Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B02002g2.533ON29429413210.0
TDEL0A030702.533ON2391084085e-48
NCAS0A048002.533ON5111123794e-41
TBLA0G022302.533ON2161043465e-39
Kpol_1018.332.533ON5891253604e-38
NDAI0K018602.533ON7301363555e-37
KNAG0C058102.533ON5541193481e-36
Smik_13.2492.533ON4731353425e-36
KAFR0A018602.533ON4901083355e-35
YMR070W (MOT3)2.533ON4901443312e-34
Skud_13.2262.533ON4751473302e-34
CAGL0K03003g2.533ON6471253166e-32
NCAS0F009002.533ON5251323112e-31
NDAI0H014002.533ON5411463051e-30
SAKL0A09482g2.533ON3881272982e-30
KLTH0D06842g2.533ON5061072952e-29
Kwal_26.80212.533ON5071182934e-29
Suva_13.2462.533ON419652834e-28
TPHA0G035102.533ON3871282815e-28
TBLA0I014802.533ON513652662e-25
AGL071C2.533ON3961302614e-25
KLLA0E18547g2.533ON4311242615e-25
Ecym_72552.533ON5441352592e-24
KNAG0A070402.533ON3521002533e-24
KAFR0J003402.533ON218962445e-24
TPHA0C041902.533ON417521883e-15
NCAS0A129102.598ON822481415e-09
NDAI0C005602.598ON972561406e-09
Suva_11.1642.598ON639561398e-09
Kpol_185.32.598ON647561381e-08
TBLA0H028302.598ON746481353e-08
Smik_11.1862.598ON641561353e-08
YKL062W (MSN4)2.598ON630561343e-08
CAGL0M13189g2.598ON541481344e-08
ZYRO0F01012g2.598ON584561334e-08
KNAG0G012808.144ON472581334e-08
Skud_11.1672.598ON628561335e-08
KLLA0F26961g2.598ON694481326e-08
SAKL0B11330g2.598ON499561318e-08
NDAI0B013402.598ON769481318e-08
Suva_13.2062.598ON709481318e-08
KLLA0F20636gsingletonON285581299e-08
NCAS0H030802.598ON730561311e-07
KNAG0H005502.598ON620561301e-07
KNAG0M023102.598ON660561291e-07
ZYRO0G19140g8.144ON557581291e-07
Kpol_1013.212.598ON494561282e-07
Skud_13.1932.598ON704481292e-07
Kwal_26.83512.598ON698561282e-07
YMR037C (MSN2)2.598ON704481282e-07
Smik_13.2072.598ON703481282e-07
TPHA0N014602.598ON519561282e-07
KLTH0D08734g2.598ON677561282e-07
TDEL0B069102.598ON437561272e-07
KAFR0F020702.598ON370561272e-07
SAKL0H24816g8.144ON410541263e-07
KAFR0A023202.598ON443551263e-07
TBLA0G019202.598ON523561263e-07
KNAG0M003504.351ON1076971264e-07
ABR089C2.598ON571481254e-07
CAGL0F05995g2.598ON597481246e-07
Ecym_23012.598ON767481247e-07
TPHA0C025802.598ON365481229e-07
Skud_13.3486.256ON216771199e-07
CAGL0M00594g4.351ON1020591231e-06
KLLA0C17072g8.144ON474481221e-06
TBLA0F003708.144ON687491211e-06
KLTH0E06688g8.144ON397531202e-06
Kwal_47.172418.144ON403531183e-06
NCAS0G012706.256ON274951164e-06
CAGL0L06072g8.144ON300481164e-06
YMR182C (RGM1)6.256ON211811144e-06
Smik_13.3876.256ON212581144e-06
Suva_13.3636.256ON211581135e-06
Ecym_4128na 1ON312591155e-06
Ecym_84038.144ON573481165e-06
TDEL0B046708.144ON312481155e-06
ACL057W8.144ON520481166e-06
SAKL0F01980g3.518ON385861156e-06
Kpol_1031.428.144ON359481147e-06
KAFR0B063608.425ON627671158e-06
CAGL0K02145g8.144ON317481131e-05
AGR186Cna 1ON287521121e-05
NCAS0F009202.531ON354511121e-05
KLLA0B04477g4.351ON1332511131e-05
KAFR0E042704.351ON1255731132e-05
CAGL0H04213g4.351ON1321981132e-05
KAFR0B025508.234ON890561132e-05
Skud_5.2488.144ON442481122e-05
Smik_5.2768.144ON442481122e-05
YER130C8.144ON443481122e-05
Suva_5.2518.144ON449481122e-05
NCAS0A062504.351ON1341751122e-05
NCAS0F00910singletonON350511103e-05
SAKL0A10582gsingletonON288701093e-05
TPHA0B003804.351ON1310921113e-05
CAGL0L05786g8.116ON348571093e-05
SAKL0G18062g4.351ON1238511113e-05
Kpol_529.138.425ON1410711104e-05
ZYRO0B11770g8.234ON867741104e-05
YPL230W (USV1)6.256ON391471094e-05
AER159C4.351ON1191511104e-05
TDEL0D006704.351ON1199561094e-05
TDEL0A013008.234ON837561094e-05
NCAS0B046008.144ON547481085e-05
KAFR0B021608.144ON453481085e-05
TDEL0F026904.80ON350521085e-05
TBLA0E039308.116ON462661085e-05
NCAS0C040708.144ON289621076e-05
Smik_6.4356.256ON386471076e-05
Suva_16.766.256ON392521077e-05
Skud_16.486.256ON398471077e-05
TPHA0C021608.425ON1375651087e-05
Kpol_1026.84.80ON412521069e-05
KLTH0H09196g4.80ON460851061e-04
Kpol_1001.14.351ON1341771061e-04
CAGL0E06116g6.256ON613511061e-04
NCAS0B028408.425ON1152591061e-04
TPHA0A04530singletonON501521051e-04
Kwal_26.80112.531ON190511021e-04
NDAI0C048608.425ON1350731061e-04
KNAG0H011803.281ON254651031e-04
TPHA0A019408.234ON912561052e-04
Kpol_1023.1004.351ON916511052e-04
NCAS0A018204.80ON455521042e-04
KAFR0B068104.351ON1155751052e-04
Ecym_8379na 2ON305571032e-04
TBLA0H006608.425ON1311511042e-04
KAFR0F036004.80ON335521022e-04
NDAI0G034208.144ON484581032e-04
NDAI0D037504.80ON493521032e-04
KAFR0A067205.586ON235881012e-04
Skud_10.3514.351ON1327551042e-04
CAGL0A01628g4.80ON424521032e-04
KAFR0C031408.117ON370531022e-04
TBLA0A089104.80ON390521032e-04
ZYRO0C13508g3.281ON189681002e-04
TBLA0F038308.234ON967561032e-04
TBLA0I027004.214ON737791032e-04
TPHA0D010508.144ON439481032e-04
TDEL0F011708.116ON16264983e-04
Suva_12.2184.351ON1270551033e-04
TBLA0E028205.586ON312681023e-04
KAFR0F012106.256ON311571013e-04
Kpol_1052.83.298ON386501023e-04
KLLA0F13046g8.425ON1379881033e-04
Ecym_1475na 3ON349751023e-04
Kpol_1032.528.234ON824561033e-04
ADR308Cna 4ON278711013e-04
SAKL0D15136gsingletonON271521013e-04
Smik_10.4204.351ON1348551033e-04
Smik_4.4638.425ON1324661033e-04
YJR127C (RSF2)4.351ON1380551033e-04
TBLA0E047704.351ON1655471033e-04
KNAG0B067104.351ON1053931023e-04
KNAG0D037104.80ON459521023e-04
NDAI0I009906.256ON409491013e-04
Ecym_35208.234ON819551023e-04
KNAG0H030108.234ON784551024e-04
ZYRO0B14894g4.351ON1119671024e-04
NCAS0I014603.298ON330541014e-04
NDAI0B022508.234ON1156561024e-04
Kpol_472.104.214ON830591024e-04
NDAI0J028504.351ON1537791024e-04
TPHA0G002707.543ON472351014e-04
AGR117C8.234ON799551014e-04
KAFR0C003403.298ON394591004e-04
NCAS0C042308.117ON338531004e-04
Kwal_47.166214.351ON1178521014e-04
TBLA0E04210singletonON454531014e-04
KLTH0D18062g4.351ON1128521015e-04
Ecym_14154.80ON504521005e-04
ADL042Wna 2ON28155995e-04
KNAG0G011408.117ON519531005e-04
CAGL0J01595g8.117ON344531005e-04
TBLA0B061604.351ON1384531015e-04
NCAS0B046708.116ON26666995e-04
Skud_13.614.351ON1253731015e-04
NDAI0C06260na 5ON582531005e-04
ZYRO0A09416g8.425ON1346601015e-04
NCAS0B045008.130ON1207641015e-04
Kwal_27.114602.303ON531541005e-04
TDEL0F055008.425ON1207661016e-04
Ecym_1383na 6ON38163996e-04
SAKL0H20416g8.116ON31753996e-04
TBLA0A016058.486ON22470976e-04
AEL077Wna 6ON33658996e-04
KNAG0G018708.234ON875551006e-04
YDR216W (ADR1)8.425ON1323661007e-04
KNAG0D021208.144ON40248997e-04
KLTH0G10802g2.303ON52650997e-04
Suva_2.3838.425ON1319661007e-04
SAKL0E10714g2.162ON81972998e-04
SAKL0H12958g8.425ON112954998e-04
Kpol_1018.352.531ON51754998e-04
NDAI0A074703.281ON26352978e-04
TBLA0B060502.303ON76261998e-04
YML081W (TDA9)4.351ON125173999e-04
Smik_13.584.351ON125377990.001
YPR013C8.116ON31753970.001
TBLA0E042208.234ON51953980.001
Suva_7.2404.80ON51552980.001
Ecym_21596.256ON46047980.001
ACR264W2.162ON76953980.001
Suva_13.704.351ON77755980.001
KAFR0B020008.117ON30365960.001
ZYRO0B07568g4.214ON616106980.001
KAFR0B019908.116ON41061970.001
SAKL0H17842g8.234ON81455980.001
CAGL0M01870g3.298ON31551960.001
SAKL0E07216g2.303ON54850970.001
Kpol_1003.502.303ON61450970.001
KNAG0H019302.303ON61856970.001
Smik_16.2538.116ON31756960.001
Suva_16.3388.117ON24760950.001
KLTH0G01826g3.518ON30749960.001
Suva_16.3358.116ON31753960.001
SAKL0H04070g4.214ON89963970.001
TBLA0I032803.518ON33050960.001
AGR172W8.425ON105766970.001
KNAG0C060305.586ON31466960.001
Skud_16.2988.116ON31753960.001
KNAG0D022908.116ON43549960.002
Ecym_27604.214ON938101970.002
KLTH0G14454g8.234ON83255970.002
AFR531Wna 3ON27477950.002
Kwal_47.190453.518ON26649950.002
NDAI0B019308.144ON43648960.002
SAKL0H20988g4.80ON54852960.002
Kwal_47.178882.162ON78672970.002
Skud_4.4788.425ON132366970.002
AGL207W3.298ON27752950.002
Kwal_56.234538.234ON82855970.002
ZYRO0E02684g8.116ON13353910.002
Kpol_1072.582.162ON79453960.002
Smik_4.3378.234ON89455960.002
YDR096W (GIS1)8.234ON89455960.002
Smik_7.2514.80ON50552960.002
NCAS0B048408.234ON86455960.002
CAGL0E04884g8.425ON148954960.002
Kpol_1050.193.518ON22155940.002
Ecym_26733.298ON30152950.002
KLTH0E09724g2.162ON76872960.002
TDEL0F010308.130ON107759960.002
TPHA0D034003.518ON33851950.002
SAKL0B05434gna 3ON344102950.002
KNAG0A044608.425ON129065960.002
CAGL0G08107g8.234ON62557960.002
YGL035C (MIG1)4.80ON50452950.002
SAKL0A10648gsingletonON26181940.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B02002g
         (294 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   513   0.0  
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   161   5e-48
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   150   4e-41
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   137   5e-39
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   143   4e-38
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   141   5e-37
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   138   1e-36
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   136   5e-36
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   133   5e-35
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   132   2e-34
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   131   2e-34
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   126   6e-32
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   124   2e-31
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   122   1e-30
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   119   2e-30
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   118   2e-29
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   117   4e-29
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   113   4e-28
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   112   5e-28
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   107   2e-25
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   105   4e-25
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   105   5e-25
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   104   2e-24
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...   102   3e-24
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       99   5e-24
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    77   3e-15
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    59   5e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     59   6e-09
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    58   8e-09
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    58   1e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    57   3e-08
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    57   3e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    56   3e-08
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    56   4e-08
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    56   4e-08
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    56   4e-08
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    56   5e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    55   6e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    55   8e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     55   8e-08
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    55   8e-08
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    54   9e-08
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    55   1e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    55   1e-07
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    54   1e-07
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    54   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    54   2e-07
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    54   2e-07
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    54   2e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    54   2e-07
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    54   2e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    54   2e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    54   2e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    54   2e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    54   2e-07
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    53   3e-07
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    53   3e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    53   3e-07
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    53   4e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    53   4e-07
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    52   6e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    52   7e-07
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    52   9e-07
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    50   9e-07
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    52   1e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    52   1e-06
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    51   1e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    51   2e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    50   3e-06
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      49   4e-06
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    49   4e-06
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    49   4e-06
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    49   4e-06
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    48   5e-06
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    49   5e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    49   5e-06
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    49   5e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    49   6e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    49   6e-06
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   7e-06
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    49   8e-06
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    48   1e-05
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    48   1e-05
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     48   1e-05
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    48   1e-05
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    48   2e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    48   2e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    48   2e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    48   2e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    48   2e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    48   2e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    48   2e-05
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    48   2e-05
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               47   3e-05
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    47   3e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    47   3e-05
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    47   3e-05
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    47   3e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    47   4e-05
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    47   4e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   4e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    47   4e-05
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    47   4e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    47   4e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    46   5e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    46   5e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    46   5e-05
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    46   5e-05
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      46   6e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    46   6e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    46   7e-05
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    46   7e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    46   7e-05
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    45   9e-05
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    45   1e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    45   1e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    45   1e-04
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    45   1e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             45   1e-04
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    44   1e-04
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    45   1e-04
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    44   1e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    45   2e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    45   2e-04
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      45   2e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    45   2e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    44   2e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    45   2e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    44   2e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    44   2e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      44   2e-04
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    44   2e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    45   2e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    44   2e-04
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               44   2e-04
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    44   2e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    43   2e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    44   2e-04
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    44   2e-04
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    44   2e-04
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    42   3e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    44   3e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    44   3e-04
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    44   3e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    44   3e-04
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    44   3e-04
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    44   3e-04
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    44   3e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    44   3e-04
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    44   3e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    44   3e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    44   3e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    44   3e-04
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    44   3e-04
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    44   3e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    44   3e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    44   3e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    44   3e-04
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    44   4e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    44   4e-04
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    44   4e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    44   4e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    44   4e-04
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    44   4e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    44   4e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    44   4e-04
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    43   4e-04
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               43   4e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    44   4e-04
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             44   4e-04
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    44   5e-04
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    43   5e-04
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    43   5e-04
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    43   5e-04
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    43   5e-04
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    44   5e-04
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                43   5e-04
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    44   5e-04
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             43   5e-04
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    44   5e-04
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    44   5e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    43   5e-04
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    44   6e-04
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    43   6e-04
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    43   6e-04
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                42   6e-04
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    43   6e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    43   6e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    43   7e-04
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    43   7e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    43   7e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    43   7e-04
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    43   8e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    43   8e-04
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    43   8e-04
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    42   8e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    43   8e-04
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    43   9e-04
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    43   0.001
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    42   0.001
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    42   0.001
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    42   0.001
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    42   0.001
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    42   0.001
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    42   0.001
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    42   0.001
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    42   0.001
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    42   0.001
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    42   0.001
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    42   0.001
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    42   0.001
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    42   0.001
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    42   0.001
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    42   0.001
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    41   0.001
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    42   0.001
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    42   0.001
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    42   0.001
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    42   0.001
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    42   0.001
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    42   0.001
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    42   0.001
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    42   0.002
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    42   0.002
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    42   0.002
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    41   0.002
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    41   0.002
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     42   0.002
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    42   0.002
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    42   0.002
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    42   0.002
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    41   0.002
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    42   0.002
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    40   0.002
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    42   0.002
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    42   0.002
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    42   0.002
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    42   0.002
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     42   0.002
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    42   0.002
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    41   0.002
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    41   0.002
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    42   0.002
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    42   0.002
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    41   0.002
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    41   0.002
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    42   0.002
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    42   0.002
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    41   0.002
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    41   0.002
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    41   0.002
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    41   0.002
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    40   0.002
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    41   0.002
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    41   0.002
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    41   0.002
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    40   0.002
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    41   0.002
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    40   0.002
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      40   0.002
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    41   0.002
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    41   0.002
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    41   0.003
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               41   0.003
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    40   0.003
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    41   0.003
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    41   0.003
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    40   0.003
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    40   0.003
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    40   0.003
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    41   0.003
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    41   0.003
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    40   0.003
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    40   0.003
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    41   0.003
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    41   0.003
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    40   0.003
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    41   0.003
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    40   0.003
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     40   0.003
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    40   0.003
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                40   0.003
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    40   0.003
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    40   0.004
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    40   0.004
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    41   0.004
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    41   0.004
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    41   0.004
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    40   0.004
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    40   0.004
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     40   0.004
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       38   0.004
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    40   0.004
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    40   0.004
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    40   0.004
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    40   0.005
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    40   0.005
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    40   0.005
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    40   0.005
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    40   0.005
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    40   0.005
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    40   0.005
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    40   0.005
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    39   0.005
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    38   0.005
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    39   0.006
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    40   0.006
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    40   0.006
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    40   0.006
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    40   0.006
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    39   0.006
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    40   0.006
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    40   0.007
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    40   0.007
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    40   0.007
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    40   0.007
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    40   0.007
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    40   0.007
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    38   0.007
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    40   0.007
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    40   0.007
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    40   0.007
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    40   0.007
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    39   0.008
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     40   0.008
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      39   0.008
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    40   0.008
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    40   0.008
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    40   0.008
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    40   0.008
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    40   0.008
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    39   0.008
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    40   0.009
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    40   0.009
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    39   0.009
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    39   0.009
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    39   0.009
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    39   0.009
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    39   0.009
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    39   0.009
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    39   0.010
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    39   0.010
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    39   0.010
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    39   0.010
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     39   0.010
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    39   0.010
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.010
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    39   0.011
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    39   0.011
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    39   0.011
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    39   0.011
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    39   0.012
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    39   0.012
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    39   0.012
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    39   0.013
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    38   0.013
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    39   0.013
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    39   0.014
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    39   0.014
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    39   0.014
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    39   0.014
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    39   0.014
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    39   0.015
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    39   0.015
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    38   0.015
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    39   0.015
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    38   0.015
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    37   0.015
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    39   0.015
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    39   0.016
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    38   0.016
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    39   0.016
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    39   0.016
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    39   0.016
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    39   0.016
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    38   0.016
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    39   0.016
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    39   0.016
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                38   0.017
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    39   0.017
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    38   0.017
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    39   0.018
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    38   0.018
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    39   0.019
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    38   0.019
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    39   0.019
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    38   0.020
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    39   0.020
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    38   0.020
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      38   0.022
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    38   0.023
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    38   0.023
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    38   0.024
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    37   0.024
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    38   0.024
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    38   0.024
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    38   0.025
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    38   0.025
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     38   0.025
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    38   0.026
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    37   0.026
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    38   0.026
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    38   0.027
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    38   0.027
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    37   0.028
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    37   0.029
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    37   0.030
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    37   0.030
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    37   0.030
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    38   0.030
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    37   0.032
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    35   0.032
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    38   0.033
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    37   0.033
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    38   0.034
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               37   0.034
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    37   0.034
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    37   0.036
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    38   0.036
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    37   0.036
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    38   0.036
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    37   0.038
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.038
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    37   0.041
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    37   0.042
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    37   0.042
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    37   0.042
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    37   0.042
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    36   0.043
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    37   0.043
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    37   0.044
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    37   0.045
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    37   0.045
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    37   0.046
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    37   0.049
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    37   0.050
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    37   0.050
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    36   0.054
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    37   0.054
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    37   0.057
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    37   0.058
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    37   0.058
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    37   0.059
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    36   0.060
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    37   0.060
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    37   0.062
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    37   0.064
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    37   0.064
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     37   0.064
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    37   0.065
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    36   0.066
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    37   0.068
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    36   0.068
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    36   0.069
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    37   0.070
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    36   0.071
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    36   0.072
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    36   0.074
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    37   0.074
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    37   0.074
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    37   0.074
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    37   0.076
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    37   0.076
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    37   0.076
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.077
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    36   0.079
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    36   0.083
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    36   0.088
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    36   0.092
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    36   0.094
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    36   0.097
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    36   0.097
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    36   0.11 
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                35   0.11 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    36   0.11 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    35   0.11 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    36   0.12 
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    36   0.12 
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    36   0.12 
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    36   0.13 
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    36   0.14 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    35   0.14 
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    36   0.15 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    35   0.16 
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    35   0.16 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    35   0.16 
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    35   0.17 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    35   0.18 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    35   0.18 
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    35   0.19 
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    35   0.21 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    35   0.22 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    35   0.23 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    35   0.25 
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    34   0.26 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.26 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    35   0.28 
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    34   0.28 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    34   0.29 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    35   0.30 
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    35   0.30 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    34   0.30 
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               34   0.31 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    35   0.33 
Suva_13.247 Chr13 (391743..391805) [63 bp, 21 aa] {OFF} YMR070W ...    30   0.34 
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    35   0.34 
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    34   0.40 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    34   0.40 
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    34   0.40 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    34   0.42 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      34   0.42 
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    34   0.43 
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    34   0.45 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    34   0.45 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    34   0.47 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    34   0.48 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    33   0.50 
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    34   0.50 
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    34   0.52 
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    33   0.54 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    34   0.55 
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    33   0.57 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    33   0.58 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    33   0.59 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    33   0.62 
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    33   0.63 
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    33   0.64 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    33   0.64 
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    33   0.71 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    32   0.73 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    33   0.75 
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    33   0.82 
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    33   0.84 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    32   0.87 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    32   0.91 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    32   0.96 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    32   0.99 
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    33   1.0  
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    32   1.0  
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    32   1.0  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    32   1.1  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    33   1.1  
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     33   1.2  
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    33   1.2  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    32   1.2  
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    32   1.2  
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    33   1.3  
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    32   1.3  
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    32   1.3  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 32   1.4  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    32   1.5  
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    32   1.5  
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    32   1.5  
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    32   1.5  
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    32   1.6  
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    32   1.6  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    32   1.6  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      32   1.8  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    32   1.8  
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    31   2.0  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    32   2.1  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    32   2.2  
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    32   2.4  
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    31   2.5  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    32   2.5  
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    32   2.9  
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    32   3.0  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    31   3.3  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    31   3.3  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    31   3.4  
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    31   3.5  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    31   3.8  
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    31   4.3  
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    30   4.4  
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    31   4.4  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    31   4.7  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    30   5.1  
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    30   5.7  
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    30   5.8  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    30   5.9  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    30   7.2  
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      30   7.6  
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    30   7.8  
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    30   9.1  
Suva_8.125 Chr8 complement(226677..228902) [2226 bp, 741 aa] {ON...    30   9.2  

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/294 (85%), Positives = 252/294 (85%)

Query: 1   MDIYESERLPLPQPLYYRNPXXXXXXXXXXXMPGELPTMNWKIPSITRQNHQHNHAPIIT 60
           MDIYESERLPLPQPLYYRNP           MPGELPTMNWKIPSITRQNHQHNHAPIIT
Sbjct: 1   MDIYESERLPLPQPLYYRNPAAGAADAATRAMPGELPTMNWKIPSITRQNHQHNHAPIIT 60

Query: 61  RFPITPSGHQTPSAFTARSVVPPHATPMVQINSAFALPGDSAGGRNDRSNGTAATSNIPS 120
           RFPITPSGHQTPSAFTARSVVPPHATPMVQINSAFALPGDSAGGRNDRSNGTAATSNIPS
Sbjct: 61  RFPITPSGHQTPSAFTARSVVPPHATPMVQINSAFALPGDSAGGRNDRSNGTAATSNIPS 120

Query: 121 MMPTVAGTTAGHQGPSLPLPHXXXXXXXXXXXXXXXXXXXXRIAAVNATXXXXXXXXXXX 180
           MMPTVAGTTAGHQGPSLPLPH                    RIAAVNAT           
Sbjct: 121 MMPTVAGTTAGHQGPSLPLPHVAATMGQAGAGVMAASVGAMRIAAVNATQQQQAQQQQQQ 180

Query: 181 KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK
Sbjct: 181 KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240

Query: 241 LKHTEYVLEKLRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294
           LKHTEYVLEKLRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYNG
Sbjct: 241 LKHTEYVLEKLRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  161 bits (408), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 3/108 (2%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVL 248
           G  H C +C+KSFKRKSWL+RHLLSHSP RHF CPWCLSKHKRKDNLLQHMKLKHT+YVL
Sbjct: 131 GYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVL 190

Query: 249 EKLRNQNVGI--DGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294
           ++LR  NV +  +G  +N NIRTLL EGRLNK++VKKVLN LID +N 
Sbjct: 191 QELRLNNVYVSTEGSCKN-NIRTLLYEGRLNKDEVKKVLNSLIDRHNN 237

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  150 bits (379), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 10/112 (8%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           + C MC KSF+R SWL+RHLL+HS +RH+ CP C+SKHKRKDNLLQH+KLKHT +VLE+L
Sbjct: 387 YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQL 446

Query: 252 RNQNVGI----------DGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSYN 293
           R  N+ I           G   N NI+TLL EGRLNKEDVKKVLN LIDS N
Sbjct: 447 RQDNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLIDSAN 498

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  137 bits (346), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (78%), Gaps = 4/104 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H CP C+K FKRKSWL+RH+LSHS ER + CPWC+S+HKRKDNLLQHMKLKHT+ VL+KL
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 252 RNQNV--GIDGE--VRNDNIRTLLCEGRLNKEDVKKVLNGLIDS 291
           +      G DGE  +  DNIRT+L EG L+K++VKKVLN L++ 
Sbjct: 173 KMTCYLEGDDGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELLEE 216

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  143 bits (360), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 84/125 (67%), Gaps = 15/125 (12%)

Query: 181 KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           K     L   +H+C +C K FKRKSWL+RHLLSHS ER+F CPWCLSKHKRKDNLLQHMK
Sbjct: 466 KTNASNLKNFAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMK 525

Query: 241 LKHTEYVLEKLRNQNVGIDGEVRND------------NIRTLLCEGRLNKEDVKKVLNGL 288
           LKH E VLE+LR   + +     ND            NIRTL+ EG LNK++VKK+LN L
Sbjct: 526 LKHAENVLEQLR---INLKANNPNDNSEPTLEGNGDHNIRTLMGEGILNKDEVKKLLNSL 582

Query: 289 IDSYN 293
           +  +N
Sbjct: 583 VAQHN 587

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  141 bits (355), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 86/136 (63%), Gaps = 35/136 (25%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C  C KSFKR SWL+RHLL+HSPERH+ CPWCLSKHKRKDNLLQH+KLKHTE VL++LR 
Sbjct: 562 CSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQLRL 621

Query: 254 QNVGI------------------------------DGEVRN-----DNIRTLLCEGRLNK 278
           +N+ I                              D +++N      NI+TLL +GRLNK
Sbjct: 622 ENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGRLNK 681

Query: 279 EDVKKVLNGLIDSYNG 294
           EDVKKVLN L+D  N 
Sbjct: 682 EDVKKVLNKLLDGTNS 697

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  138 bits (348), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (70%), Gaps = 17/119 (14%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C +C+KSFKR+SWL+RHLLSHS ERH+ CPWCLS+HKRKDNLLQHMKLKH+ Y+L++L
Sbjct: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495

Query: 252 RNQNVGI-----DGEVRND------------NIRTLLCEGRLNKEDVKKVLNGLIDSYN 293
           +N NV       DG+   D            +I+ LL  G LNK+DVK+VLN +I+  N
Sbjct: 496 KNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKIIERSN 554

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  136 bits (342), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 67/135 (49%), Positives = 83/135 (61%), Gaps = 33/135 (24%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 338 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 397

Query: 252 RNQNVGI---------------------------------DGEVRNDNIRTLLCEGRLNK 278
           +  N+                                   DG   + NI+TL+ +G LNK
Sbjct: 398 KKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLNK 457

Query: 279 EDVKKVLNGLIDSYN 293
           +DVK+VLN LI S+N
Sbjct: 458 DDVKRVLNNLIVSHN 472

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  133 bits (335), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 8/108 (7%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE 249
           L H C +C+KSF+RKSWL+RHLLSHS ER F CPWCLS+HKRKDNLLQHMKLKH+ Y++ 
Sbjct: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410

Query: 250 KLRNQNV---GIDGEVRN-----DNIRTLLCEGRLNKEDVKKVLNGLI 289
           +L+  N     ++G  R      D+IR L+  G +NK+DVKKV+N LI
Sbjct: 411 ELKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 83/144 (57%), Gaps = 42/144 (29%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 346 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 405

Query: 252 RNQNVGI------------------------------------------DGEVRNDNIRT 269
           +  N+                                            DG   + NI+T
Sbjct: 406 KKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKT 465

Query: 270 LLCEGRLNKEDVKKVLNGLIDSYN 293
           L+ +G LNK+DVK+VLN LI S+N
Sbjct: 466 LINDGVLNKDDVKRVLNNLIVSHN 489

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/147 (45%), Positives = 83/147 (56%), Gaps = 45/147 (30%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387

Query: 252 RNQNVGI---------------------------------------------DGEVRNDN 266
           +  N+                                               DG   + N
Sbjct: 388 KKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDPN 447

Query: 267 IRTLLCEGRLNKEDVKKVLNGLIDSYN 293
           I+TL+ +G LNK+DVK+VLN LI S+N
Sbjct: 448 IKTLINDGVLNKDDVKRVLNNLIVSHN 474

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  126 bits (316), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 13/125 (10%)

Query: 181 KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           K+++  L    H C +C K FKRKSWL+RHLLSHS +RHF CPWC S+HKR+DNLLQHMK
Sbjct: 524 KIEVSSL-AFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMK 582

Query: 241 LKHTEYVLEKLRNQNV------------GIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGL 288
           LKH   +L+++ ++N+             IDG +   + +TL+ EG LNK+++K +LN +
Sbjct: 583 LKHVPNLLQEINSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTV 642

Query: 289 IDSYN 293
           ID +N
Sbjct: 643 IDKHN 647

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  124 bits (311), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/132 (46%), Positives = 82/132 (62%), Gaps = 33/132 (25%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           ++C +C K+FKR+SWL+RHLLSHS ERH+ CPWCLS+HKR+DNLLQHMKLKH++ ++ +L
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447

Query: 252 RNQNVGID-----------------------------GEVRNDN----IRTLLCEGRLNK 278
           + +NV  D                              E  N N    IRTL+  G +NK
Sbjct: 448 KFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGVVNK 507

Query: 279 EDVKKVLNGLID 290
           EDVK+VLN L+D
Sbjct: 508 EDVKRVLNQLVD 519

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  122 bits (305), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 82/146 (56%), Gaps = 39/146 (26%)

Query: 187 LNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEY 246
           +   S+ C +C+K FKR+SWL+RHLLSHS ERH+ CPWCLS+HKR+DNLLQHMKLKH   
Sbjct: 395 IESQSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNN 454

Query: 247 VLE--KLRN---------------------------QNVGIDGEVRND----------NI 267
           ++   KLRN                            N  + G V N            I
Sbjct: 455 LINELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGITI 514

Query: 268 RTLLCEGRLNKEDVKKVLNGLIDSYN 293
           + L+ EG +NKEDVK++LN LID YN
Sbjct: 515 KDLISEGLINKEDVKRLLNILIDEYN 540

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  119 bits (298), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 79/127 (62%), Gaps = 30/127 (23%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C +CDKSFKRKSWL+RHLLSHS  + F CPWC S+HKRKDNLLQHMKLKHT  VL++L
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 252 RNQNVGIDGEVRN----------------------------DNIRTLLCEGRLNKEDVKK 283
             Q+ G+   V N                             +I+T++ +G LNK+DVK+
Sbjct: 318 --QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKR 375

Query: 284 VLNGLID 290
           VLN LI+
Sbjct: 376 VLNMLIN 382

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  118 bits (295), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 11/107 (10%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL-- 251
           C MC+KSFKRKSW +RHLLSHS  + + CPWC S+HKR+DNL QHMK KH   VL++L  
Sbjct: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQELME 449

Query: 252 ---------RNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLI 289
                     N  + ID  V   +IRTL+ +GR+ KE VK VLN +I
Sbjct: 450 AGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVI 496

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  117 bits (293), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 78/118 (66%), Gaps = 15/118 (12%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE 249
           +++ C MCDKSFKR+SW +RHLLSHS  + + CPWC S+HKR+DNL QHMK KH  +V++
Sbjct: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446

Query: 250 KLRNQNVG-IDGEVRND------------NIRTLLCEGRLNKEDVKKVLNGLIDSYNG 294
           +L    VG +DG V +             +I+TL+ +G++ KE VK VLN +I   NG
Sbjct: 447 ELL--EVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARVNG 502

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  113 bits (283), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C  C+KSFKRKSWL+RHLLSHS +RHF CPWCLS+ KRKDNLLQHMKLKHT Y+L++L
Sbjct: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386

Query: 252 RNQNV 256
           +  N+
Sbjct: 387 KKNNI 391

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  112 bits (281), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 73/128 (57%), Gaps = 31/128 (24%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR- 252
           C +C K FKRKSWL+RHLLSHS  R + CPWCLSKHKRKDNLLQHMKLKH + VL+++  
Sbjct: 256 CNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQEMDK 315

Query: 253 ----------NQNVGID------------------GEVRNDNIR--TLLCEGRLNKEDVK 282
                       + G D                  G   NDN+    ++  G L KE+VK
Sbjct: 316 LSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGTLKKENVK 375

Query: 283 KVLNGLID 290
           KVLN +I+
Sbjct: 376 KVLNSIIE 383

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  107 bits (266), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 44/65 (67%), Positives = 56/65 (86%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C +C+KSFKRKSWL+RHLLSHS +R+F CP CLSKHKRKDNL+QH+KLKH +Y+L+KL  
Sbjct: 342 CHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKKLNK 401

Query: 254 QNVGI 258
            ++ I
Sbjct: 402 DDLII 406

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  105 bits (261), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 75/130 (57%), Gaps = 22/130 (16%)

Query: 183 QLPRLNGLS--HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           QL  LN     H C  C+K+FKRKSWL+RHLLSHS  + + CPWC S+HKRKDNL QH+K
Sbjct: 174 QLMDLNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 233

Query: 241 LKHTEYVLEKLR---NQNVGIDGEVRNDN-----------------IRTLLCEGRLNKED 280
           LKH E +LE+L    N    +   + + +                 I+ ++  G L+K +
Sbjct: 234 LKHAEMLLERLSSNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNE 293

Query: 281 VKKVLNGLID 290
           VKK LN LI+
Sbjct: 294 VKKTLNSLIN 303

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  105 bits (261), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 75/124 (60%), Gaps = 23/124 (18%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           S+ C +C+K F+RKSWL+RHLLSHS  + F CPWC S HKRKDNLLQH+KLKHT+Y+L +
Sbjct: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364

Query: 251 ------LRNQNVG----------IDGE----VRND---NIRTLLCEGRLNKEDVKKVLNG 287
                 L N N G            GE    + N+    IR +L    L K+ VK+ LN 
Sbjct: 365 FTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNY 424

Query: 288 LIDS 291
           ++DS
Sbjct: 425 IVDS 428

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  104 bits (259), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 74/135 (54%), Gaps = 35/135 (25%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           H C  C+K+FKRKSWL+RHLLSHS  + + CPWC S+HKRKDNL QH+KLKH E +LE+L
Sbjct: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345

Query: 252 RNQ-----------NVGIDGEV------------------------RNDNIRTLLCEGRL 276
            +            + G +G V                           +I+ ++  G L
Sbjct: 346 SSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGML 405

Query: 277 NKEDVKKVLNGLIDS 291
           +K +VKK LN LI+S
Sbjct: 406 SKNEVKKTLNSLINS 420

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score =  102 bits (253), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           S+ CP C KSF+R +WL+RH ++H+    F C WC S+HKR+DN+ +HMKLKH   +++ 
Sbjct: 249 SYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKV 308

Query: 251 LRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLID 290
           +RN       E    +++ LL +GRL+KEDVK+VL  +++
Sbjct: 309 IRNYYP--LAEFEGKDLKGLLADGRLHKEDVKRVLVDIVN 346

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 98.6 bits (244), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 68/96 (70%), Gaps = 2/96 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C +C+K F+R++WLRRH LSH+ +R+F CPWC SKHKR+DNL +H+KLKH E +++ +R 
Sbjct: 121 CNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAIRE 180

Query: 254 QNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLI 289
                D E  + ++  L+  G L++ED+K+V   LI
Sbjct: 181 YYPLTDFE--DKDLNELMRSGYLHREDIKRVFLHLI 214

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 39/52 (75%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTE 245
           C +C K+FKR SWL+RH  SHS  ++F C WC  K+KRKDNL+QH++ KH +
Sbjct: 326 CKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRD 377

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C K+F+R   L+RH+ S HS ER F CP C  K  R DNL QH+K
Sbjct: 767 CETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH  S HS ER FGC +C  +  R DNL QH+K   KH ++
Sbjct: 917 CSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF 972

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  CDK+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 592 CTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C K+F+R   L+RH+ S HS ER F C  CL K  R DNL QH+K
Sbjct: 691 CDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 586 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 575 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CDK+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K
Sbjct: 486 CADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 529 CKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           C  C + FKR+  L+RH+LS H  E+ FGCP C     R DNL QH+K    E   +K
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIKTHSNENSCQK 459

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 204 KSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHM 239
           K+  R+  L   P + FGC +C  K KR+++L +H+
Sbjct: 384 KTRGRKPSLVDDPSKQFGCKYCPRKFKRQEHLKRHI 419

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 573 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K
Sbjct: 623 CDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 444 CQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C KSF+R   L+RH+ S HS ER F C  C  K  R DNL QH+K
Sbjct: 714 CDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C +C KSFKR   L+RH+ S HS ER F C  C  K  R DNL QH+K
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 186 RLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           + NG + +C  C K F R S LR H+L HS ++ F C W  C  K   K NL++H+KL
Sbjct: 226 KANGKADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 675 CSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+FKR   L+RH+ S HS +R F C  C  K  R DNL QH+K   KH ++
Sbjct: 565 CGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+FKR   L+RH+ S HS ER +GC  C  K  R DNL QH+K   +H ++
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLKTHKRHGDF 660

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 185 PRLNGLSHL-CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           P L+   H  C  CD+ FKR+  L+RH+ S H  E+ FGC  C  K  R DNL QH+K
Sbjct: 495 PILDATKHFGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 218 RHFGCPWCLSKHKRKDNLLQHMKLKH 243
           +HFGC +C  + KR+++L +H++  H
Sbjct: 501 KHFGCEYCDRRFKRQEHLKRHVRSLH 526

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 439 CGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C +C KSFKR   L+RH+ S HS ER F C  C  K  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 643 CQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 698

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C +C KSFKR   L+RH+ S HS ER F C  C  K  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C +C KSFKR   L+RH+ S HS ER F C  C  K  R DNL QH+K
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 464 CNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 622 CQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C K+F+R   L+RH+ S HS ER F C +C  K  R DNL QH+K   KH ++
Sbjct: 382 CKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K FKR   L+RH  S HS ER F C  C  K  R DNL QH+K   KH ++
Sbjct: 315 CSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEY 246
           C  CD+ FKR+  L+RH+ S H  E+ +GC  C  K  R DNL QH+K    +Y
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKTHGGDY 409

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTE 245
           C  C K+F+R   L+RH+ S HS ER F C  C  K  R DNL QH+K   KH E
Sbjct: 388 CDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKTHKKHGE 442

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKL--KHTEY 246
           C  C+K+F+R   L+RH+ S HS ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 468 CGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 13/97 (13%)

Query: 188 NGLSHL-----------CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLL 236
           +GLSHL           C +C ++F R+  L+RH  SH+ E+ F C +C     R+D +L
Sbjct: 37  SGLSHLEETLHKSRPFVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVL 96

Query: 237 QHMKLKHTEYVLEKLRNQNVGIDGEVRNDNIRTLLCE 273
           +H    H+  +  +L ++NV  +  + +DNI+T L +
Sbjct: 97  RHQHKLHSALIGTELHHENV--NALLNDDNIKTTLTD 131

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C K+F+R   L+RH+ S HS +R F C +C  K  R DNL QH+K
Sbjct: 506 CQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C +C K+FKR   L+RH+ S HS +R F C  C  K  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C K+F+R   L+RH+ S HS +R F C +C  K  R DNL QH+K
Sbjct: 700 CQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C+K FKR   L+RH+ S HS ER + C +C     R DNL QH+K
Sbjct: 310 CNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 35/77 (45%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRNQ 254
           P C+ SF R   L RH+  H+ E+ F C  CL    R DNL QH    H++  L  LR Q
Sbjct: 25  PDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRQ 84

Query: 255 NVGIDGEVRNDNIRTLL 271
                  V   N  T +
Sbjct: 85  KQSSGNTVNGPNAGTRM 101

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           LCP+C + F R+  L+RH  SH+ E+ F C  C     RKD +L+H++  H +Y  E+L
Sbjct: 28  LCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQL 86

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ +GC  C  K  R DNL QH+K
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 193 LCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           +CP C++ FKR+  L+RH  S H  E+ F C  C  K  R DNL QH+K
Sbjct: 635 ICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTE 245
           C  CD+ FKR+  L+RH+ S H  E+ F C  C  K  R DNL QH+K  H+E
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVKT-HSE 393

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTE 245
           C  CD+ FKR+  L+RH+ S H  E+ F C  C  K  R DNL QH+K  HT+
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK-THTD 399

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRNQNV 256
           C  +F R   L RH+  H+ E+ F C  CL +  R DNL QH +  H   V     ++NV
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHATVV--NAASKNV 84

Query: 257 GIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDS 291
            +  + R +  + ++    LN E+ KKV+   + S
Sbjct: 85  PLVAKGRVEKPKKII----LNNENFKKVIEQKLKS 115

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C MC++ FKR+  L+RH+ S H  ER + C  CL    R DNL QH +
Sbjct: 220 CDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKR 267

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRNQ 254
           P C+ SF R   L RH+  H+ E+ F C  CL    R DNL QH    H++  L  LR  
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRL 84

Query: 255 NVGIDGEVRNDNIRTLLCEGR 275
               +    + N   +  + R
Sbjct: 85  QQSANSTANDPNATRMFPQLR 105

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 30/58 (51%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           P C+ SF R   L RH+  H+ E+ F C  CL    R DNL QH    H++  L  LR
Sbjct: 25  PDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLR 82

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 30/58 (51%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           P C+ SF R   L RH+  H+ E+ F C  CL    R DNL QH    H++  L  LR
Sbjct: 25  PDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLR 82

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVL 248
           +S +CP+C KSF R+S L+ HLL H+  + F C +C  +   K NL +H ++ H + V+
Sbjct: 169 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI-HRQKVI 226

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H  E+ +GC  C  K  R DNL QH+K
Sbjct: 516 CEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C  K  R DNL QH+K
Sbjct: 260 CEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H  E+ +GC  C  K  R DNL QH+K
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 181 KMQLPRLNGLS-HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQ 237
           KM+ P  N    + C +C+K F R    RRH+ +H+ E+   C  P C+ +  R D L +
Sbjct: 13  KMEYPADNDQRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKR 72

Query: 238 HMKLKHTEYVLEKLRNQNVGIDGEVR 263
           H+++ HT     K R +   I  E +
Sbjct: 73  HLRI-HTNTSKRKTRKRRADISSEEK 97

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C  K  R DNL QH+K
Sbjct: 305 CEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           +LNGL+        LC +C K+F R+  L RHL SH+ E+ F C  C     R+D L++H
Sbjct: 36  KLNGLTPSGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRH 95

Query: 239 MKLKHTE 245
               H++
Sbjct: 96  SNKLHSD 102

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ + C  C  K  R DNL QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           +S +CP+C KSF R+S L+ HLL H+  + F C +C  +   K NL +H ++
Sbjct: 165 VSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           H CP+CDK   R + LR HLL H+ E+ + C W  C +    K N+ +H K
Sbjct: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           LCP+C + F R+  LRRH  SH+ E+ F C +C     R+D +L+H +  H
Sbjct: 84  LCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 134

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LCP C + F R+  L+RH  SH+ ER F C  C     RKD +L+H +  H   V     
Sbjct: 50  LCPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHATIVSNTAS 109

Query: 253 NQNVGIDGEVRND 265
           N++      + ND
Sbjct: 110 NRSDKSSTAINND 122

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 10/98 (10%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH-------MKLKHT 244
           HLCP+C + F R   L+RH  +H+ E+ F C +C     R+D +L+H       +  K+ 
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHPTLVSKNN 92

Query: 245 EYVLEKLRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVK 282
           E  L+  RN +V    +  +D ++    E  +N   +K
Sbjct: 93  EGSLDNSRNNSVSPGSDNSSDALK---AEAAINDNIIK 127

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           NG  ++C +C + F     L RH  S HS E+ F CP C  + KR+D++LQH+  K
Sbjct: 777 NGKVYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LCP C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H    H   +  +L+
Sbjct: 73  LCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNELQ 132

Query: 253 NQNVGIDGEVRNDNI 267
            QN+    +V +++I
Sbjct: 133 -QNLSNQLDVTHEDI 146

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           H+C +C KS  R + LR H+L H+  R F C W  C +    K N+ +H K
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL--KHTE 245
           L HLCP C KSF+R S L+ H + H     + C W  C  +   K NLL+H ++  K  E
Sbjct: 216 LQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKKE 275

Query: 246 YVLEKLRNQN 255
               K R +N
Sbjct: 276 ASGVKTRRRN 285

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 12/92 (13%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LC +C + F R+  L+RH +SH+ E+ F C +C     RKD +L+H    H   + +K  
Sbjct: 35  LCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPSLISKK-- 92

Query: 253 NQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKV 284
                   E  ND +     EG +N  ++ K+
Sbjct: 93  --------EAINDTVSE--NEGTVNNTNIVKI 114

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 186 RLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
            L+ L   CP+C K   R S L+ H L H+ +  F CPW  C      K N+L+H+K
Sbjct: 279 ELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           LCP+C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H +  H
Sbjct: 74  LCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 124

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 10/71 (14%)

Query: 183 QLP---RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRK 232
           QLP   RLNG++        +C +C ++F R+  L RH  SH+ E+ + C  C  K  R+
Sbjct: 99  QLPENLRLNGVTPSGKPRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRR 158

Query: 233 DNLLQHMKLKH 243
           D LL+H    H
Sbjct: 159 DLLLRHAHKIH 169

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK---H 243
           NG  ++C  C + F     L RH  S HS E+ + CP C  K KR+D++LQH+  K    
Sbjct: 784 NGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKKIPCT 843

Query: 244 TEYVLEKLRNQNVG 257
            E      RNQN G
Sbjct: 844 QENDDLSSRNQNQG 857

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           LCP+C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H +  H
Sbjct: 81  LCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 131

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           +LCP+C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H    H   V
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHGSLV 112

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           NG  ++C  C + F     L RH  S HS E+ + CP C  K KR+D++LQH+  K
Sbjct: 752 NGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  CD+ FKR+  L+RH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F+R     RHL +H+ E+   C  P C  +  R D L +H ++
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI 80

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           CP+C K   R S L+ H L H+ +  + C W  C      K N+L+H  LK+ E  LEK+
Sbjct: 357 CPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRH--LKNHEKKLEKM 414

Query: 252 RNQNVG 257
           + Q + 
Sbjct: 415 KEQMIA 420

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           + C +C K FKR   L+RH  + H   R F C  C  +  R DNL QH+++   + ++E 
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 251 LR 252
           +R
Sbjct: 283 IR 284

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVL 248
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H    L
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQL 103

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 25/47 (53%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVH 95

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG +        +C +C ++F R+  L RH  SH+ E+ + C  C  K  R+D LL+H
Sbjct: 31  RLNGKTPSGKVRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRH 90

Query: 239 MKLKH 243
            +  H
Sbjct: 91  AQKIH 95

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C+++F R     RH+ +H+ E+   C  P C+ K  R D L +H ++
Sbjct: 39  HVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHRRI 90

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 10/85 (11%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKLKHTE---- 245
           ++CP+C ++F R     RH+ +H+ E+   C  P C  K  R D L +H ++ HT     
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRI-HTNPHPK 84

Query: 246 ---YVLEKLRNQNVGIDGEVRNDNI 267
                 +K   Q+ G D  V+  N+
Sbjct: 85  GKRGRKKKTETQSSGADTAVQQGNL 109

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK-L 251
           LC +C + F R   L+RH +SH+ E+ F C +C     RKD +L+H    H   V +K  
Sbjct: 37  LCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQKDS 96

Query: 252 RNQNVGID-GEVRNDNI 267
           ++ N   + G   N+NI
Sbjct: 97  KDSNSNTNSGSATNENI 113

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTE 245
           P C+ SF R   L RH+  H+ E+ F C  CL    R DNL QH    H +
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAK 81

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 185 PRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           PRL     +C +C ++F R+  L RH  SH+ E+ + C  C  K  R+D LL+H +  H
Sbjct: 75  PRL----FVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           H CP+C++   R   L  H+L H+ ++ F C W  C      K NL +HMK+
Sbjct: 426 HQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           + C +C K F R S L+ HLL+H+  R F CP+  C      K N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 7/73 (9%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG +        +C +C ++F R+  L RH  SH+ E+ + C  C  K  R+D L++H
Sbjct: 103 RLNGKTPSGKVRLFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRH 162

Query: 239 MKLKHTEYVLEKL 251
            +  H   V++ +
Sbjct: 163 AQKVHNGNVVDTV 175

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLE 249
           +LC  C K F     L RH   H+ E++  CP+  C  +  R+DN LQH +     +   
Sbjct: 185 YLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFKNFTFT 244

Query: 250 KLRNQ 254
            L N+
Sbjct: 245 NLANK 249

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           NG  ++C  C + F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 773 NGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           LCP C + F R+  L+RH  +H+ E+ F C +C     R+D +++H    H
Sbjct: 42  LCPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLH 92

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F R     RH+ +H+ E+   C  P C+ K  R D L +H ++
Sbjct: 68  HVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRI 119

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV----- 247
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H    H+  +     
Sbjct: 55  LCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLISKSNN 114

Query: 248 ---LEKLRNQNVGID 259
               EKL   N  +D
Sbjct: 115 DNTFEKLMENNKNLD 129

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYV 247
           +C +C K FKR S LR H++ H+ ++ + C    C  +   K N+L+HM+ KH E V
Sbjct: 250 ICEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKEVV 305

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           LC  C ++F R+  L RH  SH+ E+ F C  C     R+D L++H +  H
Sbjct: 153 LCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F R     RH+ +H+ E+   C  P C+ +  R D L +H ++
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 72

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 193 LCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE 249
           LC +C + F+R+  ++RH+ + H  ER + C  C     R DNL QH++     Y ++
Sbjct: 414 LCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYEVK 471

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F R     RHL +H+ E+   C  P C+ +  R D L +H ++
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI 94

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 18/88 (20%)

Query: 186 RLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHK-------------RK 232
           + NG+ ++C  CD SF+ + +L RH+  HS E+ + CP+  ++H+             R+
Sbjct: 30  KTNGM-YVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPF-YNEHQPSELKCHNSGGFSRR 87

Query: 233 DNLLQHMKLKHTEY---VLEKLRNQNVG 257
           D    H+K +H  Y   V +  RN++ G
Sbjct: 88  DTYKTHLKSRHILYPKGVKQNERNKSTG 115

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           LCP C + F R+  L+RH  SH+ E+ + C +C     R+D +L+H +  H   V
Sbjct: 105 LCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 159

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F R     RH+ +H+ E+   C  P C+ +  R D L +H ++
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 94

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F CPW  C      K N+L+H K
Sbjct: 296 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C+++F R     RH+ +H+ E+   C  P C  K  R D L +H ++
Sbjct: 72  HVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRI 123

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK--LKHTEYV 247
           H+C +C K F     L RH   H+ E++  CP+  C  K  R DN +QH +  +K    V
Sbjct: 110 HVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKRELRV 169

Query: 248 LEKLRNQN 255
            E LR  N
Sbjct: 170 SEALRTGN 177

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           NG  ++C  C + F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 855 NGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE- 249
           SH+C  C ++F R    +RH  SH   + F C  C     R+D L +H+K  H  ++LE 
Sbjct: 4   SHVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLEH 63

Query: 250 -----KLRNQNVGIDGEVR 263
                +L  Q++ ++  ++
Sbjct: 64  GQDNSQLFKQDLFVNSLIK 82

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H   + + C  C  K  R DNL QH+K
Sbjct: 388 CDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 182 MQLPRLNGLSHL---CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLL 236
           +Q P LN    L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L
Sbjct: 88  VQGPVLNQAVRLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNML 147

Query: 237 QHMK 240
           +H+K
Sbjct: 148 RHLK 151

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           LCP C + F R+  L+RH  SH+ E+ + C +C     R+D +L+H +  H   V
Sbjct: 37  LCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 91

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSK------------HKRKDNLLQH 238
           +++C  CD SF+  S+L RH+  H+ E+ F CP+   K              RKD    H
Sbjct: 12  NYICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMH 71

Query: 239 MKLKHTEY 246
           +K +H  Y
Sbjct: 72  LKCRHFIY 79

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C  +F R   L RH+  H+ E+ F C  C     R DNL QH +  H    ++++ N
Sbjct: 26  CHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDEMSN 82

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           C +C K FKR S L  H+  H+  + F CP+  C      K N+L+H KL
Sbjct: 307 CSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG++        +C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D L++H
Sbjct: 112 RLNGVTPSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRH 171

Query: 239 MKLKHTEYVLEKLRNQNVGIDGEVRNDN 266
            +  H     + +R  +  +  + + DN
Sbjct: 172 CQKLHGGNCGDYIRRTSRKVRRDSKKDN 199

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW----C----LSKHKRKDNLLQHMKLKHTE 245
           CP C  SFK + +L RHL  H P + F CP+    C      +  RKD    H+K  H  
Sbjct: 236 CPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLKSIHFV 295

Query: 246 YVLEKLRNQNVGIDG 260
           Y +   + Q     G
Sbjct: 296 YPVGTTKAQRANSAG 310

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           NG  ++C  C + F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 683 NGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           +C +C +  +R S L+ H+L+H+ +R F C  P C      + N+L+H +L      L  
Sbjct: 205 VCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSELVD 264

Query: 251 LRNQNVGIDGE 261
             +QN    G+
Sbjct: 265 THSQNSSPQGQ 275

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           ++ CP C K FKR S LR H++ H     F C W  C  K   K NLL+H +
Sbjct: 215 TYCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYR 266

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           LCP C + F R+  L+RH  SH+ E+ + C +C     R+D +L+H +  H   V
Sbjct: 126 LCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 180

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 186 RLNGL-------SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG        S +C +C ++F R+  L+RH  SH+ E+ + C  C     R+D L++H
Sbjct: 97  RLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRH 156

Query: 239 MKLKHT 244
            +  H+
Sbjct: 157 AQKIHS 162

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           LCP C + F R+  L+RH  SH+ E+ + C +C     R+D +L+H +  H   V
Sbjct: 152 LCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHAALV 206

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           +LC +C + F R+  LRRH  +H+ E+ F C +C     R+D +L+H
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 133

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           ++CP+C + F R   L+RH  SH+ E+ + C +C     RKD +L+H    H E VL  L
Sbjct: 22  NICPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPE-VLSAL 80

Query: 252 RNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKV 284
                G   +++  ++  L   G + + +V ++
Sbjct: 81  -----GPTADIKPVSLEELYAPGFVAESNVVRI 108

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H+CP+C ++F R     RH+ +H+ E+   C  P C  +  R D L +H ++
Sbjct: 43  HVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRI 94

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTE 245
           C   F R+  L RH+  H+ E+ F C  CL    R DNL QH +  H E
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVHLE 71

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G +++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 749 GKAYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G +++C  C ++F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 722 GKTYICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LC +C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H    H   V + L 
Sbjct: 76  LCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALVSKTLE 135

Query: 253 NQNVGID 259
            ++V +D
Sbjct: 136 -EDVMMD 141

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           L + C +C K F+R S LR H    S  R + CP+  C      K N+L+H KL
Sbjct: 237 LGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 188  NGLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
            NG  ++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 994  NGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250
           H+C  C+++F R     RH  SH+  + + C  CL +  R+D L +H++  H   +L K
Sbjct: 9   HICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKSLLLSK 67

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LCP C + F R   L+RH  SH+ E+ + C +C     R+D +L+H    H+  +L   +
Sbjct: 46  LCPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSS-ILNNSK 104

Query: 253 NQNVGIDGEVRNDNIRTLL 271
             N  +    ++DN R ++
Sbjct: 105 TYNSLVHQADQHDNYRHII 123

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWC 225
           +H C +C   F RKS L RHL+SHS E+ F C +C
Sbjct: 107 NHSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFC 141

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G +++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 729 GKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 185 PRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           P  + + + C +C K FKR S L  H+  H+  + + CP+  C      K N+L+H KL
Sbjct: 271 PSTDKVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F CPW  C      K N+L+H+K
Sbjct: 268 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHT 244
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H +  H+
Sbjct: 79  LCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           S  C  C +SF     L RH  + H  E+ F CP C  + KR+D++LQH+  K
Sbjct: 389 STYCYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHT 244
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H +  H+
Sbjct: 33  LCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 84

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           ++CP+C ++F R     RH+ +H+ E+  GC +  C  K  R+D L +H ++
Sbjct: 22  YVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRI 73

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCP--WCLSKHKRKDNLLQHMKLKHTE 245
           +C +C K FKR S LR H++ H+ ++ + C    C  +   K N+L+HM+ KH E
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR-KHKE 279

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H + H+ +  F CPW  C      K N+ +H+K
Sbjct: 453 LRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLK 505

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H+L H+ +  F C W  C      K NLL+H+K
Sbjct: 282 LRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHT 244
           ++C  C + F R+  L+RH  SH+ E+ F C +C     R+D +L+H +  H+
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHS 157

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 187 LNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHT 244
           L+ L   CP C K   R S L+ H L H+ +  F C W  C      K N+L+H+K  H 
Sbjct: 195 LSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK-AHE 253

Query: 245 EYVLEK 250
           + V++K
Sbjct: 254 KKVIKK 259

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H    H+  V ++  
Sbjct: 62  LCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESV 121

Query: 253 NQNVGIDGEVRND 265
           N     + +  ND
Sbjct: 122 NSKDKTEIDAMND 134

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           S  C +C KS  R S L+ H+L H+ +R F C W  C  +   K N+ +H KL
Sbjct: 490 SRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKL 542

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG +        +C +C ++F R+  L RH  SH+ E+ + C  C  K  R+D LL+H
Sbjct: 73  RLNGRTPSGKPRLFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRH 132

>NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8.130
          Length = 1207

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 11/64 (17%)

Query: 192 HLCPM--CDKSFKRKSWLRRHLLSHSPERHFGCPW--------CLSKHKRKDNLLQHMKL 241
           ++CP   C+KSF R+  L RH L+H P+  F CP+        C     RKD L++H K 
Sbjct: 42  YICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVRKDLLIRHQK- 100

Query: 242 KHTE 245
           +HT+
Sbjct: 101 RHTK 104

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%)

Query: 188 NGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           N   + C +CDK F R   L+ HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 409 NASVYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 10/66 (15%)

Query: 183 QLP---RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRK 232
           QLP   RLNG +        +C +C ++F R+  L RH  SH+ E+ + C  C     R+
Sbjct: 40  QLPENLRLNGKTPSGKPRLFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRR 99

Query: 233 DNLLQH 238
           D LL+H
Sbjct: 100 DLLLRH 105

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           CP+C K   R S LR H+  H+  R F C W  C  +   K N+++H +L   +   EK 
Sbjct: 298 CPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQVQENKEKS 357

Query: 252 RNQ 254
           + +
Sbjct: 358 KRE 360

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+    F CPW  C      K N+L+H K
Sbjct: 256 LKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}
          Length = 224

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           +C  CD  F R+S L+RH  +H       C  C     RKD+L +H      +   EKL+
Sbjct: 139 VCNKCDMEFTRQSDLKRHEKTHMSVGPHICSQCGKDFARKDSLKRHANTMQCKKNREKLQ 198

Query: 253 NQNVGIDGEV 262
           N+  G D ++
Sbjct: 199 NEYFGQDVDL 208

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 186 RLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           R  G+ + CP+C K   R S LR H+  H+  R F C W  C  +   K N+++H +L
Sbjct: 268 RQKGVRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 325

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C + F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 757 GKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 186 RLNGL-------SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG        S +C +C ++F R+  L+RH  SH+ E+ + C  C     R+D L++H
Sbjct: 91  RLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRH 150

Query: 239 MKLKHT 244
            +  H+
Sbjct: 151 AQKIHS 156

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H   + + C  C  K  R DNL QH K
Sbjct: 351 CEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           + C +CDK F R   L+ HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 408 YACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 186 RLNGL-------SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG        S +C +C ++F R+  L+RH  SH+ E+ + C  C     R+D L++H
Sbjct: 91  RLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRH 150

Query: 239 MKLKHT 244
            +  H+
Sbjct: 151 AQKIHS 156

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 182 MQLPRLNGL-SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           ++ P+  G+  H CP C K F + + L  H+ SH   + F C +C  +  +  NL  H +
Sbjct: 529 VEKPKARGVKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTR 588

Query: 241 LKHTE--YVLEK 250
           L   E  Y  EK
Sbjct: 589 LHTGEKPYSCEK 600

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 6/67 (8%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C  C K F +   LR H   H+ E+ + C  C  +  RK NL  HM L H     E L+ 
Sbjct: 570 CEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM-LTH-----ENLKP 623

Query: 254 QNVGIDG 260
            +  +DG
Sbjct: 624 YHCKLDG 630

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 185 PRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           PRL     +C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H
Sbjct: 56  PRL----FVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           +S+ CP+C KS  R S L  H+  H+  R + C W  C      K NL +H KL
Sbjct: 456 VSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509

>NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {ON}
           
          Length = 263

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           SH+C  C   F     L RH   H+ E++  CP+  C  K  R DN LQH +
Sbjct: 205 SHICKTCSMGFTTSGHLSRHNRIHTGEKNHSCPYKGCNQKFSRHDNCLQHYR 256

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%)

Query: 181 KMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           K +L + N   + C +CDK F R   L+ HL +H+ ER F C  C     R+ +  +H  
Sbjct: 640 KKRLSQKNPAIYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHED 699

Query: 241 L 241
           L
Sbjct: 700 L 700

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H    H+  V ++  
Sbjct: 62  LCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESI 121

Query: 253 NQNVGIDGEVRND 265
           N     + +  ND
Sbjct: 122 NSKDKTEIDAIND 134

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLR 252
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H    H+  V ++  
Sbjct: 62  LCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESV 121

Query: 253 N--QNVGIDGEVRNDNI 267
           N      IDG + + NI
Sbjct: 122 NSKDKTQIDG-INDKNI 137

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 191 SHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           S  C  C +SF     L RH  + H  E+ F CP C  + KR+D++LQH+  K
Sbjct: 446 SSYCFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H CP+C ++F R     RH+  H+ E+   C  P C+ +  R D L +H ++
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI 89

>Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar to
           Ashbya gossypii AFL136W
          Length = 460

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 197 CDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKH 243
           CD SF R   L RH+  H+ E+ F C  C     R DNL QH +  H
Sbjct: 28  CDMSFTRAEHLARHIRKHTGEKPFQCEVCNRFFSRIDNLKQHRESVH 74

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEY 246
           C  C K F +   LR H+  H+ ER + C  C  +  RK NL  HM L H  Y
Sbjct: 517 CEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHENY 568

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 182 MQLPRLNGL-SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           ++ P+  G+  H CP C K F + + L  H+ SH   + F C +C  +  +  NL  H++
Sbjct: 476 VEKPKSRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVR 535

Query: 241 LKHTEYVLE 249
           L   E   E
Sbjct: 536 LHTGERPYE 544

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           + C  C K F RK  L  H+L+H   + F C   L    +    L +MK     + L+ L
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCK--LDDCNKSFTQLGNMKAHQNRFHLQTL 600

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYV 247
           LC +C + F R+  L+RH  +H+ E+ F C +C     R+D +L+H    H+  V
Sbjct: 62  LCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALV 116

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K  H + + +KL
Sbjct: 233 CPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVK-SHEKKLSKKL 291

Query: 252 RNQNV 256
           + + V
Sbjct: 292 QTKIV 296

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVL--- 248
           ++C  C K+F R     RH  SH+  + F C  C     R+D L +H++  H E +L   
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLLMKK 67

Query: 249 --EKLRNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLIDSY 292
             E+  N++  I   + N  I+    EG   + +  ++L+ LI  +
Sbjct: 68  GMEEGGNKSDLIVELLVNSMIKVTKREGSGLRGEKAEILSRLIGGF 113

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K  H   +++K 
Sbjct: 342 CPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLK-SHERRLIKKN 400

Query: 252 R 252
           R
Sbjct: 401 R 401

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 715 GKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           +C +C K FKR S L  H+  H+ E+ + CP+  C      K N+L+H KL
Sbjct: 174 ICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           + C +CDK F R   L+ HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 424 YACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           + CP+CDK F R   L+ H  +H+ ER F C  C     R+ +  +H  L
Sbjct: 493 YACPVCDKKFTRPYNLKSHKRTHTNERPFSCSQCGKTFAREHDRKRHEDL 542

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 186 RLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           R N   + C MCDK F R   L+ HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 493 RKNPAIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 187 LNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
              L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K
Sbjct: 249 FTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 183 QLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           QL  +  L   CP+C K   R S LR H L H+ +  F C W  C      K N+L+H++
Sbjct: 176 QLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLR 235

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMK 240
           C MC K F R    RRH+ +H+ E+   C  P C+ +  R D L +H++
Sbjct: 15  CDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           ++C  C K+F R     RH  SH+  + F C  C     R+D L +H++  H  ++L+  
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQCT 67

Query: 252 RNQ 254
           + Q
Sbjct: 68  KEQ 70

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           CPMC + F R    +RH+ +H+ E+   CP   C     R D L +HMK+
Sbjct: 18  CPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%)

Query: 192 HLCPM--CDKSFKRKSWLRRHLLSHSPERH 219
           HLCP+  C+KSF R   L+RH+  H    H
Sbjct: 44  HLCPILGCNKSFSRTDELKRHMKVHPASTH 73

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 10/66 (15%)

Query: 183 QLP---RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRK 232
           QLP   RLNG++        +C  C ++F R+  L RH  SH+ E+ + C  C  +  R+
Sbjct: 30  QLPENLRLNGVTPSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRR 89

Query: 233 DNLLQH 238
           D LL+H
Sbjct: 90  DLLLRH 95

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWC-------LSKH-----KRKDNLLQHMK 240
           +C  CD  F+ + +L RH+  H+ E+ F CP+        L  H      R+D    H+K
Sbjct: 62  VCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHLK 121

Query: 241 LKHTEY 246
           +KH  Y
Sbjct: 122 VKHVLY 127

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           CP+C K   R S L+ H L H+ +  F C W  C      K NL++H+K
Sbjct: 372 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLK 420

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 13/101 (12%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251
           ++C  C ++F R     RH  SH+  + F C  C     R+D L +H++  H   +LE L
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLLE-L 66

Query: 252 RNQNVGIDGEVRNDNIRTLLCEGRLNKE--DVKKVLNGLID 290
           + + V + GE R         EG L  E   +++VLN  I+
Sbjct: 67  QLKQVKL-GEGR---------EGVLQGESQQIERVLNSFIN 97

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 736 GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 11/77 (14%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW------CLS--KHKRKDNLLQHMKLKH 243
           + C  C  +FK + +L RHL  H P + F CP+      C S  +  RKD    H+K  H
Sbjct: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSIH 215

Query: 244 TEY---VLEKLRNQNVG 257
             Y     +  RN +VG
Sbjct: 216 FVYPVGTTKAQRNNSVG 232

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMK 240
           C MC K F R    RRH+ +H+ E+   C  P C+ +  R D L +H++
Sbjct: 16  CDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 194 CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMK 240
           C  C++ FKR+  L+RH+ S H   + + C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           ++CP+C ++F R     RH+ +H+ E+   C  P C  +  R D L +H ++
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRI 85

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 182 MQLPRLNGL-SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           ++ P+  G   H CP C K F + + L  H+ SH   + F C +C  +  +  NL  H++
Sbjct: 492 VEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVR 551

Query: 241 LKHTE--YVLEK 250
           L   E  Y  EK
Sbjct: 552 LHTGEKPYECEK 563

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C  C K F +   LR H+  H+ E+ + C  C  +  RK NL  H +L H     E L+ 
Sbjct: 533 CEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH-----ENLKP 586

Query: 254 QNVGIDG 260
            +  +DG
Sbjct: 587 FHCKLDG 593

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 186 RLNGL-------SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           RLNG        S +C +C ++F R+  L+RH  SH+ E+ + C  C     R+D L++H
Sbjct: 91  RLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRH 150

Query: 239 MKLKHT 244
            +  H+
Sbjct: 151 AQKIHS 156

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           ++C  C K F R S LR H   H+ +R F CP+  C      + N+L+H KL
Sbjct: 183 YVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 234

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 732 GKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMK 240
           L   CP+C K   R S L+ H L H+ +  F C W  C      K N+L+H+K
Sbjct: 64  LRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLK 116

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 4/53 (7%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNL----LQHMKLK 242
           C  C K F +   LR H   H+ ER + C  C  K  RK NL    L H KLK
Sbjct: 538 CEYCGKRFTQGGNLRTHQRLHTGERPYSCELCGKKFSRKGNLAAHFLTHQKLK 590

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKL 241
           H CP C + F + + L  H+ SH   + F C +C  +  +  NL  H +L
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRL 557

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 2/58 (3%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHTEYVLE 249
           C +C K F RK  L  H L+H   + + C    C     +  N+  H    H   ++E
Sbjct: 566 CELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNTLME 623

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C++ F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C++ F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 825 GKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H CP+C ++F R     RH+  H+ E+   C  P C+ +  R D L +H ++
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI 89

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 189 GLSHLCPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           G  ++C  C + F     L RH  S HS E+   CP C  K KR+D++LQH+  K
Sbjct: 762 GKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 816

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 185 PRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           PRL     +C  C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H
Sbjct: 27  PRL----FVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKLKHT 244
           +LC +C++ F R    +RHL  H+ E+ + C +  C  K  R D L +H K+ H+
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHS 73

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           ++C  C K F R S LR H   H+ +R F CP+  C      + N+L+H KL
Sbjct: 207 YICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKL 258

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 182 MQLPRLNGL-SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMK 240
           ++ P+  G   H CP C K F + + L  H+ SH   + F C +C  +  +  NL  H++
Sbjct: 475 VEKPKARGAKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVR 534

Query: 241 LKHTE--YVLEK 250
           L   E  Y  EK
Sbjct: 535 LHTGEKPYECEK 546

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRN 253
           C  C K F +   LR H+  H+ E+ + C  C  +  RK NL  H +L H     E L+ 
Sbjct: 516 CEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH-----ENLKP 569

Query: 254 QNVGIDG 260
            +  +DG
Sbjct: 570 FHCKLDG 576

>TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8.130
           YPR022C
          Length = 1077

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 9/59 (15%)

Query: 195 PMCDKSFKRKSWLRRHLLSHSPERHFGCPW--------CLSKHKRKDNLLQHMKLKHTE 245
           P CDKSF R+  L RH L+H P+  F C +        C     RKD L +H+K +HT+
Sbjct: 50  PACDKSFTRQEHLSRHKLNHWPKEIFKCSYVFPNTGLACNRTFVRKDLLARHVK-RHTK 107

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 193 LCPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--CLSKHKRKDNLLQHMKL 241
           +C +C K F+R    +RH+ +H+ E+   C +  C+ K  R D L +H+K+
Sbjct: 14  ICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006W STP2 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes
          Length = 344

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 21/102 (20%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPW--------CLSKHKRKDNLLQHMKLKHTE 245
           CP C  +FK K +L RHL  H P + + CP+           +  RKD    H+K  H  
Sbjct: 234 CPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDTFKTHLKSIHFV 293

Query: 246 YVLEKLRNQNVGIDGEVR-------------NDNIRTLLCEG 274
           Y +  +++Q     G                N++I T +C G
Sbjct: 294 YPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRG 335

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 186 RLNGLS-------HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQH 238
           +LNG++        +C +C ++F R   L RH  SH+ E+ + C  C     R+D LL+H
Sbjct: 62  KLNGVTPSGKPRRFVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRH 121

Query: 239 MKLKH 243
               H
Sbjct: 122 ALKTH 126

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 188 NGLSHL-CPMCDKSFKRKSWLRRHLLS-HSPERHFGCPWCLSKHKRKDNLLQHMKLK 242
           +G  +  C +CD +F     L RH  S HS E+ + CP C    KRKD++ QH+K K
Sbjct: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 194 CPMCDKSFKRKSWLRRHLLSHSPERH 219
           CP+C K FKRK  + +HL   +P R 
Sbjct: 593 CPICSKGFKRKDHVSQHLKKKTPCRQ 618

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGC--PWCLSKHKRKDNLLQHMKL 241
           H CP+C ++F R     RH+  H+ E+   C  P C+ +  R D L +H ++
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI 89

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 162 RIAAVNATXXXXXXXXXXXKMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPERHFG 221
           + A V AT            M+  + +G S  CP C+K F R S LR H + H  +  + 
Sbjct: 171 KAAGVRATRAETTAGPAGAAMRKKKEHGYS--CPECEKVFGRPSALRTHSIIHIGKSPYI 228

Query: 222 C--PWCLSKHKRKDNLLQHMK 240
           C  P C  +   K NLL+H+K
Sbjct: 229 CQLPGCAKRFNVKSNLLRHVK 249

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,510,709
Number of extensions: 1142141
Number of successful extensions: 5224
Number of sequences better than 10.0: 615
Number of HSP's gapped: 5046
Number of HSP's successfully gapped: 762
Length of query: 294
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 185
Effective length of database: 40,982,805
Effective search space: 7581818925
Effective search space used: 7581818925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)