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHSINSPSDSSLDN---------SSSPLSISKFLNRNNRSM 171

Query: 181 SQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLS 240
           S D     PSN+PWRPNGIKYKKNE+FL +NEKI+ILVS+D +ILKAYVDGT+D+T+HLS
Sbjct: 172 SVDTMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLS 231

Query: 241 GTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNK 300
           GTP CQFGLNDS SV+  +    D   F N++ +P+A AG+V+LEDCKFH+CVSLDKFN+
Sbjct: 232 GTPTCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNR 291

Query: 301 ERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGST--VEYRITLKSLFPNKLSAK 358
           +RIIKFVPPDG++ELMKY VRDN+NLPFK+TP V    S   ++YRITLKSLFP+KLSA 
Sbjct: 292 DRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSAN 351

Query: 359 DVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQ 418
           DV L IPVP  TVDCK+N+SNGKC+F  EE+ ++W+F KY+GLTEN LSAVTV ++DTTQ
Sbjct: 352 DVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDTTQ 411

Query: 419 LTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVRY 476
           L LQQW RPP+SL FEIMMFSNSGLVVRY ++ +KD+KYR VKWIKYIS+SGSYEVRY
Sbjct: 412 LMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGSYEVRY 469

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/496 (65%), Positives = 394/496 (79%), Gaps = 25/496 (5%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MINA+ I++ RGEL+VSKLF  S+KRSI+DIFRIQVINNLDVRSPILTLGSTTFHHI+S 
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVI-GA 119
             D+LWIV VSR N +S AIWEFLYK +++LD+Y L  EE LKE+FMI +E+LDV++ G+
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 120 GGIPMDTELGSIASKISVKPPKS---GGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRN 176
           GGIPM TE   + S++SVKP KS      S    S+T +N   +N+    +S PK L RN
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRRN 180

Query: 177 NRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMT 236
           + S+SQDL     ++F WRP GI +KKNEV L+VNE+INILVS+DGS+LKAYVDG+ID+ 
Sbjct: 181 SASLSQDLSI--LTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSIDLE 238

Query: 237 THLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHN--------------KKAVPKAAAGSV 282
           THLSGTPICQFGLNDS SV   DS   D    HN              KK +  A+ GSV
Sbjct: 239 THLSGTPICQFGLNDSLSVSGVDS---DMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSV 295

Query: 283 MLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC--GST 340
           +LEDCKFHQCVSLDKF+K+RIIKFVPPDG+MELMKY VRDNLNLPFK++P+VT    G+ 
Sbjct: 296 ILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTA 355

Query: 341 VEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHG 400
           +EYRIT+KSLFP +LSAK+VALHIPVPP T+DCKIN++NG CKF  EE+AM+WRFNK++G
Sbjct: 356 LEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNG 415

Query: 401 LTENTLSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVV 460
           LTENTLSAVT+PT D TQL+LQQW +PPMSL FEI+MFSNSGLVVRYF ++++D+KY+ V
Sbjct: 416 LTENTLSAVTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYKAV 475

Query: 461 KWIKYISKSGSYEVRY 476
           KWIKYIS+SGSYE+RY
Sbjct: 476 KWIKYISRSGSYEIRY 491

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 386/490 (78%), Gaps = 29/490 (5%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A+ ++S+RGELIVSK F N+LKRSISDIFRIQVINNLDVRSPILTLGSTTF HIRSN
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  -GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGA 119
              D LW+V+V+R+N N GA+WEFLYKF+ +L+ Y L  EE LKE+FM+CYE+LDV++G 
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 120 GGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGS--NLSTSNLSMPKFLTRNN 177
            G PMDT+  ++  K+SVKP K           T+ NF  S  N +++   +PKFL R +
Sbjct: 121 NGTPMDTDPATVIKKMSVKPSKE----------TIENFAISVQNKNSTLPKIPKFLRRTS 170

Query: 178 RSMSQDLGTNYPSNF------PWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231
             ++Q+   N    F      PWRP GI +KKNE+FLYVNEKI+ILVS++GSILK+YVDG
Sbjct: 171 SFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDG 230

Query: 232 TIDMTTHLSGTPICQFGLNDSPSV---EFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288
           TID+ THLSGTP+CQFGLNDS SV   ++GDS         NKKA+PKAAAGSV+LEDCK
Sbjct: 231 TIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSF----DYIKNKKAIPKAAAGSVLLEDCK 286

Query: 289 FHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVT--PCGSTVEYRIT 346
           FHQCVSL+KF+K+RIIKFVPPDG+MELMKY VR N+NLPFK++P+VT    G+ VEYRIT
Sbjct: 287 FHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRIT 346

Query: 347 LKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTL 406
           LKSLFP+KL+AK+V + IPVPP T+DCKI++SNG CKF  EE AM+W FNKY+GLTENTL
Sbjct: 347 LKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTL 406

Query: 407 SAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466
           SAVT+ + D  +L +QQW +PP+SL FEIMMFSNSGLVVRYF + +  E+Y+ VKWI+Y+
Sbjct: 407 SAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKE-SERYKTVKWIRYV 465

Query: 467 SKSGSYEVRY 476
           SKSGSYE+RY
Sbjct: 466 SKSGSYEIRY 475

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/491 (62%), Positives = 384/491 (78%), Gaps = 24/491 (4%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M+NA+F++S +GEL+VSKL  +++KRS+++IFRIQVINNLDVRSP+LTLGSTTFHHIRS 
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRS- 59

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
            S +LWIV V+R+NA+S AIWEFLYKFNA+L+AY L  EE LKE+FM CYE+LDVV+   
Sbjct: 60  -SSNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVL-EN 117

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSM 180
           G+P+DTEL S+ASK+S +P  S    + P +  +     +N+      MPKFL   N+  
Sbjct: 118 GVPVDTELSSVASKMSRRPVVS--LENNPLTDELLMSAAANVDLG-FRMPKFL---NKGS 171

Query: 181 SQDLGTNYPSN---------FPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231
                 + P+N         +PWR +GIKYKKNE+FL VNE+INILVS+DGSILK+YVDG
Sbjct: 172 RSSSSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDG 231

Query: 232 TIDMTTHLSGTPICQFGLNDSPSVEFG----DSLWLDTQEFHNKKAVPKAAAGSVMLEDC 287
           ++D+TTHLSGTP+CQFGLNDS S++ G    D  ++   E  NKKA+PKAAAGSV LEDC
Sbjct: 232 SVDLTTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDC 291

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPV--VTPCGSTVEYRI 345
           KFHQCV L++FN +RII+FVPPDG+ ELM+Y VRDNLNLPFKITP+  V      VEYR+
Sbjct: 292 KFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRV 351

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
            LKSLFP+KL+AKDV L IPVPPGTVDCKIN SNG+C+F  EENA++W+F KY GLTENT
Sbjct: 352 ALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENT 411

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSA+TVP  + + L LQQW RPPMSL FEI+MFSNSGLVVR+F+VS++D  Y  VKW+KY
Sbjct: 412 LSALTVPMDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKY 471

Query: 466 ISKSGSYEVRY 476
           IS+SG+YEVRY
Sbjct: 472 ISRSGAYEVRY 482

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/491 (63%), Positives = 384/491 (78%), Gaps = 20/491 (4%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIN I IYS RGELIVSKLF  +LKRSI+DIFRIQVINNLDVRSPILTLGSTTFHHIRS+
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  -GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGA 119
             SD+LW+V  +R NANS AIWEFLYK +++L  Y L KEE LKE+FMI +E+LDV++G+
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 120 GGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRS 179
            GIP++TE   + +K+SVKP K    ++   SS +    GS    + +SMPKFL RN+ S
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNT---SSLLDGHLGSK-GNNEISMPKFLKRNDSS 176

Query: 180 MSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHL 239
            S D   ++ ++F WRP  IK+KKNEV L+VNEKINILV++DGSILKAYVDG+ID+ T L
Sbjct: 177 QSHDSNFSF-NDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 240 SGTPICQFGLNDSPSVEFGDSLW--LDTQEFHNK----------KAVPKAAAGSVMLEDC 287
           SGTP+CQFGLNDS ++   DS +   + +  +NK          K + KA+ G+V+LEDC
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 288 KFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTP--CGSTVEYRI 345
           KFHQCVSLDKF++ERIIKFVPPDG++ELMKY +R+NLNLPFKITP+VT    G  ++YRI
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENT 405
            LKSLFP +LSAK V LHIPVPPG +DC I++SNG CKF   ENAMVW+FNKY+GLTENT
Sbjct: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415

Query: 406 LSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           LSAVTVP+ +  Q TLQQW RPPMSL FEI+MFSNSGLVVRYF +S+  + Y+ VKWIKY
Sbjct: 416 LSAVTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKY 475

Query: 466 ISKSGSYEVRY 476
           +SKSGSYEVR+
Sbjct: 476 VSKSGSYEVRF 486

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/485 (62%), Positives = 380/485 (78%), Gaps = 27/485 (5%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M+NA+FIYS RGEL++SK    S+++S+S+IFRIQVINNLDVRSP+LTLGSTTFHHI+S 
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKS- 59

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
            + +LWIV VSR+NA+S AIWEFLY+ N +L+A++L  E +LKE FMICYE+LD+V+   
Sbjct: 60  -AKNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVL-ED 117

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFP-----GSNLSTSNLSMPKFLT- 174
           G+P+DTEL S+ASK+SVKP           ++ V NF      G   +   L + +FL  
Sbjct: 118 GLPVDTELSSVASKMSVKP-----------NAGVDNFNMFAENGHGGTNRILPVSQFLRG 166

Query: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
           R +    QD+ +  PSN PWR NGIKYKKNEVFL VNE+I+ILVS+DGSILK+YVDGT++
Sbjct: 167 RPSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVE 226

Query: 235 MTTHLSGTPICQFGLNDSPSVE--FGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQC 292
            TTHLSG P+C+FGLND+ SV   FGD    D  +  NKKA+PKAAAGSVMLEDCKFHQC
Sbjct: 227 ATTHLSGMPVCRFGLNDALSVSTPFGDD---DEYQVTNKKAIPKAAAGSVMLEDCKFHQC 283

Query: 293 VSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGS-TVEYRITLKSLF 351
           V LDKF  ER I F+ PDG+ ELMKY VR+NLNLPFK+TP+VT   S +++Y+IT+KSLF
Sbjct: 284 VQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLF 343

Query: 352 PNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTV 411
           P+KL+AKDV L IPVPP TV C I+ SNGKCKF  EE+A+VW+F+KY GLTEN++SA  V
Sbjct: 344 PSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAV 403

Query: 412 PTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471
           P  D+T L ++QWPRPP+SL FEI+MFSNSGLVVR+F VS++D  Y++VKWIKY+SKSG+
Sbjct: 404 PMKDST-LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA 462

Query: 472 YEVRY 476
           YEVRY
Sbjct: 463 YEVRY 467

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/482 (62%), Positives = 377/482 (78%), Gaps = 22/482 (4%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M++A+FI+S RGEL++SK   +S+ +S+S+IFRIQVINNLDVRSP+LTLGSTTFHH++S 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           G+  LWIV VSR+NA+S AIWEFLYK +A+L+A+ L  E +LKEDFM CYE+LD+V+   
Sbjct: 61  GN--LWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVL-ED 117

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMP--KFL-TRNN 177
           G+P+DTEL S+ASK+SVKP  S        +  +  F  S    +N  +P  +FL  R++
Sbjct: 118 GVPVDTELSSVASKMSVKPSAS--------AERINTFIESGNGGTNRILPVAQFLRARSS 169

Query: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237
            S   D  +  PSN PWR NGIKYKKNEVFL VNE+I+ILVS+DGSILK+YVDGT++ TT
Sbjct: 170 SSNLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATT 229

Query: 238 HLSGTPICQFGLNDSPSVE--FGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
           HLSG P+C+FGLNDS SV   FGD    +     NKKA+PKAAAGSVMLEDCKFHQCV L
Sbjct: 230 HLSGMPVCRFGLNDSLSVSTPFGD----NESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLFPNK 354
           DKF  ER I F+PPDG+ ELMKY VR+NLNLPFKITPVVT    ++++YR+T+KSLFP+K
Sbjct: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345

Query: 355 LSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTS 414
           L+AKDV L IPVPP TVDC I+ SNG+CKF  EE+A++W+F+KY GLTEN+LSA  VP  
Sbjct: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMK 405

Query: 415 DTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEV 474
           D+  L + QW +PPMSL FEI+MFSNSGLVVR+F VS+ D  Y++VKWIKY+SKSG+YEV
Sbjct: 406 DSA-LNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGAYEV 464

Query: 475 RY 476
           RY
Sbjct: 465 RY 466

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 372/485 (76%), Gaps = 21/485 (4%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MIN + IYS+RG+LIV  L  +SLKR+ISDIF+IQVIN+L+++SPILTLGSTTFHHIRS+
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
               LWIV ++R+NANSG IWEFLYK +++L AYDL  EEKL E FM+ YE++DV++ + 
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSN-LSMPKFLTRNNRS 179
            +P++TEL SIASKIS + PK           T++N P +  + +N LS+PKFLTRN+RS
Sbjct: 121 AMPINTELSSIASKISYRLPK-----------TISNSPTNEKNNNNGLSIPKFLTRNSRS 169

Query: 180 MSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHL 239
           MSQ+      S+ PWRP GIKYKKNEVFLYVNEKINILVS+D +ILKAYVDG+ID+ +HL
Sbjct: 170 MSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHL 229

Query: 240 SGTPICQFGLNDSPSVEFGDSLWLDTQEFHNK------KAVPKAAAGSVMLEDCKFHQCV 293
           SGTPICQFGLND  S+  G+++     EF +        +  ++++ SV +EDC FHQCV
Sbjct: 230 SGTPICQFGLNDYLSMT-GNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCV 288

Query: 294 SLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGS--TVEYRITLKSLF 351
           SLDKFN ER+I FVPPDG+ ELM+Y VRD+LN+PFK+TP V+   S  ++ Y+I LKSLF
Sbjct: 289 SLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLF 348

Query: 352 PNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTV 411
           P  LSA D  L IP+PPGTVDCKIN S+GKC F + +N  +W+FNKY GLTEN L   TV
Sbjct: 349 PTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETV 408

Query: 412 PTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471
           P+S T  L+LQQW RPPMS+ FEI+MFSNSGLVV+Y +V ++ +KYR VKWIKY+SKSGS
Sbjct: 409 PSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGS 468

Query: 472 YEVRY 476
           YE+RY
Sbjct: 469 YEIRY 473

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/481 (54%), Positives = 364/481 (75%), Gaps = 5/481 (1%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MINA+ I++ RGEL+V K+F +S+KR+ISDIFR+QVINN ++RSPILTLGSTTFH IR+ 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
               LW+V V+R+NA+SGAIWE+LYK N++++ Y LT E+ LK++F++C+E+LD+ +G  
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRN-NRS 179
           G+PMDTEL S+  K+++KP +   +S++      ++      +++ +SMPKFL+RN NRS
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNRS 180

Query: 180 MSQDLGTNY-PSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238
           ++Q+  + + PSN PWR   IKYKKNE+ + V EKIN+LV +D +IL+AYVDGTID+T H
Sbjct: 181 VTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDITAH 240

Query: 239 LSGTPICQFGLNDSPSVEFGDSL-WLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDK 297
           LSG P+CQ G+ND  +++ G++  W +     N+ A+P  +   V+LE  KFHQCV+LDK
Sbjct: 241 LSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQCVALDK 300

Query: 298 FNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV--TPCGSTVEYRITLKSLFPNKL 355
           +NK+ +I F+PPDG  ELMKY V +NLNLPF+ITP V  T  G+ + Y I LKSLFP KL
Sbjct: 301 YNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSLFPRKL 360

Query: 356 SAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSD 415
           SA++V L IPVPPGT+DCKIN S+GKCKF  EEN MVW F++++G TEN L+A TVPT  
Sbjct: 361 SAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQTVPTQS 420

Query: 416 TTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVR 475
               +++QW RPPMSL F+++MFSN+GL+VRY +V +K+  Y  +KWIKYIS +GSYEVR
Sbjct: 421 IASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAAGSYEVR 480

Query: 476 Y 476
           Y
Sbjct: 481 Y 481

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/485 (58%), Positives = 350/485 (72%), Gaps = 30/485 (6%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A+F+YS RG+LI+SKL  +++K  +S+IFRIQVINNLDVRSPILTLGSTTFHHIRSN
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           G   LW+VTVSR N +S  IWEFLY FN +L+ YD+  E+ L+ DFM+CYEILD+V+   
Sbjct: 61  GG--LWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLD-N 117

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN-RS 179
           GIP DTEL  I   IS KP                N  GS+     L+ P +L +   R 
Sbjct: 118 GIPRDTELTHIMPYISKKPLSE-------------NLLGSD---DILNTPSWLVKAGARG 161

Query: 180 MS-QDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238
           MS ++LG        WR  GI+YKKNEV+L V E I+ILV++DG+ILK+YVDG++    H
Sbjct: 162 MSSENLGLTSKDMCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAH 221

Query: 239 LSGTPICQFGLND--SPSVEF---GDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCV 293
           LSG P+CQFG ND  SPS      G+  W   +E +  KA+  A  GSV+LEDCKFHQCV
Sbjct: 222 LSGMPVCQFGFNDYLSPSSNTQSSGNDGW--AEEENGTKAIKNAITGSVILEDCKFHQCV 279

Query: 294 SLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLFP 352
            LDKF++ER+I+FVPPDG  ELMKY VRDNLNLPFK+TP+VT   G +VEYRITLKSLFP
Sbjct: 280 QLDKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFP 339

Query: 353 NKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVP 412
           +KL AKDV L+IP PP TV+ KIN+S+GK KF  EENA+VW+ +KYHGLTEN  SAV VP
Sbjct: 340 SKLCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVP 399

Query: 413 TSD-TTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471
             +    L L+QW RPP+S+ FEI MFSNSGLVVRY +V +KD  Y  VKW+KYISKSG+
Sbjct: 400 MGNGNDSLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGA 459

Query: 472 YEVRY 476
           YEVRY
Sbjct: 460 YEVRY 464

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 353/492 (71%), Gaps = 34/492 (6%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MINA+ +YS RGELIVSK+F  +LKRS+ DIFR+QVIN+LDVRSPILTLGSTTFH++R+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           G + LW+V+VSR N NS A WEFLYKF  +L AY L  EE LKE+FM+ +E+LD ++  G
Sbjct: 61  G-EGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGG 119

Query: 121 GIPMDTELGSIASKISVKPPKS----GGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRN 176
           GIP +T+   I S +SVKP  S       + + +++T     G        + P+ L R 
Sbjct: 120 GIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGH-------AFPQLLHRA 172

Query: 177 NRSMSQDLGTNYPSNFPWRP----NGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGT 232
           +           P      P    +G + K+NE+ + V E I+ILVS+DGSILKAYVDG 
Sbjct: 173 SN----------PGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGG 222

Query: 233 IDMTTHLSGTPICQFGLNDSPSVE-FGDSLW--LDTQEFHNKK-AVPKAAAGSVMLEDCK 288
           ID+TT L G  +CQFGLNDS S +   +S W  L ++E       +  A  G+V+L DCK
Sbjct: 223 IDLTTKLEGAAVCQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCK 282

Query: 289 FHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGST-VEYRITL 347
           FHQCVSL++F+++RII+F PP+G +ELMKY VRDNLNLPFK+T +V P  +   +YR+T+
Sbjct: 283 FHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTI 342

Query: 348 KSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLS 407
           KSLFP KLSAK+V + IPVPPGT+DCKIN+SNG CKF  EENAMVW+F+KY+GLTEN LS
Sbjct: 343 KSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLS 402

Query: 408 AVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDK---DEKYRVVKWIK 464
           A+TVPT DTTQL LQQW RPP+SL FEI+M+SN+GLVVRYF V DK   + K++ VKWIK
Sbjct: 403 AITVPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIK 462

Query: 465 YISKSGSYEVRY 476
           Y+S SGSYEVRY
Sbjct: 463 YVSHSGSYEVRY 474

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 241/486 (49%), Positives = 336/486 (69%), Gaps = 21/486 (4%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M++AIFIY+ +G+L++SKL  + +KRS++D+FR QVIN+  VRSPILTLGSTTF H+   
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 61  GSDSL--WIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIG 118
            SD+L  W+V VSR+N +S  IWE+L+K   +++A+ +  E+ LK++FM+ YEIL++ + 
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTL- 119

Query: 119 AGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNR 178
             GIP  T+L  I  ++S KP ++   S  P         GSN+    L  PK   R++ 
Sbjct: 120 ENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDF--LSGSNI----LKAPKLSKRSSS 173

Query: 179 SMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238
           S++    +      PWRP+G+KYKKNEV+L +NEKI ILV +DGSI+K++VDG++D  +H
Sbjct: 174 SIALSSLSE----CPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSH 229

Query: 239 LSGTPICQFGLNDSPSVEFGDSLWLDTQEF------HNKKAVPKAAAGSVMLEDCKFHQC 292
           LSG P+CQ GLND+ S+   +   L   E        NKKA+P AAAGSV+LEDCKFHQC
Sbjct: 230 LSGMPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQC 289

Query: 293 VSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPC-GSTVEYRITLKSLF 351
           V L+K+    +I+FVPPDG  +LM+Y V DN+N+PF + P V     ST+ Y++TL+SLF
Sbjct: 290 VQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLF 349

Query: 352 PNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VT 410
           P+ +SAKDV + IPVPP T+ C  N+S GKCK+++ E  MVW++NKY G TENTLS  V 
Sbjct: 350 PSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVA 409

Query: 411 VPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSG 470
           +P +      L +W RPP+S+GFEI+MFSNSGLVVR+ +  +    Y+ VKWIKYIS SG
Sbjct: 410 IPATSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG 469

Query: 471 SYEVRY 476
           +YE+RY
Sbjct: 470 AYEIRY 475

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  462 bits (1190), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 304/451 (67%), Gaps = 37/451 (8%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+A F+++ RG LIVSKL +   K S+S++FR+QVIN L++RSP+LTLGSTTF HIR++
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120
           G   LW+V V R NA+S AIWEFLY  N +LDAY +  EE L +DFM+CYE+LDVV+ +G
Sbjct: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSG 118

Query: 121 GIPMDTELGSIASKISVKPPKSGGTSSEP--KSSTVANFPGSNLSTSNLSMPKFLTRNNR 178
            +P DTEL  I   +S KP      S +    S+ +      N+S   L           
Sbjct: 119 -LPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLD---------- 167

Query: 179 SMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238
             S+D+        PWR  GIKYKKNEV+L V EK+++LV+RDG+ILKAYVDGT+  T H
Sbjct: 168 HFSRDVC-------PWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAH 220

Query: 239 LSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAG----SVMLEDCKFHQCVS 294
           LSG P+C FG NDS S+          Q    ++  P+        SV+LEDCKFHQCV 
Sbjct: 221 LSGMPLCHFGFNDSQSLR---------QRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQ 271

Query: 295 LDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGS-TVEYRITLKSLFPN 353
           L+KF++ER+I+FVPPDG  ELMKY +RD+L  PFK+TPVV+     ++EYRITL+SLFP 
Sbjct: 272 LNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPT 331

Query: 354 KLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPT 413
           KLSAKDV L+IP PP T+  K+N+S GKCKF  EENA++W+ +K+HGLTENTLSAVT+  
Sbjct: 332 KLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIAD 391

Query: 414 SDTT-QLTLQQWPRPPMSLGFEIMMFSNSGL 443
                   L QWPRPP+S+  EIMMFS + L
Sbjct: 392 EQGHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  437 bits (1125), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/489 (48%), Positives = 318/489 (65%), Gaps = 74/489 (15%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+AI IY+ RGELIVSKL+ N++KRSIS+IFRIQVINN +VRSPILTLGSTTFHHIRS 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  GSD----SLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVV 116
            +D     LW+V V+R NANS AIWEFL K N IL  Y +T E KLK++FM  +EILD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 117 IGAGGIPMDTELGSIASKISVKP-PKSGGTSSEP-----KSSTVANFPGSNLSTSNLSMP 170
           +   GI  +T+L SI  K+SVKP  ++  T+S       + +T+   PG+N S       
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFS------- 173

Query: 171 KFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVD 230
             L   NR  +                   +KKNE+F +VNE +N+LVS+DGSILK YVD
Sbjct: 174 --LIPTNRHDA-------------------HKKNEIFFFVNESMNLLVSKDGSILKNYVD 212

Query: 231 GTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFH 290
           G I++ +HL+G P CQF L D  +                             + D KF 
Sbjct: 213 GKIEIKSHLNGNPTCQFELVDDQT----------------------------KITDFKFD 244

Query: 291 QCVSLDKFNKERIIKFVPPDGNMELMKYCVRDN-LNLPFKITPVVTPCGSTVEYRITLKS 349
           QC+  +K  + R ++    DG +E++ Y VRD+ +N+PFKITP+V+    TV+YRI+LKS
Sbjct: 245 QCI--EKV-QSRTVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKS 301

Query: 350 LFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAV 409
           LFP  LSA DV L IPVPP T+DCKIN+SNG CKF++E+NA++W FNK++G TENTLSA+
Sbjct: 302 LFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAI 361

Query: 410 TVPTSDTTQ-LTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDE-KYRVVKWIKYIS 467
           T+  +D  Q + L+ W RP + L FEI M+S SGL++R   ++DKD+ +Y+  +WIKYIS
Sbjct: 362 TI--ADGRQIMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYIS 419

Query: 468 KSGSYEVRY 476
           ++GSYE+R+
Sbjct: 420 RAGSYEMRF 428

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  201 bits (512), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 141/490 (28%), Positives = 248/490 (50%), Gaps = 60/490 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS---PILTLGSTTFHHI 57
           M + I+   ++G+ I+S+ + + +  +  D F + ++      S   P L      +  +
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L+++T++R+ + N   ++ FLYK   +L  Y  + +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++  G IP  TE   +   I+ K  K   ++ + K               N+  P     
Sbjct: 118 MMDYG-IPQITETKMLKQYITQKSFKLMKSAKKSK---------------NVIRPPIALT 161

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           N+ S              WRP GI YKKNE FL V E IN+L+++ G +L++ + G + +
Sbjct: 162 NSVS--------------WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            +HLSG P  + GLND     F + +    ++  +  +       ++ LED KFHQCV L
Sbjct: 208 KSHLSGMPDLKLGLNDKGI--FSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRL 265

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLK 348
            KF  E+II F+PPDG+ ELM Y     L  P K  P++           S +E     K
Sbjct: 266 SKFENEKIITFIPPDGDFELMSY----RLTTPIK--PLIWCDIKIQVHSKSRIEVHCRAK 319

Query: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408
           +    K +A +V + IPVP      K   S+G  K+  E+NA++W+   + G  E +++A
Sbjct: 320 AQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA 379

Query: 409 -VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466
            + +P+ SD  +  +++    P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI
Sbjct: 380 QLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYI 435

Query: 467 SKSG-SYEVR 475
           ++SG  Y +R
Sbjct: 436 TQSGDDYTIR 445

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  196 bits (499), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 144/489 (29%), Positives = 241/489 (49%), Gaps = 64/489 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M + I+    +G++I+S+ + + +  S  + F    ++      +  P LT     +  I
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           + N    ++++T+SR+ + N   ++ FLYK   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++  G IP  TE   +   I+ K  K     S  KS  V   P S L+ S          
Sbjct: 118 MLDYG-IPQITETKMLKQYITQKSYKL--IKSAKKSKNVIR-PPSQLTKS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WRP GI YKKNE FL V E IN+L++  G +L++ + G +++
Sbjct: 164 ----------------VSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVNV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            + LSG P  + GLND             + E  +     +    ++ LED KFHQCV L
Sbjct: 208 RSRLSGMPDLKLGLNDKG--------IFTSVESASSSEATEGKKSNIELEDLKFHQCVRL 259

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRITLKSL 350
            KF  E+II F+PPDG+ ELM Y     L+ P K        +     S +E     K+ 
Sbjct: 260 SKFENEKIITFIPPDGDFELMNY----RLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQ 315

Query: 351 FPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-V 409
              K +A +V + IPVP      K   S+G  K+  E++A++W+   ++G  E + +A +
Sbjct: 316 IKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQL 375

Query: 410 TVPTSDTTQLTLQQWPRP--PMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYIS 467
            +P+     +T  + PR   P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI+
Sbjct: 376 GLPS-----MTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYIT 430

Query: 468 KSG-SYEVR 475
           +SG  Y +R
Sbjct: 431 QSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  196 bits (498), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 144/487 (29%), Positives = 238/487 (48%), Gaps = 60/487 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M + I+     G++I+S+ + + +  S  + F    ++      V  P LT     +  I
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           + N    ++++T+SR+ + N   ++ FLYK   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   GIP  TE   +   I+ K  K     S  KS  V   P              LT+
Sbjct: 118 MLDY-GIPQITETKMLKQYITQKSYKL--IKSVKKSKNVVRPPAQ------------LTK 162

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                          +  WRP GI YKKNE FL V E IN+L++  G +L++ + G + +
Sbjct: 163 ---------------SVSWRPEGITYKKNEAFLDVTESINMLITASGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            + LSG P  + GLND             ++E  N          ++ LED +FHQCV L
Sbjct: 208 RSRLSGMPDLKLGLNDKG--------IFTSEEGGNNAEGGSGKKSNIELEDLQFHQCVRL 259

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRITLKSL 350
            KF  E+II F+PPDG+ +LM Y     L+ P K        +     S +E     K+ 
Sbjct: 260 SKFENEKIISFIPPDGDFDLMNY----RLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQ 315

Query: 351 FPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-V 409
              K +A +V + IPVP      K   S+G  K+  E++A++WR   ++G  E + +A +
Sbjct: 316 IKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQL 375

Query: 410 TVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKS 469
            +P+   T + + +  R P+ + F+I  F+ SG+ VRY +V +   +Y+   W++YI++S
Sbjct: 376 GLPS--MTDVEVPKAKR-PIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQS 432

Query: 470 G-SYEVR 475
           G  Y +R
Sbjct: 433 GDDYTIR 439

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  194 bits (494), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/492 (28%), Positives = 243/492 (49%), Gaps = 67/492 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M + +    ++G+ ++S+ + + + +S  + F+  ++     R    ++    FHH   N
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLE----REQESSVMPPCFHH---N 53

Query: 61  G-------SDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYE 111
           G        + ++++ ++R+ + N+  ++ F+YK   +++ Y    +EE ++++++I YE
Sbjct: 54  GIHYMYVQYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYE 113

Query: 112 ILDVVIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPK 171
           +LD ++  G +P  TE   +   I+ K  K   T S  K   VA  P             
Sbjct: 114 LLDEMMDKG-VPQVTETKMLKQYITQKSFKL--TRSAKKQKNVARPP------------- 157

Query: 172 FLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDG 231
                         T   ++  WRP GIKYKKNE FL V E IN+L+++ G +L++ + G
Sbjct: 158 --------------TELTNSVSWRPEGIKYKKNEAFLDVIESINMLMTQQGQVLRSEILG 203

Query: 232 TIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQ 291
           T+ + + LSG P  + GLND      G     D ++        K    ++ LED KFHQ
Sbjct: 204 TVKVRSRLSGMPDLKLGLNDK-----GIFTTNDQEDSPEPVVSSKKKNSNIELEDLKFHQ 258

Query: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRIT 346
           CV L KF  E+II F+PPDG  +LM Y     L+ P K        V    GS +E    
Sbjct: 259 CVRLSKFENEKIITFIPPDGEFDLMTY----RLSTPIKPLIWCDVKVQVHSGSRIEIHCR 314

Query: 347 LKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTL 406
            K+    K  A +V + IP+P          S G  K+  E+NA++W+F+ + G  E ++
Sbjct: 315 AKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSM 374

Query: 407 SA-VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIK 464
           +A + +P+ SD     L++    P+ + F+I  F+ SG+ VRY ++ +   +Y    W++
Sbjct: 375 AAQLGLPSVSDAEPPKLKR----PVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVR 430

Query: 465 YISKSG-SYEVR 475
           YI++SG  Y +R
Sbjct: 431 YITQSGDDYTIR 442

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  194 bits (493), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 246/482 (51%), Gaps = 56/482 (11%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVI---NNLDVRSPILTLGSTTFHHI 57
           M + I+    +G+L++S+ + + +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L+I+T++R+  AN   ++ FL+    +L  Y  + +EE +K++F+I YE+LD 
Sbjct: 61  QHN---DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           V+ + GIP  T+   +   I+ K  K   ++ + K+      P S+L+T+          
Sbjct: 118 VMDS-GIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVR---PPSSLTTA---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WRP GIKYKKNE FL V E IN+++++ G +L++ + G + +
Sbjct: 164 ----------------VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            + LSG P  + GLND     F  S   +  E  ++ ++ +  + ++ LED KFHQCV L
Sbjct: 208 RSRLSGMPDLKLGLNDKGI--FTQSNEEEEDEPSSQPSITRKKS-NIELEDLKFHQCVRL 264

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRITLKSL 350
            KF  E+II F+PPDG+ ELM Y     L+ P K        +     S VE     K+ 
Sbjct: 265 SKFENEKIITFIPPDGDFELMSY----RLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQ 320

Query: 351 FPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-V 409
              K +A +V + IPVP      K   S+G  K+  E+NA++W+   + G  + +++A +
Sbjct: 321 IKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEM 380

Query: 410 TVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISK 468
            +P+ +D      ++    P+ + F+I  F+ SG+ VRY ++++   +Y    W++YI++
Sbjct: 381 GLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQ 436

Query: 469 SG 470
           SG
Sbjct: 437 SG 438

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  189 bits (479), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 143/483 (29%), Positives = 241/483 (49%), Gaps = 49/483 (10%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +AI+    +G  ++S+ + + +  +  D F   ++ +L+  S    P LT  +T +  
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFA-SLLADLEEESSVIPPCLTYNNTQYLF 59

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ +    + I  + RTN     ++ FLYK   +L  Y  T +EE ++++++I YE+LD 
Sbjct: 60  IQHSDIYLVAITNLLRTNI--AEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++  G IP  TE   +   I+    KS       K    A  P S L+ S          
Sbjct: 118 LMDYG-IPQITETKMLKQYIT---QKSFKLVKAAKKKQNAARPPSALTDS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WR  GIKYKKNE FL + E IN+L+++ G IL++ + G + +
Sbjct: 164 ----------------VSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKI 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            + LSG P  + G+ND     F   L   T++  N  A  K     + LED KFHQCV L
Sbjct: 208 KSRLSGMPDLKLGINDKGI--FSKQL---TEDDTNNNATSK-KQNKIELEDLKFHQCVRL 261

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTPCGSTVEYRITLKSLFPNK 354
            KF  E+II F+PPDG+ ELM Y +  ++  L +    V     S +E     K+    K
Sbjct: 262 SKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKK 321

Query: 355 LSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-VTVPT 413
            +A +V + IPVP          S+G  K+  E++A++W+   + G  E +++A + +P+
Sbjct: 322 STATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPS 381

Query: 414 SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSG-SY 472
           + +    +Q   + P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI++SG  Y
Sbjct: 382 TSSKSEEVQN--KKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 439

Query: 473 EVR 475
            +R
Sbjct: 440 TIR 442

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 245/504 (48%), Gaps = 69/504 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++    +G+ ++S+ + + +  S  D F   ++++ +  S    P ++     +  
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFS-SLLSDKEEESNLLPPCISHNGIQYMF 59

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ N  D       +   AN   I+ FL+K   +LD Y  T +EE ++++F+I YE+LD 
Sbjct: 60  IQHN--DLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   G+P  TE   +   I+    KS       K    A  P + L+ S          
Sbjct: 118 MMDY-GLPQITETKMLKKYITT---KSFKLEKAHKKKRNAARPPTELTNS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WRP GIKYKKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 164 ----------------VSWRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRV 207

Query: 236 TTHLSGTPICQFGLND----SPSVEFGDSLWL-------DTQEFHNKKAVPKAAAG---- 280
            + LSG P  + G+ND    +  +E G+++ +       D  + +N+ ++    +     
Sbjct: 208 KSRLSGMPDLKLGINDRGIFTKYLE-GNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKT 266

Query: 281 SVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGST 340
           ++ LED KFHQCV L KF  E+II F+PPDG  +LM Y       L   I P++    S 
Sbjct: 267 NIELEDLKFHQCVRLSKFENEKIISFIPPDGEFDLMNY------RLSTSIKPLIWCDVSI 320

Query: 341 VEYRITL----KSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFN 396
             YRI +    K+    K  A +V + IPVP          S+GK K+  E+N ++W+ +
Sbjct: 321 QTYRIEIHCKAKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKIS 380

Query: 397 KYHGLTENTLSAV----TVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSD 452
            + G  E +++A     ++   D     +    + P+ + F+I  F+ SG+ VRY +V++
Sbjct: 381 SFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPVQVKFKIPYFTTSGIQVRYLKVNE 440

Query: 453 KDEKYRVVKWIKYISKSG-SYEVR 475
              +Y+   W++YI++SG  Y +R
Sbjct: 441 PKLQYKTYPWVRYITQSGDDYTIR 464

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  186 bits (471), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 137/490 (27%), Positives = 244/490 (49%), Gaps = 63/490 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57
           M + I+   ++G+L++S+ + + +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L+++T++++ + N   ++ +L+K   +L+ Y  + +EE +K++F+I YE+LD 
Sbjct: 61  QHN---DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   GIP  T+   +   I+ K  K   ++ + K               N+  P     
Sbjct: 118 MMDH-GIPQITDTKMLRQYITQKSFKLIRSAKKKK---------------NVVRPPATLT 161

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           N+ S              WRP GI YKKNE FL V E IN+L+++ G +L++ + G + +
Sbjct: 162 NSVS--------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295
            + LSG P  + GLND      G     D  +     +       ++ LED KFHQCV L
Sbjct: 208 KSRLSGMPDLKLGLNDK-----GIFAQGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRL 262

Query: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLK 348
            KF  E+II F+PPDG+ ELM Y     L+ P K  P++           S +E     K
Sbjct: 263 TKFENEKIITFIPPDGDFELMSY----RLSTPIK--PLIWCDVKLQVHSRSRIEIHCRAK 316

Query: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408
           +    K +A +V + IPVP      K   S+G  K+   +NA++W+   + G  + +++A
Sbjct: 317 AQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA 376

Query: 409 -VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466
            + +P+ SD +   L++    P+ + F+I  F+ SG+ VRY ++++   +Y    W++YI
Sbjct: 377 EMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYI 432

Query: 467 SKSG-SYEVR 475
           ++SG  Y +R
Sbjct: 433 TQSGDDYTIR 442

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  186 bits (472), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 249/508 (49%), Gaps = 68/508 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++     G+ ++S+ + + +  S  D F I ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPI-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ N  D   +  V+  +AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 60  IQHN--DLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           V+  G IP  TE   +   I+ K  K   ++ + +++T                P     
Sbjct: 118 VMDYG-IPQITETKMLKQYITQKSFKLVKSAKKKRNAT---------------RPPVALT 161

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 162 NSVS--------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQ-------------EFHNKKAVPKAAAG-- 280
            + LSG P  + G+ND     F   L  DT              E   K ++  ++A   
Sbjct: 208 NSKLSGMPDLKLGINDKGI--FSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNK 265

Query: 281 ---SVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTP 336
              ++ LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +    V   
Sbjct: 266 KKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVH 325

Query: 337 CGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFN 396
             S +E     K+    K +A +V + IPVP          S+G  K+  E++A++W+  
Sbjct: 326 SNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIR 385

Query: 397 KYHGLTENTLSA-VTVPTSDTTQLTLQQWPRP-------PMSLGFEIMMFSNSGLVVRYF 448
            + G  E ++SA + +P+    +   +  P+        P+ + F+I  F+ SG+ VRY 
Sbjct: 386 SFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYL 445

Query: 449 RVSDKDEKYRVVKWIKYISKSG-SYEVR 475
           ++++   +Y+   W++YI++SG  Y +R
Sbjct: 446 KINEPKLQYKSYPWVRYITQSGDDYTIR 473

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  185 bits (470), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 142/516 (27%), Positives = 247/516 (47%), Gaps = 83/516 (16%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++     G+ ++S+ + + +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFST-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ N  D   +  V+   AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 60  IQHN--DLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           V+  G IP  TE   +   I+ K  K   ++ + +++T                P     
Sbjct: 118 VMDYG-IPQITETKMLKQYITQKSFKLVKSAKKKRNAT---------------RPPVALT 161

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 162 NSVS--------------WRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGS-------------- 281
            + LSG P  + G+ND        S +LD     N   +P A + +              
Sbjct: 208 NSKLSGMPDLKLGINDKGIF----SKYLD-----NDSNIPSAVSAATSDNNTDTDKKPSI 258

Query: 282 ------------VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPF 328
                       + LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +
Sbjct: 259 TSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIW 318

Query: 329 KITPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEE 388
               V     S +E     K+    K +A +V + IPVP          S+G  K+  E+
Sbjct: 319 CDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEK 378

Query: 389 NAMVWRFNKYHGLTENTLSA-VTVPTSDTTQLTLQQWPRP-------PMSLGFEIMMFSN 440
           +A++W+   + G  E ++SA + +P+  T++   +  P+        P+ + F+I  F+ 
Sbjct: 379 SAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNAKLLKGPVQIKFQIPYFTT 438

Query: 441 SGLVVRYFRVSDKDEKYRVVKWIKYISKSG-SYEVR 475
           SG+ VRY ++++   +Y+   W++YI++SG  Y +R
Sbjct: 439 SGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  184 bits (468), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 142/496 (28%), Positives = 243/496 (48%), Gaps = 63/496 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVIN---NLDVRSPILTLGSTTFHHI 57
           M +AI+    +G  ++S+ + + +  S  D F I + N     ++  P +      F  I
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L++V ++ + + N+  I+ FL+K   +L  Y    +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   GIP  TE   +   I+    KS       K    A  P ++L+ S          
Sbjct: 118 MMDY-GIPQITEPKMLKQYIT---QKSFKLKKAAKKKRNAARPPTSLTNS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WRP GIK+KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 164 ----------------VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKV 207

Query: 236 TTHLSGTPICQFGLNDS-------PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288
            + LSG P  + G+ND           E G  +  D       K   K  + ++ LED K
Sbjct: 208 KSKLSGMPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKP-KKKRSNNMELEDLK 266

Query: 289 FHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTV 341
           FHQCV L KF  E+ I F+PPDG+ ELM Y       L   I P++       T   S +
Sbjct: 267 FHQCVRLSKFENEKQITFIPPDGDFELMSY------RLSTAIKPLIWCDVNIKTHSKSRI 320

Query: 342 EYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGL 401
           E     K+    K +A +V + IPVP          S+G  K+  E+NA++W+   + G 
Sbjct: 321 EIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGD 380

Query: 402 TENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVV 460
            E +++A + +P+++  + +  +  + P+ + F+I  F+ SG+ VRY ++ +K+ +Y+  
Sbjct: 381 KEYSMAAEMGLPSTNAGEES--EKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSY 438

Query: 461 KWIKYISKSG-SYEVR 475
            W++YI+KSG  Y +R
Sbjct: 439 PWVRYITKSGDDYTIR 454

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  184 bits (466), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 243/508 (47%), Gaps = 75/508 (14%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M+++I    ++G+ ++S+ + + +  +  D F    +++     V  P LT     +  I
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L+IV ++ + + N+  ++ FL+K   ++  Y    +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   GIP  TE   +   I+    KS       K    A  P   L+ S          
Sbjct: 118 MMDY-GIPQITETKMLKQYIT---QKSFKLVKAAKKKRNAARPPQALTNS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WRP GIKYKKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 164 ----------------VSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKV 207

Query: 236 TTHLSGTPICQFGLND---------SPSVEFGDSLWLDTQEFHNKKAVPKAAAGS----- 281
            + LSG P  + G+ND         S S     +     +   +K + P+ + G      
Sbjct: 208 RSRLSGMPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSS 267

Query: 282 -----VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-- 334
                V LED KFHQCV L KF  E+II F+PPDGN ELM Y     L  P K  P++  
Sbjct: 268 RKTSNVELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSY----RLTTPIK--PLIWC 321

Query: 335 -----TPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEEN 389
                    S VE     K+    K  A +V + IPVP          S+G  K+  E+N
Sbjct: 322 DVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKN 381

Query: 390 AMVWRFNKYHGLTENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYF 448
           A++W+   + G  E +++A + +P+ D  +   +   + P+ + F+I  F+ SG+ VRY 
Sbjct: 382 AILWKIRSFAGGKEYSMAAQLGLPSIDDNE---KPKLKRPVQIKFQIPYFTTSGIQVRYL 438

Query: 449 RVSDKDEKYRVVKWIKYISKSG-SYEVR 475
           +V++   +Y+   W++YI++SG  Y +R
Sbjct: 439 KVNEPKLQYKSYPWVRYITQSGDDYTIR 466

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  182 bits (462), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/493 (28%), Positives = 237/493 (48%), Gaps = 60/493 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M++ I+     G+ I+++ + + +  +  D F  Q++  L+  + ++   +     H++ 
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59

Query: 59  SNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDVVI 117
              SD   +   +    N   I+ FL++   +L+ Y  +  EE ++++F+I YE+LD ++
Sbjct: 60  IKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119

Query: 118 GAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN 177
             G IP  TE   +   I+ K  K   TS+  K    A  P + L+ S            
Sbjct: 120 DFG-IPQITETKMLKKYITQKSFKLIKTSTSKKKKNAAR-PPAELTNS------------ 165

Query: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237
                           WRP GI YKKNE FL + E IN+LV++ G +L++ + G + + +
Sbjct: 166 --------------VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRS 211

Query: 238 HLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKA---VPKAAAG---SVMLEDCKFHQ 291
            LSG P  + G+ND        S +L+        +   +P+        + LED KFHQ
Sbjct: 212 RLSGMPDLKLGINDRGIF----SNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQ 267

Query: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYR 344
           CV L KF  E+II F+PPDG  +LM Y     L  P K  P++           S +E  
Sbjct: 268 CVRLSKFENEKIITFIPPDGEFDLMNY----RLTTPIK--PLIWCDVNIQVHSKSRIEIH 321

Query: 345 ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTEN 404
              K+    K  A +V + IPVP      +   S+G  K+  E+NA++W+   + G  E 
Sbjct: 322 CRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEY 381

Query: 405 TLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWI 463
           ++SA + +P+ D  +       R P+ + F+I  F+ SG+ VRY +V++   +Y+   W+
Sbjct: 382 SMSAQLHLPSVDGVE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 438

Query: 464 KYISKSGS-YEVR 475
           +YI++SG  Y +R
Sbjct: 439 RYITQSGEDYTIR 451

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  182 bits (461), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 245/496 (49%), Gaps = 58/496 (11%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLD---VRSPILTLGSTTFHHI 57
           M +A++    +G+ ++S+ + + +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           + N    L++V ++ +   N   ++ FL+K   +L  Y  T +EE ++++F+I YE++D 
Sbjct: 61  QHN---DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++  G IP  TE   +   I+    KS       K    A  P S L             
Sbjct: 118 MMDYG-IPQITEPRMLKKYIT---QKSFKLEKAHKKKRNAARPPSEL------------- 160

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
            N S+S            WR  GIKYKKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 161 -NNSVS------------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKI 207

Query: 236 TTHLSGTPICQFGLND----SPSVEFGDSLWL---DTQEFHNKKAVP------KAAAGSV 282
            + LSG P  + G+ND    +  +E G+++ +   D QE  +  A        K    ++
Sbjct: 208 KSRLSGMPDLKLGINDRGIFTKYLE-GNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNI 266

Query: 283 MLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTPCGSTV 341
            LED KFHQCV L KF  E+II F+PPDG  +LM Y +  ++  L +    +     S +
Sbjct: 267 ELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRI 326

Query: 342 EYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGL 401
           E R   K+    K  A +V + IPVP          S+G  K+  E++A++W+   + G 
Sbjct: 327 EIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGG 386

Query: 402 TENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVV 460
            E  + A + +P+ D+ +   +   + P+ + FEI  F+ SG+ VRY ++++   +Y+  
Sbjct: 387 KEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSY 443

Query: 461 KWIKYISKSG-SYEVR 475
            W++YI++SG  Y +R
Sbjct: 444 PWVRYITQSGDDYTIR 459

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  181 bits (460), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 146/510 (28%), Positives = 250/510 (49%), Gaps = 69/510 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++     G+ ++S+ + + +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILD 114
           I+ N    L++V ++ + +AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD
Sbjct: 60  IQHN---DLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116

Query: 115 VVIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLT 174
            V+  G IP  TE   +   I+ K  K   ++ + +++T                P    
Sbjct: 117 EVMDYG-IPQITETKMLKQYITQKSFKLVKSAKKKRNAT---------------RPPVAL 160

Query: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTID 234
            N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + 
Sbjct: 161 TNSVS--------------WRPEGISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVK 206

Query: 235 MTTHLSGTPICQFGLNDSP--SVEFGDSLWL----DTQEFHNKKAV-----PKAAAGS-- 281
           + + LSG P  + G+ND    S    DS  L     T    NK  V     P   + S  
Sbjct: 207 VNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTA 266

Query: 282 ------VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVV 334
                 + LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +    V 
Sbjct: 267 SKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQ 326

Query: 335 TPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWR 394
               S +E     K+    K +A +V + IPVP          S+G  K+  E++A++W+
Sbjct: 327 VHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 386

Query: 395 FNKYHGLTENTLSA-VTVPT-------SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVR 446
              + G  E ++SA + +P+       S T      +  + P+ + F+I  F+ SG+ VR
Sbjct: 387 LRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKNNAEILKGPVQIKFQIPYFTTSGIQVR 446

Query: 447 YFRVSDKDEKYRVVKWIKYISKSG-SYEVR 475
           Y ++++   +Y+   W++YI++SG  Y +R
Sbjct: 447 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 476

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  181 bits (458), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 136/494 (27%), Positives = 238/494 (48%), Gaps = 65/494 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++   ++G  ++++ + + +  S  + F   ++++L+  +    P L+     +  
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ N  D   +   +  +AN+  I+ FLYK   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 91  IQHN--DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDE 148

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
            +   GIP  TE   +   I+    KS       K    A  P   L+ S          
Sbjct: 149 TMDY-GIPQITETKMLKQYIT---QKSFKLVKAAKKKRNAARPPEALTNS---------- 194

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WR   IKYKKNE FL + E IN+L+++ G IL++ + G + +
Sbjct: 195 ----------------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKV 238

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAA-----GSVMLEDCKFH 290
            + LSG P  + G+ND        S  +D    +N+ A   ++       ++ LED KFH
Sbjct: 239 KSRLSGMPDLKLGINDKGIF----SKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFH 294

Query: 291 QCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEY 343
           QCV L KF  E+II F+PPDG+ ELM Y       L   I P++           S +E 
Sbjct: 295 QCVRLSKFETEKIITFIPPDGDFELMNY------RLSTSIKPLIWCDMNIQVHSQSRIEI 348

Query: 344 RITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTE 403
               K+    K +A +V + IPVP      +   S+G  K+  E+N ++W+   + G  E
Sbjct: 349 HCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKE 408

Query: 404 NTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKW 462
            ++SA + +P+    +   +   + P+ + F+I  F+ SG+ V+Y ++++   +Y+   W
Sbjct: 409 YSMSAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPW 465

Query: 463 IKYISKSG-SYEVR 475
           ++YI++SG  Y +R
Sbjct: 466 VRYITQSGDDYTIR 479

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  178 bits (452), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 138/487 (28%), Positives = 236/487 (48%), Gaps = 66/487 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFR---IQVINNLDVRSPILTLGSTTFHHI 57
           M++A++    +G  I+S+ + + +  S  D F    +Q+     V  P L+     +  I
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 58  RSNGSDSLWIVTVSRTNA-NSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115
           + N    L++V ++ + A N   ++ FL+K   +L+ Y    +EE ++++F+I YE+LD 
Sbjct: 61  QHN---DLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           ++   GIP  TE   +   I+    KS       K S  A  P + ++ S          
Sbjct: 118 MMDY-GIPQITETKMLKQYIT---QKSFKLMKAVKKSKAAPRPPTEVTNS---------- 163

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
                             WR   I +KKNE FL + E IN+L+++ G +L++ + G I +
Sbjct: 164 ----------------VSWRAPNIVHKKNEAFLDIVESINMLMNQQGQVLRSEIIGQIKV 207

Query: 236 TTHLSGTPICQFGLND----SPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQ 291
            + LSG P  + G+ND    S  VE GDS  + T     KK        ++ LED KFHQ
Sbjct: 208 KSKLSGMPDLKLGINDKGIFSKYVE-GDSDPVTTAVTEGKKKT------NIELEDLKFHQ 260

Query: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYR 344
           CV L KF  E+II F+PPDG  ELM Y     L++P K  P++           S +E  
Sbjct: 261 CVRLSKFENEKIITFIPPDGAFELMNY----RLSMPVK--PLIWCDVNVQVHSQSRIEIH 314

Query: 345 ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTEN 404
              ++    +  A  V + IPVP          ++G  K+  ++NA++W+   + G  E 
Sbjct: 315 CRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEY 374

Query: 405 TLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWI 463
           ++SA + +P+ +      +   + P+ + F+I  F+ SG+ VRY ++++    Y+   W+
Sbjct: 375 SMSAQMGLPSINALD---KPKVKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWV 431

Query: 464 KYISKSG 470
           +YI++SG
Sbjct: 432 RYITQSG 438

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  178 bits (451), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 134/488 (27%), Positives = 238/488 (48%), Gaps = 61/488 (12%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M++ I+    +G  I+S+ + + +  S  D F   ++ +L+  S ++   L      ++ 
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRF-APLLADLEEESSVIPPCLNHRGIQYLF 59

Query: 59  SNGSDSLWIVTVSRTNA-NSGAIWEFLYKF-NAILDAYDLTKEEKLKEDFMICYEILDVV 116
               D L++V +S + A N+  ++ FL+K   A+ D     +EE ++++F+I YE+LD +
Sbjct: 60  IEHED-LYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEM 118

Query: 117 IGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRN 176
           +  G IP  TE   +   I+ K  K      + K++     P + L+ S           
Sbjct: 119 MDYG-IPQITETKMLKQYITQKSFKLIKAVKKVKATAR---PPTGLTNS----------- 163

Query: 177 NRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMT 236
                            WR +GI YKKNE FL + E IN+++++ G +L++ + G + + 
Sbjct: 164 ---------------VSWRADGITYKKNEAFLDIVESINMVMNQQGQVLRSEIIGQVIVR 208

Query: 237 THLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLD 296
           + LSG P  + G+ND         ++    E    +        S  LED KFHQCV L 
Sbjct: 209 SRLSGMPDLKLGINDK-------GIFTRDPETGESQVTAGKKKSSAELEDLKFHQCVRLS 261

Query: 297 KFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLKS 349
           KF  E+II F+PPDG  ELM Y     L  P K  P++           S +E     K+
Sbjct: 262 KFENEKIITFIPPDGEFELMSY----RLTTPVK--PLIWCDVNVQVHSKSRIEIHCRAKA 315

Query: 350 LFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA- 408
               K  A +V + IPVP          S+G  K+  E+NA++W+   ++G  E +++A 
Sbjct: 316 QIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQ 375

Query: 409 VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISK 468
           + +P+ +  +    ++ R P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI++
Sbjct: 376 MGLPSINGVEKP--KFKR-PVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ 432

Query: 469 SG-SYEVR 475
           +G  Y +R
Sbjct: 433 NGDDYTIR 440

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  177 bits (449), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 137/497 (27%), Positives = 233/497 (46%), Gaps = 69/497 (13%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58
           M++ ++     G+ I+S+ + + +  S  D F  Q++   +  S ++   L     H++ 
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFS-QILLEHEEESSVVPPCLLYQGIHYLF 59

Query: 59  SNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDVVI 117
              SD   +   +    N   I+ FL++  ++L  Y    +EE ++++F+I YE+LD ++
Sbjct: 60  IQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMM 119

Query: 118 GAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN 177
              GIP  TE   +   I+    KS       K    A  P   L+ S            
Sbjct: 120 DY-GIPQITETKMLKQYIT---QKSFKLIKAAKKKRNAARPPVALTNS------------ 163

Query: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237
                           WR  GIKYKKNE +L + E IN+L+++ G +L++ + G + + +
Sbjct: 164 --------------VSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKS 209

Query: 238 HLSGTPICQFGLNDSPSVEFGDSLWLDTQE-------FHNKKAVPKAAAGSVMLEDCKFH 290
            LSG P  + G+ND        S +L+ +E         N  +       ++ LED KFH
Sbjct: 210 RLSGMPDLKLGINDKGIF----SKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFH 265

Query: 291 QCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEY 343
           QCV L KF  E+II F+PPDG  ELM Y     L  P K  P++           S +E 
Sbjct: 266 QCVRLSKFENEKIITFIPPDGEFELMNY----RLTTPIK--PLIWCDINIQVHSKSRIEI 319

Query: 344 RITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTE 403
               K+    K  A +V + IPVP          S+G  K+  E+NA++W+   + G  E
Sbjct: 320 HCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKE 379

Query: 404 NTLSA-VTVPTSDTTQLTLQQWP---RPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRV 459
            +++A + +P+ D  +      P   + P+ + F+I  F+ SG+ VRY ++++   +Y+ 
Sbjct: 380 YSMTAQLGLPSVDGIE------PPKVKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS 433

Query: 460 VKWIKYISKSG-SYEVR 475
             W++YI++SG  Y +R
Sbjct: 434 FPWVRYITQSGDDYTIR 450

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  176 bits (447), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 141/514 (27%), Positives = 243/514 (47%), Gaps = 79/514 (15%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56
           M +A++     G+ ++S+ + + +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59

Query: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115
           I+ N  D   +  V+   AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 60  IQHN--DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117

Query: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175
           V+  G IP   E   +   I+ K  K   ++ + +++T                P     
Sbjct: 118 VMDYG-IPQICETKMLKQYITQKSFKLVKSAKKKRNAT---------------RPPVALT 161

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 162 NSVS--------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207

Query: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGS-------------- 281
            + LSG P  + G+ND        S +LD     +    P +AA S              
Sbjct: 208 NSKLSGMPDLKLGINDKGIF----SKYLDDD---SNTPPPTSAATSDNITDTDKKPSITS 260

Query: 282 ----------VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKI 330
                     + LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +  
Sbjct: 261 SSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCD 320

Query: 331 TPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENA 390
             V     S +E     K+    K +A +V + IPVP          S+G  K+  E++A
Sbjct: 321 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSA 380

Query: 391 MVWRFNKYHGLTENTLSA-VTVPTSDTTQLTLQQWPRP-------PMSLGFEIMMFSNSG 442
           ++W+   + G  E ++SA + +P+        +  P+        P+ + F+I  F+ SG
Sbjct: 381 ILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSG 440

Query: 443 LVVRYFRVSDKDEKYRVVKWIKYISKSG-SYEVR 475
           + VRY ++++   +Y+   W++YI++SG  Y +R
Sbjct: 441 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 106/475 (22%), Positives = 200/475 (42%), Gaps = 111/475 (23%)

Query: 63  DSLWIVTVSRTNANSGAIWEFLY--KFNAILDAY---DLTKEEKLKEDFMICYEILDVVI 117
           D L+ V++S  +  S  +   +Y   F+ +L  Y   +     ++ ++F + YE+LD  +
Sbjct: 58  DGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDESL 117

Query: 118 GAGGIPMDTELGSIASKISVKP-----PKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKF 172
             G IP  T+   I   I ++P     PK   ++S+   S       SN++ +       
Sbjct: 118 DFG-IPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEE---SNVAETQ------ 167

Query: 173 LTRNNRSMSQDLGTNYPSNF---------PWRPNGIKYKKNEVFLYVNE-KINILVSRDG 222
             ++N+   QD    Y ++F          WRP GI Y KNE+F+ V E +  ++  +  
Sbjct: 168 -EKSNKHGFQD-DEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHH 225

Query: 223 SILKAYVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSV 282
            + K ++ G I   ++LSG P+ +  +N          +  D  +F              
Sbjct: 226 QVRKNFIFGRIICRSYLSGMPVVKICIN---------KMLKDRDQF-------------- 262

Query: 283 MLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-------LPFKITPVVT 335
            L   KFHQCVSL+  + +  I+F+PPDG+ +L +Y ++ +++       + +K+  V  
Sbjct: 263 -LSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV--VEK 319

Query: 336 PCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNG---KCKFES-----E 387
           P    ++  + ++  F  + SA  + + +P+       KI+++     KC F S      
Sbjct: 320 PKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLS 379

Query: 388 ENAMVWRFN--------KYHGL-TENTLSAVTVPTSDTTQLTLQQWPRPPMSLG------ 432
           +  ++W+ N         YH +  E  L        +  +L     P PP+  G      
Sbjct: 380 DGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDP-PPLREGVRMEEL 438

Query: 433 ----------------------FEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
                                 FE+  F++SGL V Y ++ ++  +Y+   W++Y
Sbjct: 439 YALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRY 493

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 110/491 (22%), Positives = 204/491 (41%), Gaps = 107/491 (21%)

Query: 43  RSPILTLGSTTFHHIRSNGSDSLWIVTVSRTNA--NSGAIWEFLYKFNAILDAY-DLTKE 99
           R P++      + +I  +G   L+ V+VS      N   I  +L  F+A+L  Y  + K 
Sbjct: 41  RGPVIYSKGIIYIYILRDG---LYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKV 97

Query: 100 EK--LKEDFMICYEILDVVIGAGGIPMDTELGSIASKISV-----KPPKSGGTSSEPKSS 152
           ++  + ++F + YE+ D  +  G IP  T+   I   I +     K P +    S+ +S 
Sbjct: 98  DRTGIIDNFNLIYELFDESLDYG-IPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEES- 155

Query: 153 TVANFPGSNLSTSNLSMPKFLTRNNRSMSQDLGT----NYPSNFPWRPNGIKYKKNEVFL 208
                 G  +  S  +  K      R   Q + +           WRP GI Y KNE+F+
Sbjct: 156 ------GPEILQSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFV 209

Query: 209 YVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQE 267
            + E+ + L+  ++  + + +V G I+  ++LSG PI +  +N          +  D   
Sbjct: 210 DIIERQSYLMDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCIN---------KMLKDKDL 260

Query: 268 FHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLP 327
           F               L   KFHQCVSL+  + +  I+F+PPDG+ +L +Y ++ ++N  
Sbjct: 261 F---------------LGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHIN-- 303

Query: 328 FKITPVVTPCGSTVEYR---------ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINIS 378
              +P++      +  R         +T++  F  + SA  + +HIP      + KI+++
Sbjct: 304 --DSPIIKLIDYKINERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLT 361

Query: 379 --------NGKCKFESEENAMVWRFNKY---HGLTENTLSA-VTVPTSDTTQLTLQQWPR 426
                   +G   F   +  ++W        HG T  ++     +   +     L+Q  +
Sbjct: 362 KAPRFKCDHGSVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKK 421

Query: 427 ----PPMSLG----------------------------FEIMMFSNSGLVVRYFRVSDKD 454
               PP+  G                            FE+  +++SGL V Y ++S+++
Sbjct: 422 SMDPPPLREGAHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEEN 481

Query: 455 EKYRVVKWIKY 465
            KY+   W++Y
Sbjct: 482 LKYQSFSWVRY 492

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 114/481 (23%), Positives = 194/481 (40%), Gaps = 97/481 (20%)

Query: 45  PILTLGSTTFHHIRSNGSDSLWIVTV------SRTNANSGAIWEFLYKFNAILDAYDLTK 98
           P+       F +IR +G   +  V +       +++ N  AI  +L  F  +L  Y    
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY--FN 101

Query: 99  EEKLK-----EDFMICYEILDVVIGAGGIPMDTELGSIASKISVKPPKSGGTS-SEPKSS 152
            +KL      ++F + YE+LD  +  G +P  T+   I   I V+       + S  K S
Sbjct: 102 SQKLNRWLIVDNFHLIYELLDESLDFG-VPQLTDYNIIQDYIKVQVNLHDELADSSKKIS 160

Query: 153 TVANFPGSNLSTSNLSMPKFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNE 212
              +  G     S   M  F+ R   S              WRP GI Y KNE FL V E
Sbjct: 161 KKEDLHGFEDDES--YMNSFIARTTTSA-----------ISWRPKGIHYTKNEFFLDVIE 207

Query: 213 KINILVSRDGS-ILKAYVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNK 271
           +I   +  + S I K +V G I   ++LSG P  + GL+   S     SL  + ++F N 
Sbjct: 208 EIEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITS-----SLPKEREQFMN- 261

Query: 272 KAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKIT 331
                         + KFHQCVSL+   K  I+ F+PPDG  +L +Y ++ ++  P  I 
Sbjct: 262 --------------NAKFHQCVSLEDLQK-NIVSFIPPDGEFQLCEYKLKRHVRDPPVIK 306

Query: 332 PVVTPCGSTVEYR------ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINIS------- 378
            V        + R      +T+ + F ++ S   + + IP+     + +I+++       
Sbjct: 307 LVKFDVKKEEKKRPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKC 366

Query: 379 -NGKCKFESEENAMVWRFNKY---HGLTENTL-SAVTVPTSDTTQLTLQQWPR----PPM 429
             G   F   ++ ++W        H  TE+++     +   +  +  L++       PP+
Sbjct: 367 DQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPL 426

Query: 430 -------------------------SLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIK 464
                                    S+ FEI  ++ SGL V+Y ++ +   +Y    W++
Sbjct: 427 RQGPKLEELYKQVHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVR 486

Query: 465 Y 465
           Y
Sbjct: 487 Y 487

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 124/526 (23%), Positives = 208/526 (39%), Gaps = 98/526 (18%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           MI+ +FI     +L+  +L    LK   S +  ++       +SPIL      +  I+ +
Sbjct: 1   MISCLFILDEELQLLTVRL----LKPVPSLLEPLEWFIRHPKKSPILQNMDYDYIFIQRD 56

Query: 61  GSDSLWIVTVSR--TNANSGAIWEFLYKFNAILDAYDLTKEEK--LKEDFMICYEILDVV 116
           G   L+ +++S   TN     ++ +L + + +   Y      K  +  +F + +E++D  
Sbjct: 57  G---LYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDES 113

Query: 117 IGAGGIPMDTELGSIASKISVKPPKSGGTSSEP--KSSTVANFPGSNLSTSNLSMPKFLT 174
           I  G  P  T+   I   I V+  K    S EP  + +TV N   +    S         
Sbjct: 114 IFMGT-PQLTDYNIIRDYIKVQVVKD---SPEPATREATVTNTKKNKKKDSKKKEEDTEA 169

Query: 175 RNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKA-YVDGTI 233
            +   M+  +     S   WRP GI Y KNE +L V E +  LV      +K+  V G I
Sbjct: 170 TDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYI 229

Query: 234 DMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCV 293
              ++LSG P+   GLN   S            E+  ++A               FHQCV
Sbjct: 230 QCRSYLSGMPMLTIGLNKLNS----------ENEYFMRRA--------------NFHQCV 265

Query: 294 SLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLP---------FKITPVVTPCG-STVEY 343
           +LD+   +++I F PPDG  +L  Y +  N++ P          K+ P  T  G   +  
Sbjct: 266 NLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLIL 325

Query: 344 RITLKSLFPNKLSAKDVALHIPVPPGTV--DCKINIS--------NGKCKFESEENAMVW 393
            +T+ + F  KL      L+I VP   V  D  +++S         GK  F   ++ ++W
Sbjct: 326 AVTISTYF--KLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLW 383

Query: 394 RFNKYHG---------LTENTLSAVTVPTSDTTQLTLQQWPRP----------------- 427
              K  G          +E  L           QL+    P+P                 
Sbjct: 384 EVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHEL 443

Query: 428 --------PMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
                    + + FEI  ++ SGL V + ++ +K  +++   W++Y
Sbjct: 444 NSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRY 489

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 127/341 (37%), Gaps = 97/341 (28%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WRP GI Y KNE FL V EK+  ++   +G +    ++GTI   ++LSG P    GLN  
Sbjct: 181 WRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGLNK- 239

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKER--IIKFVPPD 310
                     L  +  H              ++  KFH+CV L    KE   +IKF+PPD
Sbjct: 240 ----------LMQKNVH-------------FMKRLKFHECVDLHTLIKEESPVIKFIPPD 276

Query: 311 GNMELMKYCVRDNLNLPFKITPVVT----------PCGSTVEYRITLKSLFPNKLSAKDV 360
           G  EL  Y     LN P    PV+                 + ++ LK+       A+D 
Sbjct: 277 GEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDS 332

Query: 361 A--LHIPVPPGTVDCKINI----------SNGKCKFESEENAMVWRFNKYHGLTENTLSA 408
           A  L I +P  +V  K NI            G   F+    +++W+ N   G   N    
Sbjct: 333 AKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYG 392

Query: 409 VTV-------PTSDTTQLTLQQWPRPP--------------------------------- 428
           +            +  ++ L+    PP                                 
Sbjct: 393 LKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVD 452

Query: 429 ----MSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
               +++ FEI  ++ SGL V YF++ +    Y+   W++Y
Sbjct: 453 KFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 131/335 (39%), Gaps = 82/335 (24%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVSRDGSILKA-YVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI+Y KNE FL V EK+   +    +I+K   + G I   + LSG P  +  LN  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLNKI 284

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGN 312
                   ++ D Q                 L  CKFHQCV  D  ++ ++++FVPPDG+
Sbjct: 285 --------IYQDKQ----------------FLSSCKFHQCVMPDSVDEGKVLEFVPPDGD 320

Query: 313 MELMKYCVRDNLN-LPF--KITPVVTPCGSTVEYR--ITLKSLFPNKLSAKDVALHIP-- 365
             L KY ++ ++N LP    I+  V P     + +  +T++S F    S   + + IP  
Sbjct: 321 FVLCKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNIKIPLK 380

Query: 366 --VPPGTVDCKINISN----GKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQL 419
             +    +D   NI +    GK  F   ++ ++W      G              +  + 
Sbjct: 381 VLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEEY 440

Query: 420 TLQQWPR------PPMSLG------------------------------------FEIMM 437
             QQ         PP+  G                                    FEI  
Sbjct: 441 LRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEIPY 500

Query: 438 FSNSGLVVRYFRVSDKDEKYRVVKWIKY--ISKSG 470
            ++SGL V Y ++ + + +Y+   W++Y  IS  G
Sbjct: 501 NTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDG 535

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 132/325 (40%), Gaps = 78/325 (24%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK+  L   ++  + K  + G I   ++LSG P  +  LN  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN-- 295

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGN 312
                   L  D Q                 +   KFHQCV+L+  N E+ ++F+PPDG 
Sbjct: 296 ------KLLQRDAQ----------------FMSHSKFHQCVALETLN-EKELEFIPPDGE 332

Query: 313 MELMKYCVRDNLN-LP-FKITPV-VTPCGSTVEYRI--TLKSLFPNKLSAKDVALHIPVP 367
             L +Y ++ ++N  P  KIT   + P     + RI  T+++ F  + S   + + IP+ 
Sbjct: 333 FILCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVKIPLA 392

Query: 368 PGTVDCKINISN--------GKCKFESEENAMVWRFNKY---HGLTENTLSA-------- 408
               D  I++S         G+  F   ++ ++W   +    HG T+ ++ A        
Sbjct: 393 KLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFNKE 452

Query: 409 ----------------------------VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSN 440
                                           +    ++ ++      + + FEI   + 
Sbjct: 453 EFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPYTTC 512

Query: 441 SGLVVRYFRVSDKDEKYRVVKWIKY 465
           SGL V Y ++ ++  +Y+   W++Y
Sbjct: 513 SGLKVEYLKIEEEQLQYQSFPWVRY 537

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 84/345 (24%), Positives = 131/345 (37%), Gaps = 97/345 (28%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V E +  L++ +D  I +  + G I   ++LSG P  +  LN  
Sbjct: 227 WRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN-- 284

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN------------- 299
                   +  D ++F               L   KFHQCVSL+  N             
Sbjct: 285 -------KILQDDKQF---------------LGHAKFHQCVSLNSINIKDLEKDLEGPND 322

Query: 300 -------KERIIKFVPPDGNMELMKYCVRDNLNLPFKITPV---VTPCGSTVEYRITLK- 348
                   ++ I+F+PPDG   L +Y +R ++  P  I      + P       +I+LK 
Sbjct: 323 ISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQISLKI 382

Query: 349 -SLFPNKLSAKDVALHIPVPPGTVDCKINISN--------GKCKFESEENAMVWRFNKY- 398
            + F  + S   + + IP+     D KI++S         GK  F   E+ ++W  +   
Sbjct: 383 ETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALK 442

Query: 399 --HGLTENTLSAVTVPTSDTTQLTLQQWPR-----PPMSLG------------------- 432
             HG  E  + A     +      LQ+  +     PP+  G                   
Sbjct: 443 GGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDT 502

Query: 433 ------------FEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
                       FEI   + SGL V Y ++ +   KY+   W++Y
Sbjct: 503 ALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRY 547

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 102/499 (20%), Positives = 194/499 (38%), Gaps = 104/499 (20%)

Query: 44  SPILTLGSTTFHHIRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAY---DLTKEE 100
            P+++  S  F HI+ +    + ++     +AN   I  FL +F+++L  Y       + 
Sbjct: 42  QPVISASSFHFVHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKN 101

Query: 101 KLKEDFMICYEILDVVIGAGGIPM-DTELGSIASKISVKPPKS----------GGTSSEP 149
            + ++ ++  E++D  I  G I + D  +     ++ V  P++            T  E 
Sbjct: 102 MVLDNVLLIMELIDESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEED 161

Query: 150 KSSTVANFPGSNL----STSNLSMPKFLTRNNRSMSQDLGTNYPSNFP--------WRPN 197
              T       NL      +     K    +  +   D+  +Y S           WR  
Sbjct: 162 NKKTKRRSGKPNLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAK 221

Query: 198 GIKYKKNEVFLYVNEKINILVSRDGSILKA-YVDGTIDMTTHLSGTPICQFGLNDSPSVE 256
           GI Y +NE FL V E++  L+  +  I+K   + G I   ++LSG P  +   N      
Sbjct: 222 GIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN------ 275

Query: 257 FGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELM 316
               L    ++F               +   KFHQCV+    N E+ I+F+PPDG+  L 
Sbjct: 276 ---KLSQKDEQF---------------ISHSKFHQCVTWPSSN-EKEIEFIPPDGDFVLC 316

Query: 317 KYCVRDNLN-------LPFKITPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPG 369
           +Y ++ ++        + F + P +      ++   T+++ F  + S   + L IP+   
Sbjct: 317 QYELKRHVKDQPMLKLVSFGVKPKLKKY--KIQMSCTIETHFKARNSTSTLNLKIPLARL 374

Query: 370 TVDCKINI--------SNGKCKFESEENAMVWRFNKY---HGLTENTLSA----VTVPTS 414
             + +I++         +GK  F   ++ ++W        HG T+ +++A          
Sbjct: 375 FQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEF 434

Query: 415 DTTQLTLQQWPRPP----------------------------MSLGFEIMMFSNSGLVVR 446
           +  Q  L+    PP                            +S+ FEI   + SGL V 
Sbjct: 435 EEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVE 494

Query: 447 YFRVSDKDEKYRVVKWIKY 465
           Y ++ ++  +Y+   W++Y
Sbjct: 495 YLKIDEEQLQYQSFPWVRY 513

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 113/283 (39%), Gaps = 40/283 (14%)

Query: 43  RSPILTLGSTTFHHIRSNGSDSLWIVTVSR--TNANSGAIWEFLYKFNAILDAY--DLTK 98
           R P+L+     + +I+ +G   L+ +++S          ++ +L +   +   Y  +   
Sbjct: 39  RLPVLSHRGYDYIYIQRDG---LYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLN 95

Query: 99  EEKLKEDFMICYEILDVVIGAGGIPMDTELGSIASKISVKPPKSG--GTSSEPKSSTVAN 156
            + + ++F + YE++D  I  G IP  T+   I   + V+  +    G     K     +
Sbjct: 96  RQLIMDNFHLVYELMDESIDMG-IPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRD 154

Query: 157 FPGSNLSTSNLSMPKFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINI 216
             G     ++         +   M+  +     S   WRP GI Y KNE FL V E++  
Sbjct: 155 KAGKEEEEADPG-----AADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEY 209

Query: 217 LVSRDGSILKA-YVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVP 275
           L+  + + ++   V G I+  ++LSG P    GLN                         
Sbjct: 210 LMDFERAQVRLNQVHGAINCRSYLSGMPQLTVGLNKM----------------------- 246

Query: 276 KAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKY 318
             A          FHQCV L++   +R I FVPPDG  +L  Y
Sbjct: 247 -VAQDRDFTSQVHFHQCVDLERLATDRHITFVPPDGEFQLCHY 288

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 98/235 (41%), Gaps = 45/235 (19%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK   ++  ++  I K  + G I     LSG P  +  LN  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-- 346

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKF-NKERIIKFVPPDG 311
                   L    Q+F               L   +FHQCVSL+   NKE  I+F+PPDG
Sbjct: 347 -------KLLQKDQQF---------------LSQLRFHQCVSLETIQNKE--IEFIPPDG 382

Query: 312 NMELMKYCVRDNLNLP-------FKITPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHI 364
              L +Y ++ ++  P       F+I P +      +   IT  + F  + S   + L I
Sbjct: 383 EFILCEYELKRHVKDPPNIKLISFEIKPKLKKFKIQINLSIT--TFFKVQNSTSILNLKI 440

Query: 365 PVPPGTVDCKINISN--------GKCKFESEENAMVWRFNKYHGLTENTLSAVTV 411
           P+     D KI++          G+ KF   ++ ++W      G     + A+T 
Sbjct: 441 PLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMTA 495

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 23/37 (62%)

Query: 429 MSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
           +++ FEI  ++ SGL V Y ++ ++   Y+   W++Y
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRY 645

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 117/521 (22%), Positives = 209/521 (40%), Gaps = 94/521 (18%)

Query: 1   MINAIFIYSTRGELIVSKLFNN---SLKRSISDIFRI--QVIN----NLDVRSPILTLGS 51
           M  + +I   R  LI   L  +     K+ ++ I  +  Q++N    ++    P +TL  
Sbjct: 1   MFLSFYITDARNNLIFQYLLRSDSPGFKQIVTKIQSVAPQLLNAASCDVSAELPTVTLSR 60

Query: 52  TTFHHIRSNGSDSLWIVTVSRTNANSGAI------WEFLYKFNAILDAY---DLTKEEKL 102
                   + +D L    + RT    G+       + FL   + IL+ Y   D+ K  K+
Sbjct: 61  NLELCSYHSPADGLRYWCLQRTEIGEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKI 120

Query: 103 KEDFMICYEILDVVIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKS--STVANFPGS 160
            +++     + + ++ AG  P  T+L  +   + +K   +   +S   S   T++N  G+
Sbjct: 121 TKNYDRVTLLFNSMVDAGE-PDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGN 179

Query: 161 NLSTSNLSMPKFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVS- 219
            + + + S       N+R  S     N     PWR  G+KY  NE+++ + E +NI+++ 
Sbjct: 180 QMFSKHSS-------NSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAK 232

Query: 220 -RDGSIL---KAYVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVP 275
            R+ + L      +DG +    +LS  P+ +  LN +     G  L            +P
Sbjct: 233 TRNSTSLVPISGSIDGEVGFKCYLSENPLVELDLNTN-----GHDL-----------GIP 276

Query: 276 KAAAGSVMLEDCKFHQCVSLDKFN-KERIIKFVPPDGNMELMKYCV-------RDNLNLP 327
                        FH+CV  +  +     ++F+PPDG+  LM+Y +       R+ +   
Sbjct: 277 ------------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNIDLDSLRNRNKILSN 324

Query: 328 FKITPV-----VTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINI-SNGK 381
             +  V     + P     E ++T+ +L  N    +D+ + +   P   D KI I  N  
Sbjct: 325 LGLVSVDYHTGLGPKKDEFEIKVTV-ALSRNVKHVEDLKIDVHFDPLREDGKIKILRNTH 383

Query: 382 CKFESE-ENAMVWRFNKYHGLTENTLSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSN 440
             FE+   N   W F+K     E  +    V        T   WP+      +  M +SN
Sbjct: 384 GGFENGINNKGTWTFDK-----ETPVGVFPVLRGCIEGCTEPTWPK------YLSMSYSN 432

Query: 441 SGLVVRYFRVSDKD------EKYRVVKWIKYISKSGSYEVR 475
            G +    RV+  +         +  K +KYI+K G Y VR
Sbjct: 433 KGQLPSGIRVNSVNILSGFPAGVKPFKGVKYITKIGDYVVR 473

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/364 (22%), Positives = 137/364 (37%), Gaps = 120/364 (32%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVSRD-GSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK+  LV  + G + ++ + G I   ++LSG P  +  LN  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN-- 308

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLD---------------- 296
                   L  + ++F               +   +FHQCVSLD                
Sbjct: 309 -------KLLQNDKQF---------------ISQVQFHQCVSLDSIEKVIKYAEEHSDEL 346

Query: 297 ------KFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTV-----EYRI 345
                 + N E  I+F+PPDG+  L  Y ++ ++  P    P+V  C   +     +Y++
Sbjct: 347 KTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDP----PMVKLCSFEITPKWKKYKL 402

Query: 346 ----TLKSLFPNKLSAKDVALHIPVPPGTVDCKINI--------SNGKCKFESEENAMVW 393
                +++ F    S   + + IP+     D +I++        SNG+  +   ++ ++W
Sbjct: 403 KISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLW 462

Query: 394 RF-----NKYHGLTENTLSAVTVPT----------------------------------- 413
                   K HG  E+      V T                                   
Sbjct: 463 EIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKL 522

Query: 414 SDTTQLTLQ---------QWPRPPM---SLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVK 461
            D  + T +         Q P+  +   S+ FEI   + SGL V Y ++ +   +Y+   
Sbjct: 523 EDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFP 582

Query: 462 WIKY 465
           W++Y
Sbjct: 583 WVRY 586

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 87/358 (24%), Positives = 135/358 (37%), Gaps = 114/358 (31%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V E++  L+    G I K  + G I   ++LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN-- 312

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN-------KE---- 301
                   L  D Q                 + +  FHQCVSLD  N       KE    
Sbjct: 313 ------KILNRDPQ----------------FMSNSNFHQCVSLDSINTIEKGQEKEQNTG 350

Query: 302 --------RIIKFVPPDGNMELMKYCVRDNL-NLP------FKITPVVTPCGSTVEYRIT 346
                   R I+FVPPDG   L +Y ++ ++ + P      F+I P +    S ++    
Sbjct: 351 DSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLK--KSKIQILTK 408

Query: 347 LKSLFPNKLSAKDVALHIPVPPGTVDCKINIS--------NGKCKFESEENAMVWRFNKY 398
           +++ F    S   + + IP+     D KI++S        NGK  F   ++ ++W     
Sbjct: 409 IQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTM 468

Query: 399 HGLTENTLSAVTVPTSD---------TTQLTL---QQWPR-----------PPM------ 429
            G  E   +A   P  D           + +L   +++ R           PP+      
Sbjct: 469 KGHRER--NASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKL 526

Query: 430 ----------------------SLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
                                 S+ FEI   + SGL V Y +V +   +Y+   W++Y
Sbjct: 527 EELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 63/137 (45%), Gaps = 35/137 (25%)

Query: 190 SNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLSGTPICQFGL 249
           S  PWR +GI Y  NE+F+ ++E+IN +V + G +L  ++ G ID+  HLSG P+ +  L
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 250 NDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN--------KE 301
                        LD +  H                +  FH+C+  DK N        K 
Sbjct: 267 G-----------LLDHKLSH---------------LNTTFHRCILEDKANSINDLIAGKF 300

Query: 302 RIIKFVPPDGNMELMKY 318
             + FVPPDG   L +Y
Sbjct: 301 TKLTFVPPDGRTRLCQY 317

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 131/313 (41%), Gaps = 62/313 (19%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILV------SRDGSILKAYVDGTIDMTTHLSGTPICQ 246
           PWR   IK  +NE+++ V E + + +      S    +L  Y++G++ + + + G P+ +
Sbjct: 174 PWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLE 233

Query: 247 FGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKF--NKERII 304
                   V FG   +        K  +PK            FH CV +++F  N   II
Sbjct: 234 --------VSFGGCDF--------KDIIPK------------FHDCVEVNEFLTNDGNII 265

Query: 305 KFVPPDGNMELMKYCV-----RDNLNLPFKITPVVTPCGSTVEYRITL---KSLFPNKLS 356
           KF+PPDG  +LM+Y +      DNL +    T  +    S  E+ ITL   KS    K++
Sbjct: 266 KFIPPDGKFQLMEYSMALSSFNDNL-ISCNFTNGLG--NSNDEFEITLNINKSNKVPKIN 322

Query: 357 AKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDT 416
              V L+     G    KI + N   +FE  +N  ++      G        V   T + 
Sbjct: 323 NLQVCLNFENREGQSKVKI-LRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVEEETKNE 381

Query: 417 TQLTLQQWPRPPMS-----LGFEIMMFSNSGLVVRYFRVSDKD---------EKYRVVKW 462
               +    R  +S     L   IM F   G +    RVS  +         ++ ++ K 
Sbjct: 382 EDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQQLFKG 441

Query: 463 IKYISKSGSYEVR 475
           +KY++K+ +YE+R
Sbjct: 442 VKYVTKTSNYEIR 454

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 133/338 (39%), Gaps = 92/338 (27%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK+  L+    G I K  + G I    +LSG P  +  LN  
Sbjct: 218 WRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN-- 275

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKE----------- 301
                   L  + ++F               + + KFHQCVS++   +E           
Sbjct: 276 -------KLIKNDEQF---------------ISNSKFHQCVSINSLKREINNEEEENTYH 313

Query: 302 -RIIKFVPPDGNMELMKYCVRDNL-NLP------FKITPVVTPCGSTVEYRITLKSLFPN 353
            + I+F+PPDG   L KY ++ ++ ++P       +I P +      ++  +T+++ F  
Sbjct: 314 GKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKY--KIQIHVTIETHFKK 371

Query: 354 KLSAKDVALHIPVPPGTVDCKINISN--------GKCKFESEENAMVWRFNKY---HGLT 402
           + S   + + IP+       KI+++         G+  F   ++ ++W        +G +
Sbjct: 372 QNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGES 431

Query: 403 ENTLSA----VTVPTSDTTQLTLQQWPRPP------------------------------ 428
           +N + A          D  Q  ++    PP                              
Sbjct: 432 KNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQ 491

Query: 429 -MSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
            +++ FE+   + SGL V Y ++ +    Y+   W++Y
Sbjct: 492 LLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRY 529

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 141/371 (38%), Gaps = 109/371 (29%)

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTID 234
           N+R M+  +         WR  GI Y KNE FL V EK+   +  + G I K  + G I 
Sbjct: 234 NDRYMNSYIAKTTIMPISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEII 293

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS 294
             ++LSG P  +  +N          L  D Q                 L + KFHQCVS
Sbjct: 294 CRSYLSGMPKLKISIN--------KILKQDVQ----------------FLSNVKFHQCVS 329

Query: 295 LD----------------KFNKER-------IIKFVPPDGNMELMKYCVRDNL-NLP--- 327
           LD                K N+E         I+F+PPDG   L KY ++ ++ + P   
Sbjct: 330 LDSIRARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIK 389

Query: 328 ---FKITPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNG---K 381
              F+I P +      ++  + +++ F    S   + L IP+       +I++S     K
Sbjct: 390 LRNFEIIPKLHKF--KIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFK 447

Query: 382 CK-----FESEENAMVWR---FNKYHGLTENTLSAVTV---------------------- 411
           C+     F   +  ++W     N  HG  ENTLS +                        
Sbjct: 448 CEQGTVLFNLSDKFLLWEVGTMNGGHG--ENTLSMMAEFALFNEEEYKKMEEERKTSMNP 505

Query: 412 -----------------PTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKD 454
                               D+ +++ ++     +++ FE+   + SGL + Y ++ +  
Sbjct: 506 PPLREGPKLEELYKKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQ 565

Query: 455 EKYRVVKWIKY 465
            +Y+   W++Y
Sbjct: 566 LQYQSFPWVRY 576

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 102/227 (44%), Gaps = 25/227 (11%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK+   +    G I K  + G I    +LSG P  +  +N  
Sbjct: 297 WRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN-- 354

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLED----CKFHQCVSLDKFNKERIIKFVP 308
             +   DS +L    FH   ++      S   +D       ++  + D+ ++++ I+F+P
Sbjct: 355 -KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENHDERDRKKEIEFIP 413

Query: 309 PDGNMELMKYCVRDNL-NLP------FKITPVVTPCGSTVEYRITLKSLFPNKLSAKDVA 361
           PDG+  L KY ++ ++ +LP      F I P ++     ++  + +++ F    +   + 
Sbjct: 414 PDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKLSKY--KLKIHVIIETHFKTTNNTSKLN 471

Query: 362 LHIPVPPGTVDCKINIS--------NGKCKFESEENAMVWRFNKYHG 400
           L IP+     + +I++S         GK  F   +N ++W      G
Sbjct: 472 LKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKG 518

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 400 GLTENTLSAVTVPTSDTTQLTLQQWPRPP--MSLGFEIMMFSNSGLVVRYFRVSDKDEKY 457
           G  E T +       +     L++  R P  + + FEI  ++ SGL + Y ++ +   +Y
Sbjct: 593 GSQEATGTHARKTKEERKDKDLRKRTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQY 652

Query: 458 RVVKWIKY 465
           +   W++Y
Sbjct: 653 QSFPWVRY 660

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 70/347 (20%), Positives = 135/347 (38%), Gaps = 95/347 (27%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVSRDGSILKA-YVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V EK+   +    +++K   + G I     LSG P  +  +N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN-- 312

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKF--NKERIIKFVPPD 310
                   +  + ++F               L +CKFHQCVSL     +  + ++FVPPD
Sbjct: 313 -------KIVNEDKQF---------------LANCKFHQCVSLASLESSDHKDVEFVPPD 350

Query: 311 GNMELMKYCVRDNLN-------LPFKITPVVTPCGSTVEYRITLKSLFPNKLSAKDVALH 363
           G   L +Y ++ ++        + F++ P +      ++  +T+++ F    +   +AL 
Sbjct: 351 GEFTLCRYELKRHVRDEPMVKLVNFEVKPKLK--KFKLKLLLTIETHFKTTNATSKLALR 408

Query: 364 IPVPPGTVDCKINISN--------GKCKFESEENAMVWRFNKY---HGLTENTL----SA 408
           +P+     + ++++S         G   F   ++ ++W        HG T+ ++    + 
Sbjct: 409 VPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVEFAL 468

Query: 409 VTVPTSDTTQLTLQQWPRPP---------------------------------------- 428
                 D  Q  L+    PP                                        
Sbjct: 469 FNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPRTRE 528

Query: 429 ----MSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGS 471
               +++ FE+   ++SGL V Y ++ +   +Y+   W++Y + S +
Sbjct: 529 IDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 84/379 (22%), Positives = 133/379 (35%), Gaps = 119/379 (31%)

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTID 234
           N+  ++ D+         WR  GI Y KNE FL V E++  L+    G I K  + G I 
Sbjct: 236 NDLYINGDIAKTIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIV 295

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS 294
              +LSG P  +  +N          L  D Q                 + + KFHQCVS
Sbjct: 296 CRCYLSGMPKLKISIN--------KLLNRDPQ----------------FMSNSKFHQCVS 331

Query: 295 LDKFN------------------KERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTP 336
           LD  N                    + I+F+PPDG   L +Y ++ ++    K  P++  
Sbjct: 332 LDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHV----KDAPMIKL 387

Query: 337 CGSTVEYRI---------TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISN-------- 379
            G  ++ ++          +++ F    S   + + IP+     D KI++S         
Sbjct: 388 QGFEIKPKLKKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANL 447

Query: 380 GKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTT---------------------Q 418
           GK  F   ++ ++W      G  E      TVP  D                       Q
Sbjct: 448 GKVVFNLSDDFLLWEIGTMKGHRERNTG--TVPQEDDASTLASMVAEFPLFNQEEYDRLQ 505

Query: 419 LTLQQWPRPP--------------------------------MSLGFEIMMFSNSGLVVR 446
             L+    PP                                +S+ FEI   + SGL V 
Sbjct: 506 EELKTSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVE 565

Query: 447 YFRVSDKDEKYRVVKWIKY 465
           Y +V +   +Y+   W++Y
Sbjct: 566 YLKVEEPQLQYQSFPWVRY 584

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 128/309 (41%), Gaps = 65/309 (21%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILVSRD---GSI--LKAYVDGTIDMTTHLSGTPICQF 247
           PWR  G+KY  NE+++ V E +++++ ++   G +  ++  +DG +D  +HLSG P+   
Sbjct: 187 PWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNPVIAL 246

Query: 248 GLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN-KERIIKF 306
            L        G  L +                          HQC  LD +  +   ++F
Sbjct: 247 NLRLR-----GHDLGMPA-----------------------LHQCC-LDSYQGRPDQLRF 277

Query: 307 VPPDGNMELMKYCVR-DNLNLPFKI---TPVVTPCGSTVEYRITLKSL---FPNKLS--- 356
           VPPDG  +LM Y +  D+L    K+     +V+P     +YR  L  L   F   L+   
Sbjct: 278 VPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLVSP-----DYRTELGDLGDEFEVNLNIAG 332

Query: 357 ------AKDVALHIPVPPGTVDCKINI---SNGKCKFESEENAMVWRFNKYHGLTENTLS 407
                   D+ + +   P   +CKI +   ++G  +  +  N   W F+K     E    
Sbjct: 333 SQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDK-----ETPTG 387

Query: 408 AVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRV-SDKDEKYRVVKWIKYI 466
            + V        T +Q     +S+ +       SG+ V    + S   +  +  K +KYI
Sbjct: 388 TLPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNIKPFKGVKYI 447

Query: 467 SKSGSYEVR 475
           +K+G + +R
Sbjct: 448 AKTGDFHLR 456

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 97/208 (46%), Gaps = 38/208 (18%)

Query: 136 SVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNNRSMS-QDLGTNYPSNFPW 194
           S++  ++GG S+   +S +    GSN +TSN+S+      NN S    + GT      PW
Sbjct: 202 SIQNVQTGGGSTRSITSNL--LSGSN-NTSNVSISGNGMGNNSSSGFGNSGTINNKVVPW 258

Query: 195 RPNGIKYKKNEVFLYVNEKINILVSRDGS------------------ILKAYVDGTIDMT 236
           R   +KY  NE+++ V E+I+++  R  S                  +++A + G +++ 
Sbjct: 259 RSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELNVR 318

Query: 237 THLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLD 296
           ++LS  P+ +  L D    +   + W +   F       +   G  M     FH CV +D
Sbjct: 319 SYLSDNPMVEVTLVDRNYSD-QKTGWSENDLF------KQLNLGLPM-----FHDCVEID 366

Query: 297 ---KFNKE-RIIKFVPPDGNMELMKYCV 320
                N++ R IKF+PPDG   LMKY +
Sbjct: 367 YEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 81/360 (22%), Positives = 129/360 (35%), Gaps = 114/360 (31%)

Query: 194 WRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTIDMTTHLSGTPICQFGLNDS 252
           WR  GI Y KNE FL V E++  L+    G I K  + G I    +LSG P  +  +N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN-- 317

Query: 253 PSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN------------- 299
                   L  D Q                 + +  FHQCVSLD  N             
Sbjct: 318 ------KILNRDPQ----------------FMSNSSFHQCVSLDSINTIEKDEEKNSDDD 355

Query: 300 -------KERIIKFVPPDGNMELMKYCVRDNL-NLP------FKITPVVTPCGSTVEYRI 345
                    R I+F+PPDG   L +Y ++ ++ + P      F+I P +      +  +I
Sbjct: 356 AGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKI 415

Query: 346 TLKSLFPNKLSAKDVALHIPVPPGTVDCKINISN--------GKCKFESEENAMVWRFNK 397
             ++ F    S   + + IP+     + KI++S         GK  F   ++ ++W    
Sbjct: 416 --QTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQT 473

Query: 398 YHGLTENTLSAVTVPTSD-----TTQLTLQQWPR-------------------PPMSLG- 432
             G  E++ +  +   SD     T    + ++P                    PP+  G 
Sbjct: 474 MKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGP 533

Query: 433 ---------------------------FEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKY 465
                                      FEI   + SGL V Y +V +   +Y+   W++Y
Sbjct: 534 RLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 593

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/361 (21%), Positives = 137/361 (37%), Gaps = 72/361 (19%)

Query: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVS-RDGSILKAYVDGTID 234
           N+  ++ D+         WR  GI Y KNE FL V E++  L+    G I K  + G I 
Sbjct: 244 NDLYINGDIAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIV 303

Query: 235 MTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS 294
              +LSG P  +  +N    +   D+ +L    FH  + V   +  ++   + K      
Sbjct: 304 CRCYLSGMPKLKISIN---KILNRDAQFLSNSSFH--QCVSLDSIKTIEKREEKEDDDTG 358

Query: 295 LDKFNKERIIKFVPPDGNMELMKYCVRDNL-NLP------FKITPVVTPCGSTVEYRITL 347
           L      + ++FVPPDG   L +Y ++ ++ + P      F+I P +      +E +I  
Sbjct: 359 LQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKI-- 416

Query: 348 KSLFPNKLSAKDVALHIPVPPGTVDCKINISN--------GKCKFESEENAMVWRFNKYH 399
           ++ F    S   + + IP+     + +I++S         GK  F   ++ ++W      
Sbjct: 417 QTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMK 476

Query: 400 GLTENTLSAVTVPTSDTTQLT----------------LQQWPR-----PPMSLG------ 432
           G  E+  +  +   +D                     LQ+  +     PP+  G      
Sbjct: 477 GHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEEL 536

Query: 433 ----------------------FEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSG 470
                                 FEI   + SGL + Y +V +   +Y+   W++Y + S 
Sbjct: 537 YRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSD 596

Query: 471 S 471
            
Sbjct: 597 D 597

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 121/310 (39%), Gaps = 67/310 (21%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILV---SRDGSI--LKAYVDGTIDMTTHLSGTPICQF 247
           PWR  G+KY  NE+++ V E I++++    + G +  ++  +DG +D  +HL+G P+   
Sbjct: 187 PWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVAL 246

Query: 248 GLNDSPSVEFGDSLWLDTQEFHNKK-AVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKF 306
            LN                  H     VP              H C           ++F
Sbjct: 247 KLN-----------------LHGHDLGVP------------ALHPCCQAQYTGSPENLQF 277

Query: 307 VPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTVEYRITLKSL---FPNKLSAK----- 358
           VPPDG   LM+Y + D   L  K          +++Y + L  L   F  K++       
Sbjct: 278 VPPDGKFRLMQYTI-DLEALQTKSKLFSNMGLVSLDYFVGLGDLRDEFEIKVNIAGSQHV 336

Query: 359 ----DVALHIPVPPGTVDCKIN-ISNGKCKFES--EENAMVWRFNKYHGLTENTLSAVTV 411
               D+ + I     T DC+I  + +    FE+  E N   W F+K     E     V V
Sbjct: 337 KLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDK-----ETPTGTVPV 391

Query: 412 PTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKD------EKYRVVKWIKY 465
                   T +Q     +++      +SN G +    +V   D      +  +  K +KY
Sbjct: 392 FRGCLENATPEQIKTLSLAIS-----YSNKGSLPSGIKVGAVDIISGLPKNTKPFKGVKY 446

Query: 466 ISKSGSYEVR 475
           ++++G + +R
Sbjct: 447 VARTGQFNLR 456

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 119/300 (39%), Gaps = 47/300 (15%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILVSRDGS---ILKAYVDGTIDMTTHLSGTPICQFGL 249
           PWR    +Y  NE+++ + E +N  + + GS   ++   + G ID+  +LSG P  Q  L
Sbjct: 141 PWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL 200

Query: 250 NDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPP 309
             S                               L++   H+CV L +      + FVPP
Sbjct: 201 RTSGH----------------------------PLDNSALHRCVELGEAGVA-TMNFVPP 231

Query: 310 DGNMELMKYCV---------RDNLNLPFKITPVVTPCGSTV-EYRITLKSLFPNKLSA-K 358
           DG   L +Y +         R   NL      + +  G    E+ I +      +++A +
Sbjct: 232 DGRFTLAEYAIDLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIE 291

Query: 359 DVALHIPVPPGTVDCKINI---SNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSD 415
           D+ + +  P  +   KI I   ++G  + +      VW F+K   +    +    V   +
Sbjct: 292 DLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPE 351

Query: 416 TTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISKSGSYEVR 475
           +T      +P   +++ +  +    SG+ V    +SD     +  K +KY S++G Y VR
Sbjct: 352 STPHAPPVFPS-HLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAGDYIVR 410

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 40/140 (28%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILVSRDG----------SILKAYVDGTIDMTTHLSGT 242
           PWR  G+KY  NE+++ + E I+++  + G           ++   ++G   +  +LSG 
Sbjct: 212 PWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSGN 271

Query: 243 PICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKER 302
           P     L+ +                 N   VP             FH+CV LD      
Sbjct: 272 PTVDLQLDLAG----------------NDLGVPA------------FHECVELDNHQNPS 303

Query: 303 --IIKFVPPDGNMELMKYCV 320
              ++F+PPDG   LM+Y +
Sbjct: 304 NCDLRFIPPDGRFNLMQYSI 323

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 64/147 (43%), Gaps = 40/147 (27%)

Query: 190 SNFPWRPNGIKYKKNEVFLYVNEKINIL----------VSRDGSILKAYVDGTIDMTTHL 239
           +N PWR   +K+  NE+++ + E ++++          ++R    +K  V+G      +L
Sbjct: 199 ANAPWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNG------YL 252

Query: 240 SGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFN 299
            GT   Q  LN +P VE      L  +   N    P             FH+CV +D++ 
Sbjct: 253 KGTAYVQSFLNGNPLVE------LQLELSGNDIGHP------------SFHECVDIDEYL 294

Query: 300 KE------RIIKFVPPDGNMELMKYCV 320
           K         +KF+PPDG   LM Y +
Sbjct: 295 KNIDNSSISSLKFIPPDGKFTLMDYTI 321

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 62/156 (39%), Gaps = 56/156 (35%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILV-------SRDG--------SILKAYVDGTIDMTT 237
           PWR NGIK  K E+++ + E++ +          RDG         ++  ++ GTID+  
Sbjct: 190 PWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRC 249

Query: 238 HLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLD- 296
           +L+G P                SL  DT    N   +P             FH CV  + 
Sbjct: 250 YLNGNPTV--------------SLMFDT--MGNDLGIPS------------FHACVEQED 281

Query: 297 ------------KFNKERIIKFVPPDGNMELMKYCV 320
                        F  +R+++F+PPDG   L +Y +
Sbjct: 282 QVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVI 317

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 69/151 (45%), Gaps = 37/151 (24%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINILVS---RDGSI--LKAYVDGTIDMTTHLSGTPICQF 247
           PWR   +KY  +E+++ + E ++++     R+ S+  +   ++G +++ ++LSG P  + 
Sbjct: 193 PWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEM 252

Query: 248 GLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFV 307
            ++                            AG+ M      HQCV + + +   +  F+
Sbjct: 253 DMD---------------------------LAGNEMYAP-SMHQCVEMPQGSPSSLC-FI 283

Query: 308 PPDGNMELMKYCVRDNLNLPFKITPVVTPCG 338
           PPDGN  L+ Y +  ++N   K+T   +P G
Sbjct: 284 PPDGNCNLLNYTIDLDMNPKVKVT---SPVG 311

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 64/163 (39%), Gaps = 58/163 (35%)

Query: 193 PWRPNGIKYKKNEVFLYVNEKINI-----LVSRDG-------------------SILKAY 228
           PWR   IK  KNE+++ + E I++     + +R G                    ++  Y
Sbjct: 260 PWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNGY 319

Query: 229 VDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288
           + G ID+ ++L+G PI +  LN                   N    P             
Sbjct: 320 ITGVIDVRSYLNGNPIVEMKLNTCG----------------NDMGTPS------------ 351

Query: 289 FHQCVSLD---KFNKERI---IKFVPPDGNMELMKYCVRDNLN 325
            H CV L+     + +++   +KF+PPDG   L +YCV  N N
Sbjct: 352 LHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARYCVDLNKN 394

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 69/146 (47%), Gaps = 18/146 (12%)

Query: 182 QDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT-HLS 240
           QD+  +     PWR   + +  NE++L + E I++++        +Y + T+ + T ++ 
Sbjct: 192 QDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKR-KSSYANSTMKIVTGNII 250

Query: 241 GTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDK-FN 299
           G  + +  LN +P VE              K  +      S+ L +C   + V  D+ F 
Sbjct: 251 GKALVKSVLNGNPIVEM-------------KIDMAGNDLESIFLHECVKSKDVDKDQEFE 297

Query: 300 KERIIKFVPPDGNMELMKYCVRDNLN 325
             ++IKF+PPDG+ +L  Y +  NLN
Sbjct: 298 NTKLIKFLPPDGSFKLFDYNI--NLN 321

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 36/135 (26%)

Query: 193 PWRPN-GIKYKKNEVFLYVNEKINILVSRDGS---ILKAYVDGTIDMTTHLSGTPICQFG 248
           PWR +   K++ NE++L + E  +++  +  S   ++   + GT+D+ ++L+ TP+    
Sbjct: 200 PWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLVK 259

Query: 249 LNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDK---FNKERIIK 305
           LN                   N   +P              H+CV ++    F+   I  
Sbjct: 260 LN----------------TMGNDIGIPS------------LHECVEINDGGVFSPSNIT- 290

Query: 306 FVPPDGNMELMKYCV 320
           F+PPDG   L++YCV
Sbjct: 291 FIPPDGKFRLLEYCV 305

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 99/259 (38%), Gaps = 63/259 (24%)

Query: 83  FLYKFNAILDAY---DLTKEEKLKEDFMICYEILDVVIGAGGI------------PMDTE 127
           FL +F+ +L  Y   D+    KL  +      +L+ +I AG I            P+ T+
Sbjct: 84  FLSRFDGLLMEYFDRDVLTATKLMNNQDRLALLLNSIIDAGEIVMSDTNKLRYLLPLHTD 143

Query: 128 LGSIASKISVKPPKSGGTSSEPKSSTVANFPGSN-LSTSNLSMPKFLTRNNRSMSQDLGT 186
           L ++ S           ++++  + T+ N   SN L +SN S        NRS    L  
Sbjct: 144 LSTVFS-----------SATKTLTRTIKNRESSNFLGSSNSSNINGGPTINRSSDSPLDA 192

Query: 187 NYPSNFPWRPNGIKYKKNEVFLYVNEKI--NILVSRDGS--ILKAYVDGTIDMTTHLSGT 242
                 PWR   +    NE+++ + E +  N+  SR  S  +    + G ID+  +L G 
Sbjct: 193 QV---VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGN 249

Query: 243 PICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVS-LDKFNKE 301
           P  Q  L                   H+     K +A          H+C+         
Sbjct: 250 PTMQINL-------------------HSAGHAFKPSA---------LHRCLDPSSSSFDS 281

Query: 302 RIIKFVPPDGNMELMKYCV 320
             ++F+PPDG   L++Y +
Sbjct: 282 SSLRFIPPDGKFTLLEYTI 300

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 104/286 (36%), Gaps = 80/286 (27%)

Query: 193 PWRPNG--IKYKKNEVFLYVNEKINILVS-----------------RDGSI--LKAYVDG 231
           PWR NG  I   +NE++  V E I ++                   R G +  ++  + G
Sbjct: 226 PWR-NGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISG 284

Query: 232 TIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQ 291
           ++DM   L+G P+ +  L             LD         +P             FH 
Sbjct: 285 SVDMRCFLTGNPLVEIALKQGG---------LDI-------GIP------------GFHD 316

Query: 292 CV---SLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGSTVEYRITLK 348
           CV   SL K  K   + F+PPDG   LM+Y    N+NL       V              
Sbjct: 317 CVDKTSLLKQEKISKLSFIPPDGRFTLMQY----NINLDQGKRHSVG------------- 359

Query: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408
                 L   D+  H+       +  +NIS+       E+  ++  F    GL+      
Sbjct: 360 ------LVHADIEDHLGTLGDEFEVTLNISSSTSVKHIEDMEVMLYF----GLSHGNRKK 409

Query: 409 VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKD 454
            T  +SD  + +++Q+   P+ +    +   +SG+  R   V DK+
Sbjct: 410 DTHLSSDEEEFSVEQFRIKPLQITHGRLENMSSGVHKRSKWVFDKE 455

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 36/135 (26%)

Query: 193 PWRPN-GIKYKKNEVFLYVNEKINILVSRDGSILK---AYVDGTIDMTTHLSGTPICQFG 248
           PWR +   K++ NE+++ + E  +++     S L+     + GT+D+ ++L+  P+    
Sbjct: 200 PWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSVK 259

Query: 249 LNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERI---IK 305
           LN                   N   VP              H+CV + K + E +   I 
Sbjct: 260 LN----------------TMGNDIGVPT------------LHECVEI-KDDGEFLPSNIT 290

Query: 306 FVPPDGNMELMKYCV 320
           F+PPDG   L++Y V
Sbjct: 291 FIPPDGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 54/133 (40%), Gaps = 33/133 (24%)

Query: 193 PWRPN-GIKYKKNEVFLYVNEKINILVSRDGS---ILKAYVDGTIDMTTHLSGTPICQFG 248
           PWR +   K++ NE+++ + E  +++  +  S   +L   + G +D+ ++L+  P+    
Sbjct: 200 PWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAVK 259

Query: 249 LNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL-DKFNKERIIKFV 307
           LN                   N   +P              H CV + D       I F+
Sbjct: 260 LN----------------TMGNDIGIPS------------LHDCVEINDGVFSPSNITFI 291

Query: 308 PPDGNMELMKYCV 320
           PPDG   L++Y V
Sbjct: 292 PPDGKFRLLEYSV 304

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 67/155 (43%), Gaps = 41/155 (26%)

Query: 173 LTRNNRSMSQDLGTNYPSNFPWRPNGI-KYKKNEVFLYVNEKINILVSRDGSILK---AY 228
           ++R N S+ +D         PWR +   K++ NE+++ + E  ++++ +  + L+     
Sbjct: 185 MSRGNISLVED-----EDIVPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGD 239

Query: 229 VDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCK 288
           + G +D+ ++L+  P+    LN                   N+  +P             
Sbjct: 240 ICGAVDVRSYLNDNPLVSVKLN----------------TMGNEIGIPS------------ 271

Query: 289 FHQCVSLD---KFNKERIIKFVPPDGNMELMKYCV 320
            H+CV ++   +F    I  F+PPDG   L++Y +
Sbjct: 272 LHECVEINDDGEFTPSNIT-FIPPDGKFRLLEYSI 305

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 29  SDIFRIQVINNLDVRSPILTLGSTTFHHIRSNGSDSLWIVTVSRTNANSGAIWEFLYKFN 88
           SDI+++   N ++    I  LG T+FH +R+N  D L      R N+ +GA W FL K  
Sbjct: 107 SDIYKVSDKNGVEKVMKIHRLGRTSFHTVRNN-RDYL------RKNSKNGANWMFLSKLA 159

Query: 89  A 89
           A
Sbjct: 160 A 160

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 289 FHQCVSLDKFNK----ERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTP 336
            H CV LD   +       +KF+PPDG   LM+Y V   L  P     +VTP
Sbjct: 287 LHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSV--TLGDPRAYFGLVTP 336

>TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.274
           YHR030C
          Length = 501

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 4/110 (3%)

Query: 109 CYEILDVVIGAGGIPMDTELGSIASK-ISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNL 167
           C + L+ ++   G P D  L  I SK I     K G  S  P S     FP ++    +L
Sbjct: 238 CVDHLNRILQVLGTPDDETLRRIYSKNILGYLQKLGRISPTPLSEL---FPNASTEYLDL 294

Query: 168 SMPKFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINIL 217
               F+   NR ++ D   N+P    W     +Y  N+ F +  E IN L
Sbjct: 295 LSKIFIFDKNRRITVDEALNHPYLSVWHDPEDEYSCNDKFNFEFENINNL 344

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 16/89 (17%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M+N   +YS  G + V K          SDI+R+   N  +    I  LG T+FH ++ N
Sbjct: 88  MLNRETVYSVGGTIGVGKE---------SDIYRVSDRNGTEKVMKIHRLGRTSFHTVK-N 137

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNA 89
             D +      + NA +G  W +L K  A
Sbjct: 138 KRDYI------KKNAKNGVNWMYLSKIAA 160

>TPHA0C03610 Chr3 (783935..785566) [1632 bp, 543 aa] {ON} Anc_2.336
           YMR171C
          Length = 543

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 34/75 (45%), Gaps = 14/75 (18%)

Query: 341 VEYRITLKSLF----PNKLSAKDVALHI---------PVPPGTVDCKINISNGKCKFES- 386
           V YRI   ++F      K+S K+V  HI         P+    V CKI+++ G   F   
Sbjct: 336 VGYRINSGTVFFTRNGKKVSEKEVGGHIKGWKFKYLYPIVGANVPCKIHVNLGTSGFVFI 395

Query: 387 EENAMVWRFNKYHGL 401
           E N   W F K HGL
Sbjct: 396 EANVKKWGFAKAHGL 410

>Ecym_4212 Chr4 (443277..445514) [2238 bp, 745 aa] {ON} similar to
           Ashbya gossypii AGL153C
          Length = 745

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 78  GAIWEFLYKFNAILDAYDLTKEEKLKEDFM-ICYEILDVVIGAGGIPMDTELGSIASKIS 136
           G+I   + +F  + D Y +  E  ++ D+M  C+     +I  GG+    +LGS  S++S
Sbjct: 92  GSIVSEMPQFGQLRD-YHVPSEMVVQFDYMPRCFRENGGLIACGGLIGPDDLGSKLSRVS 150

Query: 137 VKPPKSGGTSSEPKS 151
           V+     G S +P S
Sbjct: 151 VQSDGDNGDSGDPSS 165

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 105/251 (41%), Gaps = 56/251 (22%)

Query: 204 NEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPSV-----EFG 258
           N + + +NE IN  ++RDG+I  + + G +++  + +     Q  L DS +V     +F 
Sbjct: 286 NGILITINETINAEITRDGNISSSELKGVLELRINDASLAHSQLALLDSINVKDKAFQFK 345

Query: 259 DSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPD----GNME 314
               +D  +F + K +         L D K                K  P +    G + 
Sbjct: 346 THPNIDKNKFLSSKLIS--------LRDAK----------------KSFPSNDHSLGVLR 381

Query: 315 LMKYCVRDNLNL-PFKITPVVTPCGS-------TVEYRITLKSLFPNKLSAKDVALHIPV 366
             K C  D+ +L P  ++  VTP  +       T+E  IT +  +  +L  ++V+  +PV
Sbjct: 382 WRKVCSADDTSLIPLNVSAWVTPSDNGEGIFDVTLELEITEE--YGQEL--ENVSFVLPV 437

Query: 367 PPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTTQLTLQQWPR 426
              T + KIN  +         NA +   ++  G+T    S++T  +S     T++    
Sbjct: 438 V--TENVKINDESNDF------NARIAGMDEEVGITIKLDSSITPGSSGVVAFTVEAGLE 489

Query: 427 P---PMSLGFE 434
               P+++GF+
Sbjct: 490 DAMFPITVGFK 500

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 16/89 (17%)

Query: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60
           M+N   +YS  G + V K          SDI+++   N +     I  LG T+FH +R+N
Sbjct: 88  MLNRDTVYSIGGSIGVGKE---------SDIYQVSDKNGVSKVMKIHRLGRTSFHTVRNN 138

Query: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNA 89
             D L      + N  +G  W +L +  A
Sbjct: 139 -RDYL------KKNVKNGVNWMYLSQLAA 160

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%)

Query: 195 RPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPS 254
            P  IK + N + + + E IN  +SRDG++    + G +++  +       +  L+DS +
Sbjct: 268 EPEEIKPENNGILISIKETINAEISRDGAVRSTELKGVMELRINDESLAHSKVTLSDSVN 327

Query: 255 V 255
           V
Sbjct: 328 V 328

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 139 PPKSGGTSSEPKS-----STVANFPGSNLSTSNLSMPKFLTRNNRSMSQDL 184
           PP S   S++P S     S V N P + L T NL  P  +T NN +M+QDL
Sbjct: 842 PPNSIHISNQPNSIPLTPSVVYNAPITQLQT-NLPFPTTVTSNNSNMNQDL 891

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 47/103 (45%), Gaps = 10/103 (9%)

Query: 182 QDLGTNYPSNFPWR-----PNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMT 236
           +++GT+  S+   R     P   K   N + + + E +N  ++RDG+I  + + G +++ 
Sbjct: 253 RNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISSSELKGVLELR 312

Query: 237 THLSGTPICQFGLNDS-----PSVEFGDSLWLDTQEFHNKKAV 274
            +       +  L+DS      S++F     +D  EF   K +
Sbjct: 313 VNDRSLAHAKLTLDDSVDVKDRSLQFKTHPNIDKAEFLKSKTI 355

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235
           RS S    ++ P     R   IK   N + + +NE IN  + RDGSI  + + G +++
Sbjct: 250 RSASNTGASHVPKPHRQREE-IKRTNNGILILINETINAELQRDGSITSSELKGVLEL 306

>YEL025C Chr5 complement(102581..106147) [3567 bp, 1188 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to both the
           cytoplasm and the nucleus
          Length = 1188

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 12/73 (16%)

Query: 183 DLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKIN--ILVSRDGSILKAYVDGT------ID 234
           DL  N    F +   G+ YK N +FL ++E  +  + VSR G +LKA +DG+      +D
Sbjct: 467 DLALNGGDEFAYESGGLIYK-NGIFL-MDEPYDYGLFVSRTGKVLKAGMDGSTGEFRQVD 524

Query: 235 M--TTHLSGTPIC 245
              + H S T  C
Sbjct: 525 FLQSNHNSSTMFC 537

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,209,743
Number of extensions: 2503969
Number of successful extensions: 8042
Number of sequences better than 10.0: 115
Number of HSP's gapped: 8030
Number of HSP's successfully gapped: 133
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)