Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B01980g2.532ON1881888171e-112
NCAS0D026402.532ON2601662771e-29
NDAI0I022702.532ON2771702396e-24
KNAG0C058202.532ON2711542311e-22
KAFR0A018502.532ON2561572254e-22
TBLA0G022202.532ON2781522091e-19
Smik_13.2482.532ON2551592072e-19
YMR069W (NAT4)2.532ON2851611952e-17
Skud_13.2252.532ON2541511922e-17
SAKL0A09460g2.532ON2401561904e-17
TPHA0C041802.532ON2641531899e-17
CAGL0K02981g2.532ON2781621863e-16
Kpol_1018.342.532ON2921651847e-16
KLTH0D06820g2.532ON2601591564e-12
TDEL0A030602.532ON2441721493e-11
KLLA0E18569g2.532ON2151141422e-10
Suva_13.2442.532ON2571491432e-10
Ecym_72562.532ON243701264e-08
Agos_YGOB_Anc_2.5322.532ON1871061184e-07
Kwal_26.80162.532ON2401561169e-07
NCAS0C012308.697ON19558955e-04
Skud_4.27singletonOFF19056750.20
KLLA0A12089gsingletonON18188700.75
KLLA0C09845g8.697ON16363662.5
Ecym_23758.697ON16663662.6
NDAI0G032708.58ON15689643.6
NDAI0E010608.697ON17066644.2
Kwal_26.88778.697ON16263635.8
TDEL0A064208.697ON16759627.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B01980g
         (188 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   319   e-112
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   111   1e-29
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    97   6e-24
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    94   1e-22
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...    91   4e-22
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    85   1e-19
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    84   2e-19
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    80   2e-17
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    79   2e-17
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    78   4e-17
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    77   9e-17
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    76   3e-16
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    75   7e-16
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    65   4e-12
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    62   3e-11
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    59   2e-10
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    60   2e-10
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    53   4e-08
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    50   4e-07
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    49   9e-07
NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON...    41   5e-04
Skud_4.27 Chr4 (43930..44502) [573 bp, 190 aa] {OFF} YPR051W (HSP)     33   0.20 
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    32   0.75 
KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {O...    30   2.5  
Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON} ...    30   2.6  
NDAI0G03270 Chr7 complement(768935..769405) [471 bp, 156 aa] {ON...    29   3.6  
NDAI0E01060 Chr5 complement(211581..212093) [513 bp, 170 aa] {ON...    29   4.2  
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    29   5.8  
TDEL0A06420 Chr1 (1124798..1125301) [504 bp, 167 aa] {ON} Anc_8....    28   7.5  

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  319 bits (817), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 160/188 (85%)

Query: 1   MPNWPGFKREICISNSNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCS 60
           MPNWPGFKREICISNSNDKILEKQLQLIEINLGS              RWQSNKWQEMCS
Sbjct: 1   MPNWPGFKREICISNSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCS 60

Query: 61  ENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILN 120
           ENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILN
Sbjct: 61  ENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILN 120

Query: 121 ALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDKXXXXXXXXXXXXXXY 180
           ALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK              Y
Sbjct: 121 ALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDKRRRTRTGIRIIRPTY 180

Query: 181 YIMCYVLR 188
           YIMCYVLR
Sbjct: 181 YIMCYVLR 188

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 90/166 (54%), Gaps = 12/166 (7%)

Query: 12  CISNSNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNV 71
           C ++  DK+L++ L ++++NLG                W+ NK +EM S  L +VSYW+ 
Sbjct: 56  CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115

Query: 72  ESNELVCFCSIMPCEES--IVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPK 129
           ES+E + F S M  EE     + ++ +++YLYEI + P  RN+K G  +L    +  C +
Sbjct: 116 ESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 175

Query: 130 AH----------LSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
                       L GIELTVFS NE AI FY++ G  L+ DSP D+
Sbjct: 176 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDR 221

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 96.7 bits (239), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 83/170 (48%), Gaps = 24/170 (14%)

Query: 20  ILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNELVCF 79
           +L K L ++++NLG+               W+SNK +EM S  L +VSYW+ +  E + F
Sbjct: 66  VLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLLF 125

Query: 80  CSIMPCEESIVEGEMSN-------------IIYLYEIHVAPEWRNQKFGKSILNALKEKL 126
            S M  E     G  SN             +IYLYEI + P+ R Q  G  +L+    + 
Sbjct: 126 LSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQC 185

Query: 127 CPKA-----------HLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
           C               L GIELTVFS N +AINFY++ G  L+ DSP+D+
Sbjct: 186 CSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDE 235

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 93.6 bits (231), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 80/154 (51%), Gaps = 3/154 (1%)

Query: 14  SNSNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVES 73
            N+ ++ L   L++++ NLG                W+ NKW EM S  L +VSYW V  
Sbjct: 76  DNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYW-VSD 134

Query: 74  NELVCFCSIMPCEESIVEG--EMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAH 131
           +E V + S M  EE+ +        ++YLYEI +    R QK G++I++ L E       
Sbjct: 135 SEPVLYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECALESPE 194

Query: 132 LSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
           ++ + LTVFS NE+A+ FY    FT + DSP D+
Sbjct: 195 VAAVALTVFSDNEKALKFYERLNFTYTIDSPRDE 228

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score = 91.3 bits (225), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 81/157 (51%), Gaps = 11/157 (7%)

Query: 19  KILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNELVC 78
           K+L+  L++++ NLG+               W+ NK  EM S  L +VSYW  E+ +  C
Sbjct: 66  KLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTC 125

Query: 79  --FCSIMPCEESIVEGEMS--NIIYLYEIHVAPEWRNQKFGKSILNAL-------KEKLC 127
             F S M  EE  V  ++   ++IYLYEI +  ++R  + G  ++  L       + K+ 
Sbjct: 126 ALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIR 185

Query: 128 PKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSD 164
           P   L GI+LTVFS N+RAI FY   G   +Y SP D
Sbjct: 186 PAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKD 222

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 85.1 bits (209), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 25  LQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMP 84
            QLI+ NLG                W  NK +EM + N+ +++YW+ + N +  F SI+ 
Sbjct: 75  FQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILS 134

Query: 85  CEESIV--EGEMSNIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPKAHLS-------G 134
           CEE+ +    +   ++YLYEIH+  E++ Q  G+ ++ + L EKL     +        G
Sbjct: 135 CEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIG 194

Query: 135 IELTVFSSNERAINFYRNN-GFTLSYDSPSDK 165
           +ELTVFS N  A NFY N      ++ SP D+
Sbjct: 195 LELTVFSENNDAQNFYFNKIQMQYTFGSPRDE 226

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 84.3 bits (207), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 81/159 (50%), Gaps = 14/159 (8%)

Query: 17  NDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNEL 76
            + IL+  +QLI+ +LG+               W++NK  EM S NL +VSYW  ++  L
Sbjct: 67  GNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYW--DNGAL 124

Query: 77  VCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSIL-NALKEKL--- 126
             F S M  EE+ +VEG+ ++     +IYLYE+HVA   R    G+ +L  AL E +   
Sbjct: 125 AAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEGVARH 184

Query: 127 --CPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPS 163
             C      G+ LTVFS N RA   Y   GF  +  SP+
Sbjct: 185 VRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPA 223

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 80/161 (49%), Gaps = 18/161 (11%)

Query: 17  NDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNEL 76
            D++L+  +QLI+ +LG+               W++NK  EM S  L +V YW  ++  L
Sbjct: 97  GDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW--DNGVL 154

Query: 77  VCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSIL-NAL------- 122
             F S M  EE+ +VEG+  +     +IYLYE+HVA   R    G+ +L +AL       
Sbjct: 155 GAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARH 214

Query: 123 KEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPS 163
             ++C      G+ LTVFS N RA   Y   GF  +  SP+
Sbjct: 215 TRRMCDN--FFGVALTVFSDNTRARRLYEALGFYRAPGSPA 253

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 78.6 bits (192), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 17  NDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNEL 76
            D +L+  +QL++ +LG                W++NK  EM S  L +VSYW   +  L
Sbjct: 66  GDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG--NGAL 123

Query: 77  VCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPK 129
             F S M  EE+ +VEG+ ++     +IYLYEIHVA   R    G+ +L  AL E +  +
Sbjct: 124 GAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEGVARR 183

Query: 130 AHLS-----GIELTVFSSNERAINFYRNNGF 155
                    G+ LTVF  N RA   Y   GF
Sbjct: 184 VRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 77.8 bits (190), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 80/156 (51%), Gaps = 7/156 (4%)

Query: 15  NSNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESN 74
            S++ +L + L+++++NLGS               W  NK +EM +  L +V Y+   S 
Sbjct: 57  QSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSP 116

Query: 75  ELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNA-LKEKLCPKAHLS 133
             + F S +  +E     +   ++YLYEI + PE + Q+ G  +L   LK  +   + L 
Sbjct: 117 --LMFLSFLLTDEPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLD 174

Query: 134 ----GIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
               GIELTVFS N+ A++ Y + G  L+  SP+D+
Sbjct: 175 PLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDE 210

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 77.4 bits (189), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 71/153 (46%), Gaps = 10/153 (6%)

Query: 23  KQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSY-WNVESNELVCFCS 81
           K L +++ NLG                W+ NK QEM +E L +V Y    E   +  + S
Sbjct: 69  KILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLS 128

Query: 82  IMPCEESIVEGEM---SNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAH------L 132
               +ES    ++   S +IYLYEI + PE RN   G  ++    +      H      +
Sbjct: 129 FTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDI 188

Query: 133 SGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
            GIELTVFS N  AI FY   G  L+ DSP+DK
Sbjct: 189 IGIELTVFSDNTNAIRFYETIGMKLTPDSPNDK 221

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 76.3 bits (186), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 80/162 (49%), Gaps = 19/162 (11%)

Query: 20  ILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNE---L 76
           IL   L+L++ NLG                W+ NK +EM +E + +VSYW    +E    
Sbjct: 78  ILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVP 137

Query: 77  VCFCSIMPCEESIVE--GEMSNIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPKAHL- 132
           + F S M  EE  +     +S++I+LYEI ++ E R Q  G+  L N L +  C K  L 
Sbjct: 138 LLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQ--CAKRLLD 195

Query: 133 ----------SGIELTVFSSNERAINFYRNNGFTLSYDSPSD 164
                     +GIELTVF+ N  AIN Y+  G T + +SP D
Sbjct: 196 NDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD 237

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 75.5 bits (184), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 84/165 (50%), Gaps = 17/165 (10%)

Query: 18  DKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESNELV 77
           D +L K L +++ NLG                W+ NK  EM SE L +V Y +  + E +
Sbjct: 66  DVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPL 125

Query: 78  CFCSIMPCEE-SIV------EGEMSN----IIYLYEIHVAPEWRNQKFGKSIL-NALKEK 125
            F S M  ++ S+V        E+SN    +IYLYEI +    RNQK G  ++ N LK+ 
Sbjct: 126 LFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKT 185

Query: 126 L-----CPKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165
           +       + ++  +ELTVFS+N  AINFY+  G   + DSP DK
Sbjct: 186 IEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDK 230

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%), Gaps = 8/159 (5%)

Query: 13  ISNSNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXR-WQSNKWQEMCSENLFHVSYWNV 71
           +      +L++ L L+  NLG               + W + K  EM +  L +V Y + 
Sbjct: 70  VPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDS 129

Query: 72  ESNELVCFCSIMPCEESIVEGEMS-NIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPK 129
            S  LV F S++  +E  +  E++  ++YL+EIHV+   R Q  G  +L + L   L   
Sbjct: 130 HSQPLV-FMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASL 188

Query: 130 AHLS----GIELTVFSSNERAINFYRNNGFTLSYDSPSD 164
           +  S    G ELTVFS N+RA+  Y   G  ++  SP D
Sbjct: 189 SRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 26/172 (15%)

Query: 18  DKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSY--------- 68
           +K+L + L++++ NLG                W+ NKW+EM +  L +V Y         
Sbjct: 58  EKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTAT 117

Query: 69  --WNVESNELVCFCSIMPCEESIVEGEMS---NIIYLYEIHVAPEWRNQKFGKSILN--- 120
              N   + L+    ++  E+ +V  + +    ++YLYE+ + P  R       +L    
Sbjct: 118 QRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHL 177

Query: 121 -ALKEKLCP--------KAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPS 163
                +LC         K    G+ELTVF+ N  AI  Y + G  L+ DSP+
Sbjct: 178 AQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPT 229

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 49  RWQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNI----IYLYEIH 104
           +W   KW EM  ++L ++  +  ++ ++V F S+   +    E + S +    ++LYEIH
Sbjct: 85  KWIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIH 144

Query: 105 VAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLS 158
           +  E++++  G  I N L   L        IEL VF++N+ A  +Y+  GF L+
Sbjct: 145 LMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGFQLT 198

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 67/149 (44%), Gaps = 15/149 (10%)

Query: 16  SNDKILEKQLQLIEINLGSXXXXXXXXXXXXXXRWQSNKWQEMCSENLFHVSYWNVESN- 74
             D+ L   +QL++ +LG+               W++NK  EM S  L +V YW  ++  
Sbjct: 65  DGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQG 124

Query: 75  --ELVCFCSIMPCEES-IVEGEMSN-----IIYLYEIHVAPEWRNQKFGKSILNALKEKL 126
              L  F S M  EE+ +VEG+ ++     +IYLYE+H           + +  AL E +
Sbjct: 125 ERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXX-HRGRGLGRRLLAKALCEGV 183

Query: 127 CPKAH-----LSGIELTVFSSNERAINFY 150
             +       L G+ LTVF  N RA   Y
Sbjct: 184 AARVRRTCDDLFGVALTVFGDNTRARRLY 212

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 96  NIIYLYEIHVAPEWRNQKFGKSIL---NALKEKLCPK-AHLSGIELTVFSSNERAINFYR 151
            ++Y+ EIHV+P ++NQ  G  +L     L + + P    L G+ELTVF+ N +A+  YR
Sbjct: 158 KVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYR 217

Query: 152 NNGFTLSYDS 161
             GF  + ++
Sbjct: 218 RQGFKTATNT 227

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 8/106 (7%)

Query: 50  WQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEW 109
           W   K  E+      H+ Y +  +  L CF S++      + G    ++Y+ E+HVA  +
Sbjct: 73  WPRCKRAELLDPAALHILYRD-PAGRLACFISLL------LPGPADPVLYILELHVAAPF 125

Query: 110 RNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGF 155
           R +    ++L+A        A L+ +ELTVF++N  A+  Y   GF
Sbjct: 126 RRRGLAAALLDAATRTAR-AAGLTRLELTVFTANRPALALYARAGF 170

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 71/156 (45%), Gaps = 11/156 (7%)

Query: 20  ILEKQLQLIEINLGSXXXXXXXXXXXXX-XRWQSNKWQEMCSENLFHVSYWNVES----- 73
           +LE+ L L++ NLG                 W+  K QEM +  L +V Y  V+      
Sbjct: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111

Query: 74  NELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILN---ALKEKLCPKA 130
              + F S++  +E  +    + ++YL EIHVA   R    G ++L    A   +   +A
Sbjct: 112 GLPLAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGARRA 171

Query: 131 H--LSGIELTVFSSNERAINFYRNNGFTLSYDSPSD 164
           H  + G ELTVF+ NE A+  Y   G  ++  SP D
Sbjct: 172 HPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQD 207

>NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON}
           Anc_8.697 YOR253W
          Length = 195

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 98  IYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGF 155
           IY+  + VA EWR+ + GK +L  ++++ C    L  I + V ++N+RAI +Y +NGF
Sbjct: 111 IYIETLVVAKEWRSHRLGKLLLKFIEDE-CQNYFLHNIIVHVSTNNKRAIKWYFSNGF 167

>Skud_4.27 Chr4 (43930..44502) [573 bp, 190 aa] {OFF} YPR051W (HSP)
          Length = 190

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 102 EIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTL 157
           +I VAPE R    G++++  L  +   +     + L V + N  AI+ YR  GFTL
Sbjct: 110 DIEVAPEHRGHGVGRALMG-LATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTL 164

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 73  SNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHL 132
            NE   F  +    +S  E   +  + L  I++  +++ +  G+ +++ + + +      
Sbjct: 76  DNEAAAFIKVND-HKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHD-IAQSYGK 133

Query: 133 SGIELTVFSSNERAINFYRNNGFTLSYD 160
             I L V+  N++AI+FY+  GF ++ D
Sbjct: 134 KKIWLGVWEHNQKAIDFYKKFGFEITGD 161

>KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat- shock resistance mating sporulation and
           telomeric silencing
          Length = 163

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 98  IYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTL 157
           +Y+  + V   +R +  G  +L  +++K C ++    I + V + NE AI +Y  NGF+ 
Sbjct: 80  MYIEVLAVLEAYRGKTAGSLMLKYIEDK-CKESFQHDIYVHVATDNETAIEWYEKNGFSR 138

Query: 158 SYD 160
             D
Sbjct: 139 DGD 141

>Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON}
           similar to Ashbya gossypii AAL102C
          Length = 166

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 98  IYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTL 157
           +++  + V   +R +  G  +L  + E  C + H S +   V S+NE A+ +Y  +GF L
Sbjct: 83  VHIETLDVLKAYRGKGVGSKLLEYV-ENRCKQYHQSELYTYVPSNNEGAVEWYLKHGFKL 141

Query: 158 SYD 160
           + D
Sbjct: 142 NND 144

>NDAI0G03270 Chr7 complement(768935..769405) [471 bp, 156 aa] {ON}
           Anc_8.58 YFL017C
          Length = 156

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 6/89 (6%)

Query: 70  NVESNELVCFCSIMPCEESIVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPK 129
           +V ++E+    +I+  ++ I EG +    ++ +I V+   + +K GK++L  L +     
Sbjct: 66  DVNTDEVAAVGNIILEQKLIHEGGICG--HIEDIAVSKNHQGKKLGKALLGYLSDL---- 119

Query: 130 AHLSGIELTVFSSNERAINFYRNNGFTLS 158
              SG    +   NE+ + FY   G++ +
Sbjct: 120 GFQSGCYKIILDCNEKNVKFYEKCGYSTT 148

>NDAI0E01060 Chr5 complement(211581..212093) [513 bp, 170 aa] {ON}
           Anc_8.697 YOR253W
          Length = 170

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 98  IYLYEIH-----VAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRN 152
           I+L  +H     V  ++R  + G  +LN ++E+ C   H   + + V +     I +Y+N
Sbjct: 77  IFLKGVHIEFMTVLEQYRGNQIGTKLLNYIEEQ-CQSHHQHNVYVHVPTDETNKIEWYKN 135

Query: 153 NGFTLS 158
           +GF + 
Sbjct: 136 HGFEID 141

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 98  IYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTL 157
           +Y+  + V   +R +  G  +L  ++E+ C K     + + V + NE+A+++Y+  GF +
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQ-CKKHFQHNLYVHVATDNEKALSWYQKKGFKV 137

Query: 158 SYD 160
             D
Sbjct: 138 EGD 140

>TDEL0A06420 Chr1 (1124798..1125301) [504 bp, 167 aa] {ON} Anc_8.697
           YOR253W
          Length = 167

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 98  IYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFT 156
           +Y+  + V   +R +  G  +L+ + E  C K     I + V + NE AIN+Y  +GF 
Sbjct: 83  VYIEILVVLEHYRGKGIGGKLLSYV-ETECKKHFQHDIYVHVATDNESAINWYIKHGFV 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,487,432
Number of extensions: 694434
Number of successful extensions: 1564
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1552
Number of HSP's successfully gapped: 34
Length of query: 188
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 85
Effective length of database: 41,670,801
Effective search space: 3542018085
Effective search space used: 3542018085
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)