Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B04136g3.483ON57257230160.0
SAKL0F02970g3.483ON57357325420.0
KLLA0B10868g3.483ON57457325330.0
TDEL0D055203.483ON57357325280.0
Kpol_480.193.483ON57457325210.0
YPR145W (ASN1)3.483ON57257225040.0
Smik_16.3963.483ON57257224950.0
NCAS0F035103.483ON57557424940.0
KNAG0A079203.483ON57857724940.0
Suva_16.4743.483ON57257224920.0
KAFR0G036703.483ON57257124810.0
KLTH0F14630g3.483ON57357224790.0
CAGL0I10648g3.483ON57457224710.0
Kwal_55.211873.483ON57357124630.0
YGR124W (ASN2)3.483ON57257124630.0
Skud_16.4393.483ON57257224570.0
Smik_6.2203.483ON57257324560.0
AFR303W3.483ON57157324480.0
NDAI0B058103.483ON57757624440.0
Skud_7.4353.483ON57257124310.0
Ecym_12443.483ON57357124250.0
Suva_7.4103.483ON57257224240.0
TBLA0C044303.483ON58057924160.0
TPHA0D042003.483ON57457123940.0
KLLA0D10285g8.875ON5154331528e-10
ZYRO0A00528g8.875ON5121031384e-08
KAFR0L021108.875ON514951252e-06
Skud_13.468.875ON5191001242e-06
Ecym_81558.875ON5134071233e-06
NDAI0K001808.875ON522941215e-06
ADL350C8.875ON508831206e-06
TPHA0C049508.875ON525811207e-06
SAKL0D00352g8.875ON515851199e-06
TDEL0B004408.875ON5161031199e-06
KNAG0J002008.875ON5151021181e-05
Kwal_27.97058.875ON515871181e-05
Kpol_455.78.875ON518941181e-05
NCAS0C001908.875ON5171061152e-05
Smik_13.398.875ON5214311143e-05
Suva_13.528.875ON519991125e-05
YML096W8.875ON525961118e-05
TBLA0C063008.875ON5181001091e-04
KLTH0E16412g8.875ON515951091e-04
CAGL0H06963g8.875ON51773950.006
Skud_7.311singletonON8190750.21
Suva_11.3365.713ON71493742.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B04136g
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...  1166   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   983   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   980   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   978   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...   975   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   969   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   965   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   965   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   965   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   964   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   960   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   959   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   956   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   953   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   953   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   951   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   950   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   947   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   946   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   941   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   938   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   938   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   935   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   926   0.0  
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    63   8e-10
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   4e-08
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    53   2e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    52   2e-06
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    52   3e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    51   5e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    51   6e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    51   7e-06
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    50   9e-06
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    50   9e-06
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    50   1e-05
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    50   1e-05
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    50   1e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   2e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    48   5e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    47   8e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   1e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    47   1e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    41   0.006
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    33   0.21 
Suva_11.336 Chr11 (620693..622837) [2145 bp, 714 aa] {ON} YKR099...    33   2.1  

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPKSAA 540
           QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPKSAA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPKSAA 540

Query: 541 NTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           NTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN
Sbjct: 541 NTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/573 (80%), Positives = 506/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFA ++H  VQE++P ALQLSKRIRHRGPDWSGNVVKN+TIL HERLAIVGL+SG+Q
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G+YTLCVNGEIYNHI+LREE + YPF++LSDCEPIIPLY KY +D PK LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMG+SS SP T FFASELKCL+DDCDEI AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS +D+ITRY+ P WLDE  +P TPLDYK++R+SLE +VRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+AN++LDPV YD E+KHLAG+D +GNLH  GWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDRDFL++CM +DP EKMI   EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKDAAE AISDE  A P+PEWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           A+TVMRWIPKADWGC  DPSGR+AKIHEQHI N
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/573 (80%), Positives = 507/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFA+FR+ DVQ Y+P ALQLSKRIRHRGPDWSGN+VKNSTILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G+YTL VNGEIYNHI LREEC+ YPF++LSDCEPIIPLY KY +DAPK LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYDSK+DRI+AARDPIGITTLYMG+SS SPK+ +F+SELKCL DDCDEI+AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D++TRYF P WLDES +P+TP+D+K +R SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+ N ELDPV YDS+   LAG+D QG+LH  GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVA FIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDRDFL LCM +DPN+KMIKP EG+IEKYILRKAFDTTDEP++KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKDAAE  ISDE  A P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           A+TVMRWIPKADWGC  DPSGR+AKIHEQH+D 
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDK 573

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/573 (79%), Positives = 505/573 (88%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAA +H DVQ Y+  ALQLSKRIRHRGPDWSGNV++N+T+LVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCGNYTLCVNGEIYNHI+LREE SDY F +LSDCEPIIPLY KY +D PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRI+AARDP+GITTLYMG++S SPKT FFASELKCL DDCD IVAFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE+ +PS P+DYK +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+AN E+D   YDSE+KHLAGID  GNLH+ GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA KVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DP +KMI  EEGR+EKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKD AE  ISD++ A P+  WGDD PTTKEA+WYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           A+TVMRW+PKADWGC  DPSGRFA+IH+QH+ N
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/573 (79%), Positives = 504/573 (87%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAA++H + + ++P ALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCG+Y LCVNGEIYNHIQLRE C DY +++LSDCEPIIPLYLK+ +DAPK LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMG++SKSPKT FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRYF+P W+DE  +P+ P+ YK +R SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+A +E+D   YDSE+KHL GID QGNLHT GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           LAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DP EKMI   EGRIEKYILRKAFDT+DEP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKD AE  ISDE+ +TP+  WG D PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           A TVMRWIPKADWGC  DPSGR+AKIHEQHI +
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHIGD 573

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/572 (79%), Positives = 497/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAFRH DV  Y+P ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVG+ESG+Q
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G Y LCVNGEIYNHIQLREEC+DY F +LSDCEPIIP+YLK+ +DAPK LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARET +A  +++P  YDS+ +HLAGID  G LHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DPNEKMIKP+EGRIEKYILRKAFDTT EP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKD AE  ISDEM A+P+ EWG D PTTKEA+WYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRWIPKADWGC  DPSGR+A+IHE+HI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/572 (79%), Positives = 496/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H DV  Y+P ALQLSKRIRHRGPDWSGN +KNSTI VHERLAIVGLESG+Q
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC +Y F++LSDCEPIIP+YLK+ +DAPK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  ++DP  YDS+ +HLAG+D  G LHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLD++FL LCM +DPNEKMIKP+EGRIEKYILRKAFDTT EP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKD AE  ISDEM A+P+ EWG D P+TKEA+WYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRWIPKADWGC  DPSGR+A+IHE+HID
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/574 (78%), Positives = 502/574 (87%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAFRH DV+ Y+P ALQL+KRIRHRGPDWSGNVVKN+TIL HERL+IVGL+SG+Q
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQ+REEC+DY F++LSDCEPIIPLYLKY LDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRIVAARDPIGITTLYMG+ SK+P+T +FASELKCL DDCD IVAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS +DQITRYFNP WLDE  +PSTP+D K +R +LEK+VRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEE-KHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPD 299
             IASIAARETE+A +++D  + + E  KHL G+D +G+LHTGGWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQK 479
           RVPFLD++FL LCM +DP +KMI    G+IEKYILRKAFDTTD+P  KPYLP++ILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KS 538
           EQFSDGVGYSWIDGLKD AE  ISD M   P+P WG+D PTTKEAYWYRLKFD  +P K+
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 539 AANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           AA+TVMRWIPKADWGC  DPSGR+AKIHE+H+D 
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/577 (78%), Positives = 506/577 (87%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFA FRH DVQ ++P ALQLSKRIRHRGPDWSGN++KNSTI+ HERLAIVGL+SG+Q
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCG+Y L VNGEIYNHIQLREEC +Y ++SLSDCEPIIP+YLKY LDAPK LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRIVAARDPIGITTLYMG+SS  PKT FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRY+ P WLDE+ +PSTP+D K +RH+LEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEK----HLAGIDAQGNLHTGGWSRLHSFAIGLPG 296
             IA+IAARETE+AN+ELDP  YD +E+    HLAGID +GNL +  WSRLHSFAIGLPG
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL+AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILW 476
           LEARVPFLD++FL+LCM +DP +K+I  +EGRIEKYILRKAFDT DEP+VKPYLPE+ILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISDEM A P+  WG D PTTKEA+WYRLKFD  FP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 K-SAANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           + +AA TVMRWIPKADWGC  DPSGRFAKIHEQH+++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/572 (78%), Positives = 498/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H DV  Y+P ALQLSKRIRHRGPDWSGN VKNSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC DY F++LSDCEPIIP+YLK+ +DAPK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARET +A  +++P  YD++ +HLAG+D +GNLHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DP+EKMI+P+EGRIEKYILRKAFDTTDEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWID LKD AE  ISDEM A P+ EWG+D PTTKEAYWYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRW+PKADWGC  DPSGR+A+IHE+HID
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 500/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAFRH DV  ++  ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQLRE+  DY F++LSDCEPIIPLYL+  +DAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYDSK+DRI+AARDPIG+TTLYMG+SS SPKT FFASELKCL+DDCD IVAFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P W+DE+ +P+TP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETE AN ELD   Y  E  HLAGID +G+L T GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGS+HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL+LCM +DPN+K+I  +EGRIEKYILRKAFDT D+P+ KPYLP++ILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539
           QFSDGVGYSWID LKD AE+ ISDEM A P+  WG D PTTKEAYWYRLKFD  FP+ +A
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A TVMRWIPKADWGC  DPSGR+A+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/572 (79%), Positives = 494/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIF  FRH  V+E++P AL+L KRIRHRGPDWSGN++KNST++ HERLAIVGL+SG+Q
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           P  S   NY L VNGE+YNHIQLREE S YPF++LSDCEPIIPLY KYG+DAPK LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+ SKSPKT +FASELKCL D+CD I+AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRYFNP W+DE  +PS PLD   +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+AN ++DPV YDSE+KHLAG+D  GNL + GWS LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM LDP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKDAAE AISDE    P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRWIPKADWGC  DPSGR+AKIHEQHID
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/572 (79%), Positives = 499/572 (87%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAA++H DV  ++P ALQLSKRIRHRGPDWSGNVVKNSTI+VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G+YTLCVNGEIYNHIQLRE+  DY F++LSDCEPIIP YL++ +DAPK LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRIVAARDP+GITTLYMG+ S SPKT FFASELKCL DDCDEI AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+DQITRYF P W+DES +P+TP+++K +R SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYD-SEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPD 299
             IASIAARETE+ANEE D  + D S  K LAGID QG+LHT GWSRLHSFAIGLP APD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           L AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQK 479
           RVPFLD++FL LCM +DP +KMI    GRIEKYILRKAFDT+DEP+VKPYLPE+ILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KS 538
           EQFSDGVGYSWIDGLKD AE  ISD M + P+ EWG+D PTTKEAYWYRLKFD  FP K+
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 539 AANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           AA+TVMRWIPKADWGC  DPSGR+AKIHEQH+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/571 (78%), Positives = 497/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIF  FRH DV +++P ALQL+KRIRHRGPDWSGNV++NST+L HERLAIVGL++G+Q
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           P+ S   +Y L VNGEIYNHIQLREE SDYPF++LSDCEPIIPLY KYG+DAPK LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DR++AARDPIGITTLYMG+ SKSPKT +FASELKCL D+CD I+AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++DQITRY+ P WLDE+ +PS PLD   +R+SLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+AN E++PV YDSE+KHLAG+D  G LH+ GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL+LCM LDP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGLKD AE  ISDE    P+ EWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A+TVMRWIPKADWGC  DPSGR+AKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 500/571 (87%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H D+  ++P ALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G Y L VNGEIYNHIQLRE CSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           A+CLYDSK+DRIVAARDPIG+ TLYMG+SS+SP+T +FASELKCL D CD I++FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+AN + +  N + +EK LAGID QG+LHT GWSRLHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANADANEDN-NVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLD+DFL LCM +DPNEKMIKP+EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGL+D AE AISD M A P+ +WGDD PTTKEAYWYRLKFD +FP K+A
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A+TVMRWIPKADWGC  DPSGR+AKIHE+H+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/572 (78%), Positives = 492/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAA++H DV  Y+  ALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGLESG+Q
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC DY F++LSDCEPIIP+YLK+ ++APK LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARET  A  +++P  YDS+ +HLAG+D  GNLHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DP EKMI+ +EGRIEKYILRKAFDTT EP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWID LKD AE  ISDEM A+P+ EWG D PTTKEA+WYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRW+PKADWGC  DPSGR+A+IHE+HI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/573 (78%), Positives = 500/573 (87%), Gaps = 6/573 (1%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H D+  ++P ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G Y L VNGEIYNHIQLREECSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           A+C+YD+K+DRIVAARDPIG+ TLYMG+SSKSPKT +FASELKCL D CD I+AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDS--EEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAP 298
             IA+IAARETE+AN +   VN +S  +EK LAGID QG+LHT GWSRLHSFAIGLP AP
Sbjct: 241 SLIAAIAARETEKANAD---VNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAP 297

Query: 299 DLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 358
           DL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA
Sbjct: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLE 418
           QGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLE
Sbjct: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417

Query: 419 ARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQ 478
           ARVPFLD+DFL LCM +DP +KMIKP+EG+IEKYILRKAFDTT+EP+VKPYLPE+ILWRQ
Sbjct: 418 ARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQ 477

Query: 479 KEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-K 537
           KEQFSDGVGYSWIDGL+D AE  ISD M A P+ +WGDD PTTKEAYWYRLKFD +FP K
Sbjct: 478 KEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQK 537

Query: 538 SAANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           +AANTVMRW+PKADWGC  DPSGR+AKIHE+H+
Sbjct: 538 TAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/573 (78%), Positives = 494/573 (86%), Gaps = 3/573 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFA +R  D++ ++P AL+LSKR+RHRGPDWSGNV+KN TILVHERLAIVGL+SG+Q
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SP GNY LCVNGEIYNHI LREECSDY F SLSDCEPIIPLYLKY ++ P+ LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD + DRIVAARDPIG+TTLYMGKSS SP+TR+FASELKCL+D+CDEI AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS +D++TRYF P W+DE+ +PS P+DYK +R +LEK+VRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETERAN E   V  D   KHLAG+D +G LHTGGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANREAGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS  EF  E   RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL LCM +DP EKMI P++GRIEKYILRKAFDT+DEP V PYLPE+ILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539
           QFSDGVGYSWIDGLKDAAE AISDE  A P P WGDD PTTKEA+WYRLKFD  FP+ +A
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572
           A TVMRW+PKADWGC  DPSGR+AKIH+QHI +
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/576 (77%), Positives = 492/576 (85%), Gaps = 5/576 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H DV  ++P ALQLSKRIRHRGPDWSGNV+KN+TIL HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCGNYTLCVNGEIYNHIQ+RE+  DYPF++LSDCEPIIPLYLK+ +D PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYDSK+DRI+AARDPIGITTLYMG++SK+P+T FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDSK+DQITRYF P WLDE  +P   LD   +R SLE +VRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEE--LDPVNYDSE--EKHLAGIDAQGNLHTGGWSRLHSFAIGLPG 296
             IASIAARETE+AN +  LD  N + E  + HL G+D +G+LH GGWS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILW 476
           LEARVPFLDRDFL LCM +DP EKMI   EGRIEKYILRKAFDT+D+P  KPYLPE+ILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISD M   P+  WG D PTTKEAYWYRLKFD  +P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 -KSAANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
            K+AA+TVMRWIPKADWGC  DPSGR+AKIHE+H++
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/571 (77%), Positives = 492/571 (86%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H D+  ++P ALQLSKRIRHRGPDWSGN V NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G Y L VNGEIYNHIQLRE+CS Y FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           A+CLYD+K+DR+VAARDPIG+ TLYMG+SSKSPKT +FASELKCL D CD I++FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +PS P+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+AN + D  +     K LAGID QG+LHT GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETEKANADADG-DASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDRDFL LCM +DP +KMI P+EGRIEKYILRKAFDTTDEP VKPYLPE+ILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWIDGL+D AE  ISD M A P+ +WG+D PTTKEAYWYRLKFD +FP K+A
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A+TVMRW+PKADWGC  DPSGR+AKIHE+H+
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/571 (76%), Positives = 499/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFA +R   ++ ++P ALQLSKRIRHRGPDWSGNVVKN TI VHERLAIVGL++G+Q
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  GNY LCVNGEIYNHI LR+ C+DYPF +LSDCEPIIPL+ KYG++ P  LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AWCLYD+K+DRIVAARDPIG+TTLYMGK SKSP+TR+FASELKCL+++CDEI++FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS +DQITRYF P WL +S  P+ P+DYK LR  LEK+VRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE+AN+E+D V YDS+ ++L G+D + +LH  GWS+LHSFAIGLP APDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSAK+F  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDRDFL LCM +DP EKMIKP+EG+IEKYILRKAFDT+DEP+V+PYLP++ILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539
           QFSDGVGYSWID LKDAAE AISDE  A P+PEWGDD P+TKEAYWYR+KFD  FP+ +A
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A+TVMRW+PKA+WGC  DPSGRFAKIHE+HI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/572 (76%), Positives = 496/572 (86%), Gaps = 2/572 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAAF+H D+++++P ALQLSKRIRHRGPDWSGN + NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G+Y L VNGEIYNHIQLRE+CSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           A+CLYDSK+DR++AARDPIG+ TLYMG+ SKSPKT +FASELKCL D CD I+AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +P+TP+DY+ +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IA+IAARETE AN E +     +E+  LAGID QG+LHT GWSRLHSFA+GLP APDL
Sbjct: 241 SLIAAIAARETETANVEANE-EASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLD+DFL LCM +DP +KMI  +EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539
           QFSDGVGYSWID L+D AE  ISD M A P+  WGDD PTTKEAYWYRLKFD +FP K+A
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
           A+TVMRW+PKADWGC  DPSGR+A+IHE+H++
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/579 (74%), Positives = 496/579 (85%), Gaps = 8/579 (1%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIFAA++H +V  ++P ALQL+KRIRHRGPDWSGNVVKN+T+  HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI SPCGNY L VNGEIYNHIQLREE +DY +++L DCEPIIP+YLKY +DAP  LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           A+ LYDS++DR++AARDP+GITTLYMG++SK+PKT +FASELKCL+DDCD I+AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+I RYF P W+DES +P+TP+D K +R +LE++VRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEE-------KHLAGIDAQGNLHTGGWSRLHSFAIG 293
             IASIAARETE+  +E + ++Y+ +        K L G+D  GNL T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPGAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LPGAPDL AARKVA FIGS+HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPED 473
           AWGLEARVPFLDRDFLNLCM +DPN+KMIKP+EG+IEKY+LRKAFDT+DEP+VKPYLPE+
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDK 533
           ILWRQKEQFSDGVGYSWID LKD AE  ISDEM A P+  WG D PTTKEAYWYRLKFD 
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 FFP-KSAANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571
            FP K+AA+TVMRWIPKADWGC  DPSGR+AKIHEQHID
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/571 (76%), Positives = 488/571 (85%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60
           MCGIF  ++H + + ++P ALQLSKRIRHRGPDWSGNVVKNSTI+ HERLAIVGL+SG+Q
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120
           PI S  G++ LCVNGEIYNHIQ+RE+  DY F++LSDCEPIIPLY+KYG +APK LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMG+SSKSPKT +FASELKCL DDCD IVAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYXXXXXXXXXX 240
           YDS +DQITRY+ P W+DE+ + + PLD   +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300
             IASIAARETE+A +     +  S    L GID  GNL + GWSRLHSFAIGLPGAPDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480
           VPFLDR+FL+LCM +DP+EKMI  +EGRIEKYILRKAFDTTDEPN KPYLP++ILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFPK-SA 539
           QFSDGVGYSWIDGLKD AE  ISDE+   PR  WG D PTTKEAYWYRLKFD  FP+ +A
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570
           A+TVMRWIPKADWGC  DPSGR+AKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 107/433 (24%), Positives = 176/433 (40%), Gaps = 70/433 (16%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLD-APKKLDGMFAWCLYDS 127
           Y L  NGE+YN   + E C        SD E I  L  K+ ++   +K  G FA+ + D 
Sbjct: 90  YLLQYNGELYNDDTV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDL 142

Query: 128 KEDRIVAARDPIGITTLY-------MGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180
           +E ++   RD IG  +L        +  +S S +   F + L  +I            ++
Sbjct: 143 QERKVYFGRDSIGKRSLSYILLDDELYITSVSGRCDGFQNCLAGVI------------YI 190

Query: 181 YDSKSDQITRYFNPQWLDESYMPSTPLD--------YKV-LRHSLEKSVRKRLMAEVPYX 231
           +D  + Q+T   + +  DE Y+ S  +D        YK+ L   L +SV +R++   P  
Sbjct: 191 FDINTKQLTG--SVKIHDEPYIVSDQIDNDFQLLEEYKIKLYECLRRSVYQRIVTIHPMH 248

Query: 232 XXXXXXXXXXXIASIAARETERANEELDPVNYDSEEK-HLAGIDAQGNLHTGGWSRLHSF 290
                           +  T    E+L  +N +SE    L  +  + N  TG        
Sbjct: 249 LENGNISILFSGGLDCSVITALLCEQLIKINRNSETIIELLNVGFE-NPRTGKMP----- 302

Query: 291 AIGLPGAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLET-----YDVTT--- 342
                 +PD + A K A+ +  L+ +    L E      D + H +T     Y   T   
Sbjct: 303 ----SDSPDRILAIKSAQLLSELYPQVNIKLIEVDVPYTDYLSHKDTVIDLMYPKNTEMD 358

Query: 343 IRASTPMFLLSR---KIKAQGVK--------MVLSGEGSDEIFGGYLYFAQAPSAKEFQA 391
           +  +   +  SR   K+   G          ++ SG G+DE++GGY  F+   S +E   
Sbjct: 359 LSIAIAFYFASRGRGKVTENGESKPYNRSGIVMFSGLGADELYGGYHKFSN-KSNEELVI 417

Query: 392 ECASRVKNLHLADCLRANKSTMAWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEK 451
           E   ++  +H  +  R +K     G+E R PFLD   +   ++L  N K+ K     + K
Sbjct: 418 ELQKQIAQIHDRNLNRDDKVISNHGIEVRYPFLDERVVQFSVDLPLNYKVNKHILRVMAK 477

Query: 452 YILRKAFDTTDEP 464
            ILR  F  ++EP
Sbjct: 478 DILRLDF-ISEEP 489

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E   ++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRK 456
           A G+E R PFLDR  +   M+         P   +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQ-------SIPINWKINKLILRK 471

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S +E  AE   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKA 457
           FLD + +    +  P          ++ K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINY-------KVNKLILRKV 474

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQS--LSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYD 126
           Y L  NGE+YN  +++++ +D  F +  LS    +I            +LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 SKEDRIVAARDPIGITTL 144
            +E +I   RD IG  +L
Sbjct: 139 LRETKIYFGRDSIGKRSL 156

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 11/100 (11%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E   ++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDRDFLNL-CMELDPNEKMIKPEEGRIEKYILRKA 457
            R PFLD   +NL  +E+  N K        + K ILRK 
Sbjct: 448 VRYPFLDEYVINLSTLEIPINYK--------VNKLILRKV 479

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 54/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQPIKSPCGN----YTLCVNGEIYNHIQ 82
           I  RGP++S   V    I  H+      + S  +P      N    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECSDYPFQSLSDCEPIIPLY-LKYGLDAPKKLDGMFAWCLYDSKEDRIVAARDPIGI 141
             +E SD+   SL     +  L   +  +D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 98/407 (24%), Positives = 156/407 (38%), Gaps = 64/407 (15%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAP-KKLDGMFAWCLYDS 127
           Y L  NGE+YN     ++ S       +D + I  L  K  +D   ++L G FA+ +Y++
Sbjct: 91  YILQYNGELYN-----DDISH------NDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDD---CDEIVAFPPGHVYDSK 184
           K   I   RD +G  +L   + +++ +   F + +   ++    CD  + +    VYD+ 
Sbjct: 140 KTKCIYFGRDSVGKRSLSYHQDNETGE--LFITSVSGKLEGFKACDAGIIY----VYDTV 193

Query: 185 SDQITRYFNPQWLDESYMPSTPLDYKV---------LRHSLEKSVRKRLMAEVPYXXXXX 235
              +   +N   L E Y  S   D  V         L + L  S+ KRL    P      
Sbjct: 194 RRTL---YNDMRLREYYQVSGTHDTDVELLQSNVDLLYNKLYDSINKRLTTIEPLHEENK 250

Query: 236 XXXXXXXIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLP 295
                     +          E   VN D+  + L    A  N  TG         +   
Sbjct: 251 THVSVLFSGGLDCSVIAALICEQWKVNSDAVLELLNV--AFENPRTG---------MKPS 299

Query: 296 GAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPM------ 349
            APD + +++  K +  L+ +    L E   + DD + H            T M      
Sbjct: 300 EAPDRILSKRSVKILRKLYPQTKIKLVEVDVSYDDYLKHKPVVIDLMYPKDTEMDLSIAI 359

Query: 350 -FLLSRK-----------IKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAKEFQAECASR 396
            F  + K           I  Q   +VL SG G+DE++GGY  F    S +    E   +
Sbjct: 360 AFYFASKGHGSLQEGDKTISYQRRSLVLFSGLGADELYGGYHKFNN-KSPELLIKELTKQ 418

Query: 397 VKNLHLADCLRANKSTMAWGLEARVPFLDRDFLNLCMELDPNEKMIK 443
           + N++  +  R +K     G+E R PFLD + +NL   L  N K  K
Sbjct: 419 INNIYDRNLDRDDKCMACNGIEIRYPFLDEEVINLSTSLPINYKTNK 465

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S +E   E   ++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRK 456
           FLD D +    E         P   +I K ILRK
Sbjct: 455 FLDIDVIKFSTEE-------LPINYKINKLILRK 481

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIV---GLESGSQPIKSPC----GNYTLCVNGEIYN 79
           I  RGP++S       +  V ++ +I     + S  +P    C      Y +  NGE+YN
Sbjct: 49  IAARGPNYS-------SFKVSKQYSITWFSSVLSLREPFTKQCVEIKDRYVVQFNGELYN 101

Query: 80  HIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDSKEDRIVAARDPI 139
             +++   + Y  Q L + + II        D  +KLDG FA+ +YD +       RDPI
Sbjct: 102 D-EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPI 152

Query: 140 G 140
           G
Sbjct: 153 G 153

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S +E   E   ++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFAN-KSTEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDRDFLNLCMELD---PNEKMI 442
           FLD   +   + L     N+KMI
Sbjct: 441 FLDEKVIKASVALPISYKNDKMI 463

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S +E   E   ++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDRDFLNLCMELDP 437
           +E R PFLD   +N   +  P
Sbjct: 446 IEVRYPFLDEYVVNFSTKEIP 466

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 17/82 (20%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAP------KKLDGMFAW 122
           Y L  NGE+YN+              +SD    +   LK  LD        + L+G FA+
Sbjct: 89  YILQFNGELYNN----------EIHGISDTTYFVNC-LKTALDEKDIINILRTLEGEFAY 137

Query: 123 CLYDSKEDRIVAARDPIGITTL 144
            ++DSK+  +   RD IG  +L
Sbjct: 138 TIFDSKKKLVYFGRDTIGKRSL 159

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA+E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDRDFLNLCMELDPNEKMIK 443
            R PFLD   +    EL  N K+ K
Sbjct: 445 VRYPFLDEKVVQFSTELPINYKVNK 469

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 25/127 (19%)

Query: 69  YTLCVNGEIYNH-IQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPK---KLDGMFAWCL 124
           + L  NGE+YN  IQ             +D   I  L  +Y  D PK   +++G FA+ +
Sbjct: 91  FVLQYNGELYNSSIQH------------NDTLFIASLIERYQDDIPKAIREMEGEFAYTI 138

Query: 125 YDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCL---IDDCDEIVAFPPGHVY 181
           +D + +++   RD IG  +L     S++ K   F S +       +DC+    +    +Y
Sbjct: 139 FDKQCEKLYFGRDTIGKRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IY 192

Query: 182 DSKSDQI 188
           DSK+  +
Sbjct: 193 DSKTGNL 199

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S  E + E   ++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLAN-KSPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDRDFLNLCMELDP-NEKMIKPEEGRIEKYILRKAFDTTDEP 464
           FLD D +    E  P N K+ K    R+  + L      +DEP
Sbjct: 449 FLDHDVIKFSTEEIPINYKVNKMILRRLASHQLSLGL-ISDEP 490

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 96/225 (42%), Gaps = 47/225 (20%)

Query: 27  IRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQPIKS---PCGN-YTLCVNGEIYNH-I 81
           I+ RGPD+S   V +     H       + S  +P  S     GN + L  NGE+YN  I
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQEI 102

Query: 82  QLREECSDYPFQSLSD-----CEPIIPLYLKYGLDAPKKLDGMFAWCLYDSKEDRIVAAR 136
              +  + +    L +     C+ I            ++L G FA+ LYD ++ +    R
Sbjct: 103 TAHDNDTQFIVSKLQEGYHDVCQII------------RQLSGEFAYTLYDLQQRKFYYGR 150

Query: 137 DPIGITTLYMGKSSKSPKTRFFASELKCLI---DDCDEIVAFPPGHVYDSKSDQI----- 188
           D +G  +L    S+ + +   + S +   I    DC   V +    VYD++S  +     
Sbjct: 151 DNVGKRSLSYHLSAITGE--LYISSVSGAIPGFKDCIAGVVY----VYDTESKTLDDSIK 204

Query: 189 --TRYFNPQWLDESYMPSTPLDYKV--LRHSLEKSVRKRLMAEVP 229
             ++YF  + LDE     T LD  V  L   L  +VRKR+++  P
Sbjct: 205 LESQYFITKKLDEEL---TCLDSTVEQLYGMLSLAVRKRVLSIHP 246

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 355 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTM 413
           KI  Q   +VL SG G+DE++GGY  FA   S  + Q E   ++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 414 AWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILR 455
           + G+E R PFLD   +    E         P   +I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFSTE-------DLPINYKINKLILR 473

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 28/145 (19%)

Query: 67  GNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYD 126
           G Y L  NGE+YN  ++    + Y    L+  E  IP       D   +LDG FA+ +YD
Sbjct: 87  GRYVLQFNGELYND-EIEFNDTQYIADMLARGEASIP-------DIIARLDGEFAYTIYD 138

Query: 127 SKEDRIVAARDPIGITTL--YMGKSSKSPKTRFFASELKCLIDDC---DEIVAFPPGHVY 181
           +++ +    RD IG  +L  Y+  S    K + + S +   ++D    D I      ++Y
Sbjct: 139 TEDQKYYFGRDAIGKRSLSYYVNTS----KDQLYVSSVTGRVEDIEFRDCIAGII--YIY 192

Query: 182 DSKSDQITRYFNPQWLDESYMPSTP 206
           D+K+         Q LD+S   S P
Sbjct: 193 DAKN---------QHLDDSNHISDP 208

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   + +E   E  +++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDRDFLNLCMELDPNEKMIK 443
           +E R PFLD   +    +L  N K+ K
Sbjct: 442 VEVRYPFLDDRVIEFSTQLPINYKVNK 468

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 56/137 (40%), Gaps = 23/137 (16%)

Query: 18  PHALQLS------KRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQPIKSPC----G 67
           PH  QL         I  RGP+++   +K+S       +    + S  +P+   C     
Sbjct: 34  PHTRQLGFLQTLIPHIVDRGPNYAS--LKSSA--TDAAVWFTSILSLREPLTKQCIDIND 89

Query: 68  NYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDS 127
            + L  NGEIYN   +    + Y    LS  + + P  ++       KL G FA+ +YD 
Sbjct: 90  RFVLQYNGEIYNS-SIAHNDTQYIATELSIVQNV-PTVIR-------KLSGEFAYTVYDR 140

Query: 128 KEDRIVAARDPIGITTL 144
               I   RD +G  +L
Sbjct: 141 ATGEIFFGRDGVGKRSL 157

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S +E   E   ++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRK 456
           FLD + +   +   P          ++ K ILRK
Sbjct: 450 FLDEEVIQYSVSQIPISY-------KVNKGILRK 476

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 74/171 (43%), Gaps = 26/171 (15%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDSK 128
           Y L  NGE+YN  ++    + Y    L  C+  +       +   +KLDG FA+ +YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLK 143

Query: 129 EDRIVAARDPIGITTLYMGKSSKSPKTRFFASEL---KCLIDDCDEIVAFPPGHVYDSKS 185
           E  I   RD IG  +L       S +   F S +   +    DC   V +     YD+K+
Sbjct: 144 EGNIYFGRDTIGKRSLCYSIDENSGE--LFISSVTGTRGTFVDCLGGVIY----TYDTKT 197

Query: 186 DQI-------TRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVP 229
             +        +Y      DE    S  ++  +L  +L +SV+KR+++  P
Sbjct: 198 HTLDDTKVIRDKYVVTDMTDELENESQYME--LLYGTLYESVKKRVLSIHP 246

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 11/106 (10%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E   ++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDRDFLNL-CMELDPNEKMIKPEEGRIEKYILRK 456
               G+E R PFLD + +    ME+  N K        + K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINYK--------VNKMILRK 475

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDSK 128
           Y L  NGE+YNH ++    + Y    L +  P IP  +K       KL+G FA+ +YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAIIK-------KLNGEFAYSIYDIQ 141

Query: 129 EDRIVAARDPIGITTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 102/431 (23%), Positives = 164/431 (38%), Gaps = 82/431 (19%)

Query: 69  YTLCVNGEIYN-HIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDS 127
           Y L  NGE+YN  +      S Y    L D E    +     +D  K L+G +A+ +YD 
Sbjct: 89  YYLQFNGELYNKEVSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDV 143

Query: 128 KEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHVYDSKSDQ 187
           K  +    RDPIG  +L     S +     + + +   ++   + +    G VY+  + Q
Sbjct: 144 KSAKFYFGRDPIGRRSL---SYSVTANNELYVASVTGAVECFHDCIG---GTVYEYDT-Q 196

Query: 188 ITRYFNPQWLDESYMPSTPLD-------------YKVLRHSLEKSVRKRLMAEVPYXXXX 234
                + Q L   Y  +  LD             Y VLR S++K +     A +      
Sbjct: 197 TKSLHDNQRLRPPYEVTPKLDMEFVSLSIVSKNLYSVLRESVKKRIESIHPAHIENSPIA 256

Query: 235 XXXXXXXXIASIAARETERANEELDPVNYDSEEKHLAGIDAQ-GNLHTGGWSRLHSFAIG 293
                    + IAA   E   E     +Y   +  +  ++    N  TG           
Sbjct: 257 VLFSGGIDCSVIAALVCEVLQEN----SYKCGKPTIELLNVSFENPRTG----------L 302

Query: 294 LPG-APDLLAARKVAKFIGSLHHEHTFTLQEGLD-----------ALDDVIYHLETYDVT 341
           LP   PD   +   A+ I  L+ E    L E +D           ++ D++Y  +T    
Sbjct: 303 LPSDTPDRKLSINSARIIQKLYPEIDIKLVE-IDVPYEEYLKFRPSVIDLMYSKQTE--M 359

Query: 342 TIRASTPMFLLSRK-------------IKAQGVKMVLSGEGSDEIFGGYLYFA-QAPSAK 387
            +  +   F  SR               +  G+ ++ SG G+DE++GGY  FA +AP   
Sbjct: 360 DLSIAIAFFFASRGKGFLTLPHGERKPYQRHGIVLL-SGLGADELYGGYHKFANKAP--H 416

Query: 388 EFQAECASRVKNLHLADCLRANKSTMAWGLEARVPFLDRDFLNL-CMELDPNEKMIKPEE 446
           E   E   ++ N++  +  R +K     G+E R PFLD   +    +E+  N K      
Sbjct: 417 ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRYPFLDEYVIKFSTVEIPINYK------ 470

Query: 447 GRIEKYILRKA 457
             + K ILRK 
Sbjct: 471 --VNKLILRKV 479

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E   ++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKA 457
            R PFLD   +           +  P   +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-------VDIPINFKINKLILRNV 479

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 20/109 (18%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPF-----QSLSDCEPIIPLYLKYGLDAPKKLDGMFAWC 123
           Y L  NGE+YN  ++ ++ +D  +     Q+L+    +I        D  + L+G +A+ 
Sbjct: 89  YYLQFNGELYNK-EISDDDNDSQYIASLLQNLTGDGDVI--------DVIRMLEGEYAYT 139

Query: 124 LYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLID---DC 169
           +YD K  +    RDPIG  +L     S +P    + +     I+   DC
Sbjct: 140 VYDVKASKFYFGRDPIGRRSL---SYSVTPNNELYVASATGAIEGFQDC 185

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E   ++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDRDFLNLCM-ELDPNEKMIKPEEGRIEKYILRKA 457
           FLD   + L   E+        P   ++ K ILRK 
Sbjct: 452 FLDEYVIKLSTAEI--------PINFKVNKLILRKV 479

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYG-LDAPKKLDGMFAWCLYDS 127
           Y L  NGE+YN     +E S     SL     +  L    G +D  K L+G +A+ +YD 
Sbjct: 89  YFLQFNGELYN-----KEISQGDNDSLYIASMLQNLKEGMGVIDVIKSLEGEYAYTIYDV 143

Query: 128 KEDRIVAARDPIGITTL 144
              ++   RDPIG  +L
Sbjct: 144 NSSKLYFGRDPIGRRSL 160

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 20/100 (20%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    + +E   E   ++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDRDFLNLCMELDPNEKMIK------PEEGRIEKYILRK 456
           FLD             E +IK      P   +I K ILRK
Sbjct: 451 FLD-------------EHVIKYSTHDIPINYKINKLILRK 477

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 111/274 (40%), Gaps = 70/274 (25%)

Query: 1   MCGIFA--------AFRHTDVQEYR---PHAL----------QLSKRIRHRGPDWSGNVV 39
           MCGI           F   + +E++   P AL           L K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASL-- 58

Query: 40  KNSTILVHERLAIVGLESGSQPIKSP-CGN-------YTLCVNGEIYNHIQLREECSDYP 91
              T+  H     + L S    ++ P C         Y L  NGE+YN   +        
Sbjct: 59  --RTLKDHR----ISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYNDEIIH------- 105

Query: 92  FQSLSDCEPIIPLYL------KYGLDAPKKLDGMFAWCLYDSKEDRIVAARDPIGITTL- 144
               +D + I+ L L      K  +   K LDG FA+ +YD K  R+   RDPIG  +L 
Sbjct: 106 ----NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSLC 161

Query: 145 YMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHVYDS--KSDQITRYFNPQWLDESYM 202
           Y    +        +  +K    +CD  V +     YD+  K+  +T  FN  + D +  
Sbjct: 162 YYLTDANELYVSSVSGSIKGF-KNCDAGVIYE----YDATNKNSPLT-IFNNIFEDFTIN 215

Query: 203 PSTPLDYKVLRHSLEK-------SVRKRLMAEVP 229
             + L++K L+  +E+       +VRKR+++  P
Sbjct: 216 DKSDLEFKSLQKHIEELYKVLYNAVRKRVLSIHP 249

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  + +E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKA 457
           FLD   +    +L  N K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 69  YTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMFAWCLYDSK 128
           + L  NGEIYN   +    + Y  + L + + I  +         + L G FA+ +YD  
Sbjct: 91  FVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RTLSGEFAYTIYDKL 141

Query: 129 EDRIVAARDPIGITTL 144
              +   RDPIG  +L
Sbjct: 142 TGEVFFGRDPIGRRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKS 411
           + ++ K +G+ ++ SG G+DE++GGY Y        E   E  +++ N++  +  R +K 
Sbjct: 382 VRKEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKV 439

Query: 412 TMAWGLEARVPFL 424
             + G+E R PFL
Sbjct: 440 IASNGVEVRYPFL 452

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 33.5 bits (75), Expect = 0.21,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 16/90 (17%)

Query: 102 IPLYLKYGLDAPKKLDGMFAWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASE 161
           +P YL+  +DAPK L+ MFA+     ++              ++ G S    +T FF   
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRT-FFQVS 51

Query: 162 LKCLI-------DDCDEIVAFPPGHVYDSK 184
             CL+         CD   +F PG V+DS+
Sbjct: 52  KDCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Suva_11.336 Chr11 (620693..622837) [2145 bp, 714 aa] {ON} YKR099W
           (REAL)
          Length = 714

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 113 PKKLDGMFAWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEI 172
           PK  DG  A  L DS++  +   +D      + M + S+ P T    S++   I+    I
Sbjct: 292 PKLKDGNDADSLSDSRQQLLPPLKDISVPPPIRMMQVSQ-PHTSSSRSKIPLPIEGLSPI 350

Query: 173 VAFPPGHVYDSKSDQITRYFNPQWLDESYMPST 205
               PG + DS    +   FNP  LDE  M +T
Sbjct: 351 NKHSPGGIPDSPQATLPPTFNPASLDEHMMNNT 383

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,920,175
Number of extensions: 2693749
Number of successful extensions: 5786
Number of sequences better than 10.0: 50
Number of HSP's gapped: 5826
Number of HSP's successfully gapped: 66
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)