Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0B01958g2.530ON33630714300.0
TDEL0A030502.530ON3552979861e-133
KAFR0A018302.530ON4423258971e-118
NCAS0F009302.530ON4223248591e-113
Skud_8.492.530ON4473398611e-112
YHR004C (NEM1)2.530ON4463388571e-112
Suva_8.582.530ON4523438531e-111
CAGL0K02959g2.530ON4643268361e-109
SAKL0A09416g2.530ON3853118241e-108
NDAI0H014202.530ON4483298291e-108
KNAG0C058502.530ON4433368281e-108
TPHA0G035002.530ON3923398161e-107
Smik_8.532.530ON4463388141e-105
KLTH0D06776g2.530ON4093428071e-105
Kwal_26.80012.530ON4133418061e-105
Kpol_348.82.530ON4223478041e-104
AGL070W2.530ON3432867671e-100
Ecym_72572.530ON3522897642e-99
TBLA0I014602.530ON3933357655e-99
KLLA0E18613g2.530ON3742986514e-82
Suva_10.995.202ON3851662634e-25
YLR019W (PSR2)5.202ON3971662626e-25
Kpol_478.165.202ON3501912606e-25
Smik_12.825.202ON3921662582e-24
TPHA0E030705.202ON4941712603e-24
NDAI0I021705.202ON3911932564e-24
Skud_12.875.202ON3921712555e-24
CAGL0D05610g5.202ON4471662532e-23
SAKL0G12870g5.202ON3991712503e-23
TBLA0C060905.202ON4841642514e-23
NDAI0D018605.202ON5141672514e-23
Kpol_2002.1005.202ON4771622505e-23
TBLA0H019905.202ON6882272526e-23
KLLA0F15620g5.202ON4141712452e-22
Ecym_71045.202ON4921682435e-22
CAGL0D03234g5.202ON4101712415e-22
NCAS0D027405.202ON3981682407e-22
Smik_12.535.202ON4141832399e-22
TDEL0E042705.202ON4531662401e-21
ZYRO0B10428g5.202ON4822412401e-21
YLL010C (PSR1)5.202ON4271762372e-21
KAFR0J009905.202ON4831722364e-21
KNAG0M017405.202ON4811712355e-21
Suva_10.655.202ON4151712345e-21
TPHA0N006705.202ON4521712355e-21
Skud_12.575.202ON4151712346e-21
AAL158W5.202ON4781662339e-21
Kwal_33.151405.202ON4101532283e-20
KLTH0B03388g5.202ON4091532258e-20
NCAS0A068005.202ON4731622241e-19
ZYRO0F09130g8.527ON4891041728e-13
YPL063W (TIM50)8.527ON4761041711e-12
TDEL0B031908.527ON4771041711e-12
TPHA0I020008.527ON4781041647e-12
Smik_16.1728.527ON4771041631e-11
Suva_16.2498.527ON4801041631e-11
NDAI0E029108.527ON4411041593e-11
SAKL0H10296g8.527ON478981593e-11
Kpol_457.58.527ON489981584e-11
NCAS0C022108.527ON4911041567e-11
Skud_16.2188.527ON4801041551e-10
Kwal_27.119908.527ON4741041542e-10
CAGL0H05159g8.527ON4851041504e-10
KLTH0E12254g8.527ON4761041505e-10
KLLA0E23101g8.527ON4801041487e-10
TBLA0A005408.527ON485981462e-09
KNAG0A020608.527ON4501381433e-09
Ecym_11778.527ON490981391e-08
KAFR0E010208.527ON4481041381e-08
ADR045W8.527ON4761041264e-07
Kpol_1068.98.839ON745126860.037
KLTH0C03894g8.839ON745108830.079
TBLA0D032608.839ON76895820.11
Ecym_46108.839ON751106810.14
TPHA0I002408.839ON732109810.16
SAKL0B02926g8.92ON47565693.6
ZYRO0A08976g2.413ON86735678.0
TDEL0C008508.59ON353112668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0B01958g
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   555   0.0  
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   384   e-133
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   350   e-118
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   335   e-113
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   336   e-112
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   334   e-112
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   333   e-111
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   326   e-109
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   322   e-108
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    323   e-108
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   323   e-108
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   318   e-107
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   318   e-105
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   315   e-105
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   315   e-105
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   314   e-104
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   300   e-100
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   298   2e-99
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   299   5e-99
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   255   4e-82
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...   105   4e-25
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   105   6e-25
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...   104   6e-25
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...   103   2e-24
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   104   3e-24
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202    103   4e-24
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...   102   5e-24
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...   102   2e-23
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   100   3e-23
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...   101   4e-23
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202    101   4e-23
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   100   5e-23
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...   101   6e-23
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    99   2e-22
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    98   5e-22
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    97   5e-22
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    97   7e-22
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    97   9e-22
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    97   1e-21
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    97   1e-21
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    96   2e-21
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    96   4e-21
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    95   5e-21
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    95   5e-21
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    95   5e-21
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    95   6e-21
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    94   9e-21
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    92   3e-20
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    91   8e-20
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    91   1e-19
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    71   8e-13
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    70   1e-12
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    70   1e-12
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    68   7e-12
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    67   1e-11
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    67   1e-11
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    66   3e-11
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    66   3e-11
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    65   4e-11
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     65   7e-11
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   1e-10
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    64   2e-10
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    62   4e-10
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    62   5e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    62   7e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    61   2e-09
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    60   3e-09
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    58   1e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    58   1e-08
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    53   4e-07
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...    38   0.037
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...    37   0.079
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...    36   0.11 
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...    36   0.14 
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    36   0.16 
SAKL0B02926g Chr2 (273721..275148) [1428 bp, 475 aa] {ON} highly...    31   3.6  
ZYRO0A08976g Chr1 complement(718141..720719,721035..721059) [260...    30   8.0  
TDEL0C00850 Chr3 complement(138626..139687) [1062 bp, 353 aa] {O...    30   8.2  

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/307 (89%), Positives = 275/307 (89%)

Query: 30  HGVLVXXXXXXXXXXXXXXXXXXXXXGESIFLKPFHLIWFVITSPLILIEYGLKSKQKVE 89
           HGVLV                     GESIFLKPFHLIWFVITSPLILIEYGLKSKQKVE
Sbjct: 30  HGVLVESEEEQEDNDEVNQFQNENDEGESIFLKPFHLIWFVITSPLILIEYGLKSKQKVE 89

Query: 90  STSRKGEIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILF 149
           STSRKGEIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILF
Sbjct: 90  STSRKGEIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILF 149

Query: 150 AERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLS 209
           AERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLS
Sbjct: 150 AERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLS 209

Query: 210 KVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTE 269
           KVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTE
Sbjct: 210 KVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTE 269

Query: 270 VLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLK 329
           VLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD           RYVTDVRSILGLK
Sbjct: 270 VLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLK 329

Query: 330 NGEKALG 336
           NGEKALG
Sbjct: 330 NGEKALG 336

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  384 bits (986), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 189/297 (63%), Positives = 225/297 (75%), Gaps = 20/297 (6%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKG---EIIRKKEVDDDLAEDEMFLQ 115
           + +KP  LIW++I+ PL+LIEYGLKS+ + +ST R     + I + E DD    DE+FLQ
Sbjct: 57  LIIKPTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTLQSISELEEDDLAGGDEIFLQ 116

Query: 116 RDTVKGGLRGKAF--------------GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLD 161
           RD VKG L    +              GTK+MGRFLFPKKL+P+S+L AE++KRLVVDLD
Sbjct: 117 RDAVKGSLAPAKYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEKRKRLVVDLD 176

Query: 162 ETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFT 221
           ETLIHSA+R+ SHSNSAQGHMVE+RF  S +STLYYVHKRPHCDLFLSKVSKWYDL++FT
Sbjct: 177 ETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFT 236

Query: 222 ASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVV---TEVLDEVVLID 278
           ASM+EYADPVIDWLE SF+G+F KRLYR+NC++R+GVGYIKDLS+V   T  L EV+L+D
Sbjct: 237 ASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVD 296

Query: 279 NSPTSYARNEDNAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           NSP SYA N DNAIQVEGWISDPSDTD           RY TDVR IL LKN E+A 
Sbjct: 297 NSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  350 bits (897), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 214/325 (65%), Gaps = 50/325 (15%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEV----------DDDLA 108
           +FL P   +WF++T PL L+E G+K + + +    +G      E+          ++DL+
Sbjct: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLS 172

Query: 109 -EDEMFLQRDTVKGGL-------------------------RGKAFGTKKMGRFLFPKKL 142
             DE FLQRDT+KG L                             FGTKKMGRFLFPKKL
Sbjct: 173 TSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKL 232

Query: 143 VPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRP 202
           +P+SIL  ERKK LVVDLDETLIHS +R  +H NS+QGH+VEV+F  + ISTLYYVHKRP
Sbjct: 233 IPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRP 292

Query: 203 HCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIK 262
            CDLFLSKVSKWY+++IFTASMKEYADPVIDWLE SF G F KRLYRHNC++R+GVGYIK
Sbjct: 293 FCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIK 352

Query: 263 DLSVV--------------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXX 308
           DLSV+               E L EV++IDNSP SYA N DNAIQVEGWISDP+DTD   
Sbjct: 353 DLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLN 412

Query: 309 XXXXXXXXRYVTDVRSILGLKNGEK 333
                   RY TDVR++L LKNGEK
Sbjct: 413 LLPILEALRYTTDVRNVLALKNGEK 437

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  335 bits (859), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 215/324 (66%), Gaps = 47/324 (14%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSK---------------QKVESTSRKGEIIRKKEV 103
           + +KP   +WF++T PL L+E G+K +               ++V +TS +  +I +   
Sbjct: 96  LIVKPLLFLWFIVTFPLYLLERGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTE 155

Query: 104 DDDLAEDEMFLQRDTVKGGL--------------------RGKAFGTKKMGRFLFPKKLV 143
           DD    DE++LQRDT+KG L                       +F +K+MG+FLFPKKL+
Sbjct: 156 DDLAGGDEIYLQRDTIKGSLLKATSAKQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLI 215

Query: 144 PQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPH 203
           P+SI+   R+K+LV+DLDETLIHS +R  +HSNS+QGH+VEV+F  S +STLYYVHKRP+
Sbjct: 216 PRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPY 275

Query: 204 CDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKD 263
           CD FLSKVSKWYDLIIFTASMKEYADPVIDWLE S   KF +RLYR +C++R+GVGYIKD
Sbjct: 276 CDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKD 335

Query: 264 LSVVTEV------------LDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXXXXX 311
           LSV++E             L E+++IDNSP SYA N +NAIQVEGWISDP+D        
Sbjct: 336 LSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLP 395

Query: 312 XXXXXRYVTDVRSILGLKNGEKAL 335
                R+ TDVR++L LKNGEKA 
Sbjct: 396 LLEALRFTTDVRNVLALKNGEKAF 419

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  336 bits (861), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 216/339 (63%), Gaps = 61/339 (17%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQK----------VESTS-------------RKG 95
           + +KP   +WFV T PL +IE  +K   K          V STS             + G
Sbjct: 107 LIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNG 166

Query: 96  EIIRKKE-VDDDL-AEDEMFLQRDTVKGGL-------------------------RGKAF 128
            +    E VDDDL A DE+ LQRD VKG L                             F
Sbjct: 167 NLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVF 226

Query: 129 GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFP 188
           GTK+MGRFLFPKKL+P+SIL  ++KK+LV+DLDETLIHSA+RS +HSNS+QGH+VEV+F 
Sbjct: 227 GTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFG 286

Query: 189 PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLY 248
            S I TLY++HKRP+CD FL+KVS+WYDLIIFTASMKEYADPVIDWLESSF   F KR Y
Sbjct: 287 ISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYY 346

Query: 249 RHNCVVREGVGYIKDLSVVT-----------EVLDEVVLIDNSPTSYARNEDNAIQVEGW 297
           R +CV+R+GVGYIKDLS++              LD+V++IDNSP SYA N DNAIQVEGW
Sbjct: 347 RSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGW 406

Query: 298 ISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           ISDP+DTD           RY TDVR+IL LK+GEKA  
Sbjct: 407 ISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 445

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  334 bits (857), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/338 (53%), Positives = 217/338 (64%), Gaps = 60/338 (17%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGE---------IIRKKE------- 102
           + +KP   +WFV T PL +IE  +K   K    S   E         I    E       
Sbjct: 107 LIIKPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNC 166

Query: 103 --------VDDDL-AEDEMFLQRDTVKGGL-RGKA------------------------F 128
                   V+DDL A DE+ LQRD VKG L R ++                        F
Sbjct: 167 NLNTIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVF 226

Query: 129 GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFP 188
           GTK+MGRFLFPKKL+P+S+L  ++KK+LV+DLDETLIHSA+RS +HSNS+QGH+VEV+F 
Sbjct: 227 GTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFG 286

Query: 189 PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLY 248
            S I TLY++HKRP+CDLFL+KVSKWYDLIIFTASMKEYADPVIDWLESSF   F KR Y
Sbjct: 287 LSGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYY 346

Query: 249 RHNCVVREGVGYIKDLSVV----------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWI 298
           R +CV+R+GVGYIKDLS+V          +  LD+V++IDNSP SYA N DNAIQVEGWI
Sbjct: 347 RSDCVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWI 406

Query: 299 SDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           SDP+DTD           RY TDVR+IL LK+GEKA  
Sbjct: 407 SDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 179/343 (52%), Positives = 218/343 (63%), Gaps = 65/343 (18%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLK--SKQKVES----------TSRKGEIIRKKE---- 102
           + +KP   +WFV T PL +IE  +K   K+  ES          +S  G+   K++    
Sbjct: 108 LIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNR 167

Query: 103 --------VDDDL-AEDEMFLQRDTVKGGLRGKA-------------------------- 127
                   V+DDL A DE+ LQRD VKG L   A                          
Sbjct: 168 NLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTA 227

Query: 128 ---FGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVE 184
              FGTK+MGRFLFPKKL+P+SIL  ++KK+LV+DLDETLIHSA+R  +HSNS+QGH+VE
Sbjct: 228 NTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHLVE 287

Query: 185 VRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC 244
           V+F  S ISTLY++HKRP+CDLFL+K SKWYDLIIFTASMKEYADPVIDWLE SF   F 
Sbjct: 288 VKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAASFS 347

Query: 245 KRLYRHNCVVREGVGYIKDLSVVT-----------EVLDEVVLIDNSPTSYARNEDNAIQ 293
           KR YR +CV+R+GVGYIKDLS++              LD+V++IDNSP SYA N DNAIQ
Sbjct: 348 KRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAMNVDNAIQ 407

Query: 294 VEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           VEGWISDP+DTD           RY TDVR+IL LK+GEKA  
Sbjct: 408 VEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 450

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 214/326 (65%), Gaps = 49/326 (15%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKV---------------ESTSRKGEIIRKKEV 103
           I +KP   +WF++T PL LIE+ ++ + K                 S S++  +I +   
Sbjct: 136 ILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKDNSPSKRLNVIEEAIE 195

Query: 104 DDDLAEDEMFLQRDTVKGGL---------------RGKA-----------FGTKKMGRFL 137
           DD ++ + M LQ+D +KG L               RGK             GTK MGRF 
Sbjct: 196 DDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQ 255

Query: 138 FPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYY 197
           FPKKL+P+SIL++E+KK LV+DLDETLIHS +R  +HSNS+Q H++EVRF  S +STLYY
Sbjct: 256 FPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYY 315

Query: 198 VHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREG 257
           VHKRP+CDLFLSKV KWY+LIIFTASMKEYADPVIDWLESSF+G F +R+YR++C+ R+G
Sbjct: 316 VHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDG 375

Query: 258 VGYIKDLSVV--------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXXX 309
           VGYIKDL  +        T  L +VV+IDNSP SYA + DNAIQVEGWISDP+DT+    
Sbjct: 376 VGYIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNL 435

Query: 310 XXXXXXXRYVTDVRSILGLKNGEKAL 335
                  RY TDVR++L LKN EKA 
Sbjct: 436 LPFLEALRYTTDVRNVLALKNSEKAF 461

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  322 bits (824), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 216/311 (69%), Gaps = 35/311 (11%)

Query: 61  LKPFHLIWFVITSPLILIEYGL---KSKQKVESTSRKGE-------IIRKKEVDDDLAED 110
           +KP    W++IT PL LIE+     + ++  E  +  G+        I  +E ++DLA D
Sbjct: 74  IKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSINIIVEEDEEDLAGD 133

Query: 111 EMFLQRDTVKGGLR------------------------GKAFGTKKMGRFLFPKKLVPQS 146
           E+ LQ D VKG L                         G A G+++MGRFLFPKKL+PQS
Sbjct: 134 EIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKLIPQS 193

Query: 147 ILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDL 206
           +L  E+KK LV+DLDETLIHS +R  S SNS+QGHMVEV+F  S IS+LY+VHKRP+CDL
Sbjct: 194 VLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKRPYCDL 253

Query: 207 FLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSV 266
           FLSKV+KWY L++FTASMKEYADPVIDWLESSF+G F +RLYR +C++R+GVGYIKDLS+
Sbjct: 254 FLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSL 313

Query: 267 VT-EVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSI 325
           ++ + L+E++++DNSP SYA N DNAIQVEGWISDP+DTD           R+ TD+R++
Sbjct: 314 ISKKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNV 373

Query: 326 LGLKNGEKALG 336
           L LK+GE+A  
Sbjct: 374 LSLKSGEQAFN 384

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  323 bits (829), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 164/329 (49%), Positives = 209/329 (63%), Gaps = 52/329 (15%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSR----------------------KGE 96
           + +KP   +W+++T PL LIE G K + +  S S+                      K +
Sbjct: 116 LIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSKLD 175

Query: 97  IIRKKEVDDDLAEDEMFLQRDTVKGGL--------------------RGKAFGTKKMGRF 136
            I +   DD ++ D ++LQRD VKG L                       +F +K+MG+F
Sbjct: 176 AINELTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRSMKTMVSNNTSFSSKRMGKF 235

Query: 137 LFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY 196
           LFPKKL+P+SI   ER+K+LV+DLDETLIHS +R  +H+N +QGH+VEV+F  S +S LY
Sbjct: 236 LFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLY 295

Query: 197 YVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVRE 256
           YVHKRP+CD FLSKV KWYDLIIFTASMKEYADPVIDWLE+SF G F +R YR +C+ R+
Sbjct: 296 YVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRD 355

Query: 257 GVGYIKDLSVV----------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDX 306
           GVGYIKDL+++          T  L EV+++DNSP SYA N DNAIQVEGWISDP+DT  
Sbjct: 356 GVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTAL 415

Query: 307 XXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
                     RY TDVRSIL LKNGE+A 
Sbjct: 416 LNLLPLLEALRYTTDVRSILALKNGERAF 444

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  323 bits (828), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 178/336 (52%), Positives = 219/336 (65%), Gaps = 60/336 (17%)

Query: 59  IFLKPFHLIW-------FVITSPLILIEYGLK----SKQKVESTS--------RKGEIIR 99
           IF  P +LI+       F++T PL L+E G+K     K K E  S        + G I  
Sbjct: 108 IFFLPTYLIYKPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSI-- 165

Query: 100 KKEVDDDLAE-DEMFLQRDTVKGGL-----------------------------RGKAFG 129
            +EV++DLA  DE +LQRD VKG L                                 FG
Sbjct: 166 NEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFG 225

Query: 130 TKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPP 189
           TKKMGRFLFPKKL+P+SIL  E+KK LV+DLDETLIHS +R  +H NS+QGH+VEV+F  
Sbjct: 226 TKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSI 285

Query: 190 SSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYR 249
           S +STLYYV KRP+CDLFL+KVSKWYD++IFTASMKEYADPVIDWLESSF GKF +RLYR
Sbjct: 286 SGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYR 345

Query: 250 HNCVVREGVGYIKDLSVVT---------EVLDEVVLIDNSPTSYARNEDNAIQVEGWISD 300
           ++C++R+GVGYIKDL +VT         + L++V+++DNSP SYA N DNAIQVEGWI+D
Sbjct: 346 NDCILRDGVGYIKDLKMVTRGSNLGTSPDRLEDVIIVDNSPVSYALNVDNAIQVEGWIND 405

Query: 301 PSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           P+DTD              TDVR+IL LKNGEKA  
Sbjct: 406 PTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFN 441

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 213/339 (62%), Gaps = 65/339 (19%)

Query: 62  KPFHLIWFVITSPLILIEYG------LKSKQKVESTSRKGEII----------RKKE--- 102
           KP    W+++T PL L E         +  Q   S S    I           RK+    
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 103 ------VDDDLAEDEMFLQRDTVKGGL--------------RGK------------AFGT 130
                 ++DD+   EM LQRDTVKG L               GK            AFGT
Sbjct: 111 QNLDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFGT 170

Query: 131 KKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPS 190
           KKMGRFLFPKKL+P+SIL + RKK+LV+DLDETLIHS +RS S+SN+AQ H+VEV+F  S
Sbjct: 171 KKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQIS 230

Query: 191 SISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH 250
            ISTLYYVHKRP+CDLFLS VSKWYDLIIFTASMKEYADPVIDWLESSF G F KR YR+
Sbjct: 231 GISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYRN 290

Query: 251 NCVVREGVGYIKDLSVVTE--------------VLDEVVLIDNSPTSYARNEDNAIQVEG 296
           +C++R+GVGYIKDLS++ +              +L E++LIDNSP SYA N DNAIQVEG
Sbjct: 291 HCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAIQVEG 350

Query: 297 WISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           WISDP+D D           RY TDVR+IL LKNGE+A 
Sbjct: 351 WISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  318 bits (814), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 221/338 (65%), Gaps = 60/338 (17%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLK--SKQKVESTSRKG-------------EIIRKKE- 102
           + +KP   +W+V T PL +IE  +K   K+  ES+  +              E I  K  
Sbjct: 107 LVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNC 166

Query: 103 --------VDDDL-AEDEMFLQRDTVKGGL-RGKA------------------------F 128
                   V+DDL A DE+ LQRD VKG L R ++                        F
Sbjct: 167 NLNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVF 226

Query: 129 GTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFP 188
           GTK+MGRFLFPKKL+P+S+L  ++KK+LV+DLDETLIHSA+RS +HSNS+QGH+VEV+F 
Sbjct: 227 GTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFG 286

Query: 189 PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLY 248
            S I TLY++HKRP+CDLFL+KVSKWY+LIIFTASMKEYADPVIDWLESSF   F +R Y
Sbjct: 287 ISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYY 346

Query: 249 RHNCVVREGVGYIKDLSVV----------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWI 298
           R +CV+R+GVGYIKDLS++          +  LD+V++IDNSP SYA N DNAIQVEGWI
Sbjct: 347 RSDCVLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWI 406

Query: 299 SDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           SDP+DTD           RY TDVR+IL LK+GEKA  
Sbjct: 407 SDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  315 bits (807), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 170/342 (49%), Positives = 213/342 (62%), Gaps = 65/342 (19%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQK----------VESTSRKGEIIRKK------- 101
           I +KP   +WFVIT PL LIE    S+ +           +S +  G I  K        
Sbjct: 65  IVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTI 124

Query: 102 -EVDDDLAEDEMFLQRDTVKGGLR------------------------------------ 124
            E +DDLA +EM LQ DTVKG L                                     
Sbjct: 125 TEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTSS 184

Query: 125 ---------GKAFGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHS 175
                    G A G+++MGRFLFPKKL+PQS+L   +++ LV+DLDETLIHS +R  S S
Sbjct: 185 VRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSS 244

Query: 176 NSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWL 235
           NS+QGHMVEV+F  S ISTLY+VHKRP+CDLFL+K++KWY+L++FTASMKEYADPVIDWL
Sbjct: 245 NSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWL 304

Query: 236 ESSFTGKFCKRLYRHNCVVREGVGYIKDLSVV--TEVLDEVVLIDNSPTSYARNEDNAIQ 293
           ESSF GKF +RLYR +C++R+GVGYIKDLSVV     L ++ +IDNSP SYA + DNAIQ
Sbjct: 305 ESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQ 364

Query: 294 VEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           VEGWISDP+DTD           R+ TD+R++L LK+GE A 
Sbjct: 365 VEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAF 406

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  315 bits (806), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 212/341 (62%), Gaps = 64/341 (18%)

Query: 59  IFLKPFHLIWFVITSPLILIEY------------------GLKSKQKVESTS----RKGE 96
           + +KP   +WFVIT PL LIE                    L S ++V +TS     K  
Sbjct: 70  LVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPR 129

Query: 97  IIRKKEVDDDLAEDEMFLQRDTVKGGLR-------------------------------- 124
           I   +E DDDL  DE+FLQ DTVKG L                                 
Sbjct: 130 INTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHSKGSRQSPKAASV 189

Query: 125 --------GKAFGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN 176
                   G A G+++MGRFLFPKKL+PQS+L   + + LV+DLDETLIHS +R  S SN
Sbjct: 190 RSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSSSN 249

Query: 177 SAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLE 236
           S+QGHMVEV+F  S ISTLY+VHKRP+CDLFL+ ++ WY+L++FTASMKEYADPVIDWLE
Sbjct: 250 SSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLE 309

Query: 237 SSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTE--VLDEVVLIDNSPTSYARNEDNAIQV 294
           SSF GKF +RLYR +C++R+GVGYIKDLS V    +L ++ +IDNSP SYA + DNAIQV
Sbjct: 310 SSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIIDNSPVSYAMHVDNAIQV 369

Query: 295 EGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           EGWISDP+DTD           R+ TDVR+IL LK+GE A 
Sbjct: 370 EGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  314 bits (804), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 214/347 (61%), Gaps = 71/347 (20%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEVDDDLAED-----EMF 113
           + +KP   +WF+IT P+ L E   K+K+  +S++    + + K ++  + ED     E+ 
Sbjct: 75  LLVKPIFFLWFLITFPITLFEQ--KNKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEII 132

Query: 114 LQRDTVKGGL-RGKA-------------------FGTKKMGRFLFPKKLVPQSILFAERK 153
           LQRDT+ G L + +A                     +KK+GRFLFPKKL+P+SIL + RK
Sbjct: 133 LQRDTLNGSLLKSRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPKKLIPRSILHSGRK 192

Query: 154 KRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSK 213
           K+LV+DLDETLIHS +RS  +SN+AQ H+VEV+FP S ISTLYYVHKRP+CDLFLSKV +
Sbjct: 193 KKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCR 252

Query: 214 WYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEV--- 270
           WYDLIIFTASMKEYADPVIDWLE+SF G F KR YR++C++R+GVGYIKDLS+V  +   
Sbjct: 253 WYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGS 312

Query: 271 -----------------------------------------LDEVVLIDNSPTSYARNED 289
                                                    L EV+LIDNSP SYA N D
Sbjct: 313 HAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVD 372

Query: 290 NAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           NAIQV+GWISDP+D D           R  TDVR+IL LKNGE+A  
Sbjct: 373 NAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFN 419

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  300 bits (767), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 157/286 (54%), Positives = 202/286 (70%), Gaps = 13/286 (4%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEV------DDDLAEDEM 112
           + +KP  L+WFV+T PL LIE         E+    G    ++E       DDDLA + M
Sbjct: 61  LVVKPVVLVWFVLTFPLSLIE----QTSSKEADGAPGPEAAEEEQLAEAVEDDDLAGESM 116

Query: 113 FLQRDTVKGGLRGKAFGTKK---MGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSAT 169
            LQ D+VK      +  +     +G+FLFPKKL+PQSIL  +RKK LV+DLDETLIHS +
Sbjct: 117 VLQEDSVKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMS 176

Query: 170 RSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYAD 229
           RS S  +++QGHMVEV F  S +STLYYVHKRP+CDLFLS+VSKWYDL+IFTASMKEYAD
Sbjct: 177 RSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYAD 236

Query: 230 PVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNED 289
           PVIDWLES  + +F +R YR +C++R+GVGY+KDLS++++ L +++++DNSP SYA N D
Sbjct: 237 PVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKNLQDIIIVDNSPISYAMNVD 296

Query: 290 NAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           NAIQVEGWISDP+DT            R+ TD R+IL LKNGE+A 
Sbjct: 297 NAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  298 bits (764), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 156/289 (53%), Positives = 200/289 (69%), Gaps = 16/289 (5%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVEST---------SRKGEIIRKKEVDDDLAE 109
           + +KP  LIWFV+T PL LIE+       VE           S  GE+I     DDDL  
Sbjct: 67  LIIKPIWLIWFVLTFPLNLIEHTSSKDGSVEEEEVIPTNSQGSGGGEVIE----DDDLVG 122

Query: 110 DEMFLQRDTVKGGLRGKAFGTKK---MGRFLFPKKLVPQSILFAERKKRLVVDLDETLIH 166
           + M L  D++K      +  +     +G+FLFPKKL+PQSIL  +RKK LV+DLDETLIH
Sbjct: 123 ESMVLHEDSIKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIH 182

Query: 167 SATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKE 226
           S +RS S SN++QGHMVEV F  S +S+LYYVHKRP+CDLFLS+V KWYDL+IFTASM+E
Sbjct: 183 SMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMRE 242

Query: 227 YADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYAR 286
           YADPVIDWLES  + +F KR YR +C++R+G+GY+KDL+++++ L + +++DNSP SYA 
Sbjct: 243 YADPVIDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMISKNLQDTIIVDNSPVSYAM 302

Query: 287 NEDNAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           N DNAIQVEGWISDP+DT            R+ TD R+IL LKNGE A 
Sbjct: 303 NVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  299 bits (765), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 206/335 (61%), Gaps = 57/335 (17%)

Query: 58  SIFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEVD-DDL-AEDEMFLQ 115
           +I +KP   +W++ T PL+LIE     K K        +I      D DDL + DE+ LQ
Sbjct: 56  AILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDLDDLNSNDEIILQ 115

Query: 116 RDTVKGGLRGKA---------------------------------------FGTKKMGRF 136
            D++KG L  K                                         G+K MGRF
Sbjct: 116 TDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIGSKNMGRF 175

Query: 137 LFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFP-----PSS 191
           LFPKKL+P SIL   ++K+L++DLDETLIHS +R++S S  +  H++EV+FP     P+S
Sbjct: 176 LFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVKFPTPTSAPTS 235

Query: 192 -------ISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC 244
                  +S+LYYV+KRP+CD FL+ VS WYDLIIFTASMKEYADPVIDWLE SF G F 
Sbjct: 236 APGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNFQ 295

Query: 245 KRLYRHNCVVREGVGYIKDLSVVT----EVLDEVVLIDNSPTSYARNEDNAIQVEGWISD 300
           KRLYR++C++R+G+GYIKDLSV+       L+E++LIDNSP S+A N DNAIQV+GWISD
Sbjct: 296 KRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELILIDNSPISFAMNVDNAIQVQGWISD 355

Query: 301 PSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKAL 335
           P+DT+           R+ TDVR+IL LKNGE+A 
Sbjct: 356 PTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  255 bits (651), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 136/298 (45%), Positives = 191/298 (64%), Gaps = 25/298 (8%)

Query: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKV----ESTSRKGEIIRKKEVDDDLAE-DEMF 113
           + +KP   IW+VIT PL L+E   +  + +      T  + E + K  V++DL+  DE+ 
Sbjct: 81  LLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRTEKLSKYVVEEDLSPTDEII 140

Query: 114 LQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVS 173
           + +D +K         T+ +G+F FPKKLVPQS+L +  +K LV+DLDETLIHS + S S
Sbjct: 141 INQDKMK-----PRPITEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRS 195

Query: 174 HSNSAQG---------HMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASM 224
             N             H+VEVRFP ++ISTLY V KRP+CD+FL + S+WYD+ IFTASM
Sbjct: 196 LGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASM 255

Query: 225 KEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDL-SVVTEV-----LDEVVLID 278
           KEYADPVIDWL+ + + +F  R YR +C +R GVGY+KD+ +V T++     L ++++ID
Sbjct: 256 KEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIID 315

Query: 279 NSPTSYARNEDNAIQVEGWISDPSDTDXXXXXXXXXXXRYVTDVRSILGLKNGEKALG 336
           NSP SYA + DNAIQV GWI+DPSD++           R+VTD R IL LK+G  ++ 
Sbjct: 316 NSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASIS 373

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score =  105 bits (263), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 97/166 (58%), Gaps = 13/166 (7%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L+P  +L  ++KK L++DLDETL+HS+ + +        H  +   P      ++  YV 
Sbjct: 204 LLPPKLLPFQQKKCLILDLDETLVHSSFKYL--------HTADFVLPVEIDDQVHNVYVI 255

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL +VS+ Y++++FTAS+  YA+P++D L+ + T     RL+R  C   EG  
Sbjct: 256 KRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRT--IHHRLFREACYNYEG-N 312

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L E +++DNSP SY  +  +A+ +  W SD  D +
Sbjct: 313 YIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 358

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score =  105 bits (262), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 97/166 (58%), Gaps = 13/166 (7%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L+P  +   ++KK L++DLDETL+HS+ + +        H  +   P      ++  YV 
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYM--------HSADFVLPVEIDDQVHNVYVI 267

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL++VS+ Y++++FTAS+  YA+P++D L+ +  G    RL+R  C   EG  
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 324

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L E +++DNSP SY  +  +A+ +  W SD  D +
Sbjct: 325 YIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 370

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score =  104 bits (260), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 108/191 (56%), Gaps = 10/191 (5%)

Query: 117 DTVKGGLRGKAFGTKKMGRFLFP--KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSH 174
           D+V+      ++ + +  +F  P    L+P      + +K LV+DLDETL+HS+ + VS 
Sbjct: 141 DSVQDNFSTISYSSLQKNQFHAPGCNTLLPPIQQSLQNRKCLVLDLDETLVHSSFKYVST 200

Query: 175 SNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDW 234
           ++      ++ +F         YV KRP  D FL   SK ++++IFTAS+++Y +P++D 
Sbjct: 201 ADFVLPVDIDDQF------QNVYVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDI 254

Query: 235 LESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQV 294
           L+S+       RL+R  C    G  YIK+L+ +   L +++++DNSPTSY  + ++AI +
Sbjct: 255 LDST-NDLVHHRLFRDACYNYNG-NYIKNLAQLGRPLSDIIILDNSPTSYLFHPNHAIPI 312

Query: 295 EGWISDPSDTD 305
             W SD  D +
Sbjct: 313 SSWFSDAHDNE 323

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 96/166 (57%), Gaps = 13/166 (7%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L+P  +   ++KK L++DLDETL+HS+ + +        H  +   P      ++  YV 
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYM--------HTADFVLPVEIDDQVHNVYVI 262

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FLS+V + Y++++FTAS+  YA+P++D L+ +  G    RL+R  C   EG  
Sbjct: 263 KRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 319

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L E +++DNSP SY  +  +A+ +  W SD  D +
Sbjct: 320 YIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNE 365

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 97/171 (56%), Gaps = 22/171 (12%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L P+ I    RKK L++DLDETL+HS+ + V  ++         Q H V           
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDSADFVIPVTIDNQTHHV----------- 360

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL +VS+ Y++++FTAS+  Y DP+++ L+ + T     RL+R +C  
Sbjct: 361 --YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANT-IIHHRLFRESCYT 417

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  Y+K+LS +   L+E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 418 YEG-NYVKNLSQLGRPLNEIIILDNSPASYIFHPQHAIPISSWFSDIHDNE 467

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score =  103 bits (256), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 102/193 (52%), Gaps = 15/193 (7%)

Query: 140 KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--Y 197
           + L+P        KK LV+DLDETL+HS+ + +        H  +   P      ++  Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 198 VHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREG 257
           V KRP  D FL +V++ Y++++FTAS+  Y DP++D L+SS       RL+R  C   EG
Sbjct: 260 VIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG 317

Query: 258 VGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDXXX--XXXXXXX 315
             Y+K+L+ +   L E+V++DNSP SY  +  +AI +  W SD  D +            
Sbjct: 318 -NYVKNLAQIGRPLSEIVILDNSPASYMFHPQHAIPISSWFSDTHDNELLDIIPLLEDLS 376

Query: 316 XRYVTDVRSILGL 328
            +YV DV  IL +
Sbjct: 377 QKYVPDVGKILDV 389

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  102 bits (255), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 96/171 (56%), Gaps = 23/171 (13%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P  +   ++KK L++DLDETL+HS+ + +  ++         Q H V           
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLPVEIDDQVHNV----------- 259

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL +VS+ Y++++FTAS+  YA+P++D L+ +  G    RL+R  C  
Sbjct: 260 --YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYN 315

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L E +++DNSP SY  +  +A+ +  W SD  D +
Sbjct: 316 YEG-NYIKNLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDSHDNE 365

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 93/166 (56%), Gaps = 14/166 (8%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L P+   F + KK LV+DLDETL+HS+ + +        H  +   P      ++  YV 
Sbjct: 267 LSPKGDAF-KHKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVI 317

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL +V + Y++++FTAS+  Y DP++D L+ S       RL+R  C   EG  
Sbjct: 318 KRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-N 374

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 375 YIKNLSQIGRPLSEIIILDNSPPSYIFHPQHAIPISSWFSDSHDNE 420

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  100 bits (250), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 95/171 (55%), Gaps = 24/171 (14%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L P+  +F E KK LV+DLDETL+HS+ + +  ++         Q H V           
Sbjct: 219 LPPKDPVF-EGKKCLVLDLDETLVHSSFKYLRTADFVIPVEIDDQVHNV----------- 266

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL +V K Y++++FTAS+  Y DP++D L+    G    RL+R +C  
Sbjct: 267 --YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYN 322

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            +G  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 323 YDG-NYIKNLSQIGRPLSDLIILDNSPASYILHPQHAIPISSWFSDAHDNE 372

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 95/164 (57%), Gaps = 7/164 (4%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKR 201
           L+P      + KK L++DLDETL+HS+ + +++ +     ++ +      I  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 202 PHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYI 261
           P  D FL +V KWY+++IFTAS+  YA+P++D L+         RL+R  C   E   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDH-NLINHRLFRDACYNYEN-NFI 413

Query: 262 KDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           K+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 414 KNLSQIGRPLHDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 457

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 96/167 (57%), Gaps = 14/167 (8%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L P+  +  + KK LV+DLDETL+HS+ + + ++        +   P +    ++  YV 
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLPNA--------DFNLPVNIDDQIHNVYVI 383

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGK-FCKRLYRHNCVVREGV 258
           KRP  D FL KV K ++++IFTAS+  Y DP++D L+    GK    RL+R  C   EG 
Sbjct: 384 KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK--GKSIHHRLFREACYNYEG- 440

Query: 259 GYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            YIK+LS +   L E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 441 NYIKNLSQMGRPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNE 487

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  100 bits (250), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 93/162 (57%), Gaps = 23/162 (14%)

Query: 151 ERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSISTLYYVHKRPH 203
           + KK LV+DLDETL+HS+ + +  ++         Q H V             YV KRP 
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFVLPVTIDDQTHQV-------------YVIKRPG 351

Query: 204 CDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKD 263
            D FL +V K +++++FTAS+  Y DP++D L+SS +     RL+R +C + +G  Y+K+
Sbjct: 352 VDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKS--IHHRLFRESCYIYDG-NYVKN 408

Query: 264 LSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 409 LSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 450

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score =  101 bits (252), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 118/227 (51%), Gaps = 44/227 (19%)

Query: 102 EVDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRF-----LFPKK---------LVPQSI 147
           E+++D   D++ +  DT++         T++  +F     L P++         L PQ+ 
Sbjct: 456 EINEDA--DQIMIDSDTIEDEFNPYLDETQQQQQFVDLTVLQPQQYHAMGFNTLLPPQNQ 513

Query: 148 LFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSISTLYYVHK 200
           +F+  KK L++DLDETL+HS+ + ++ ++         Q H V             YV K
Sbjct: 514 IFS-GKKCLILDLDETLVHSSFKYLTSADFVIPVDIDEQIHNV-------------YVIK 559

Query: 201 RPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC--KRLYRHNCVVREGV 258
           RP  D FL  VSK +++++FTAS+  Y DP++D L+       C   RL+R  C   EG 
Sbjct: 560 RPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDK----HRCIHHRLFREACYDYEG- 614

Query: 259 GYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            YIK+LS +   L E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 615 NYIKNLSQIGRPLSELIILDNSPASYIFHPQHAIPISSWFSDTHDNE 661

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/171 (35%), Positives = 98/171 (57%), Gaps = 24/171 (14%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P++ +F + KK LV+DLDETL+HS+ + +  ++         Q H V           
Sbjct: 234 LLPKADMF-KGKKCLVLDLDETLVHSSFKYLRTADFVIPVEIDNQVHNV----------- 281

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL ++++ Y++++FTAS+  Y DP++D L+   T     RL+R +C  
Sbjct: 282 --YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKT--IHHRLFRDSCYN 337

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 338 YEG-NYIKNLSQIGRPLSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNE 387

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 94/168 (55%), Gaps = 13/168 (7%)

Query: 140 KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--Y 197
           + L+P       R+K LV+DLDETL+HS+ + +        H  +   P    + ++  Y
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVY 360

Query: 198 VHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREG 257
           V KRP  D FL +V + Y++++FTAS+  Y DP++D L+         RL+R +C   EG
Sbjct: 361 VIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKHNV--VHHRLFRDSCYNYEG 418

Query: 258 VGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
             YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 419 -NYIKNLSQIGRPLSDLIILDNSPASYIFHPHHAIPISSWFSDAHDNE 465

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 97.4 bits (241), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 93/171 (54%), Gaps = 24/171 (14%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L PQ+  F + KK LV+DLDETL+HS+ + +  ++         Q H V           
Sbjct: 230 LPPQTEQF-KGKKCLVLDLDETLVHSSFKYLRTADFVLPVNIDDQVHNV----------- 277

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL +V + Y++++FTAS+  Y DP++D L+         RL+R  C  
Sbjct: 278 --YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYN 333

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L E++++DNSP SY  +  +AI V  W SD  D +
Sbjct: 334 YEG-NYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNE 383

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 97.1 bits (240), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 95/168 (56%), Gaps = 10/168 (5%)

Query: 138 FPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYY 197
           F   L P+   F+  KK LV+DLDETL+HS+ + V  ++      +E       I  +Y 
Sbjct: 214 FKTLLSPRKPEFS-NKKCLVLDLDETLVHSSFKYVRTADFVLPVEIE-----DQIHNVYV 267

Query: 198 VHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREG 257
           + KRP  D FL +V + Y++++FTAS+  Y DP+++ L+ S       RL+R  C   EG
Sbjct: 268 I-KRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG 324

Query: 258 VGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
             YIK+L+ +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 325 -NYIKNLAQIGRPLSDIIILDNSPASYMFHPQHAIPISSWFSDTHDNE 371

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 96.7 bits (239), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 98/183 (53%), Gaps = 25/183 (13%)

Query: 132 KMGRFLFP--KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHM 182
           + G++  P  K L+P      + KK L++DLDETL+HS+ + +  ++         Q H 
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLPVEIDDQVHN 280

Query: 183 VEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGK 242
           V             YV KRP  + FL +V K +++++FTAS+  Y DP++D L++     
Sbjct: 281 V-------------YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKV-- 325

Query: 243 FCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPS 302
              RL+R  C   EG  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  
Sbjct: 326 IHHRLFREACYNYEG-NYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTH 384

Query: 303 DTD 305
           D +
Sbjct: 385 DNE 387

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 92/166 (55%), Gaps = 14/166 (8%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L P++  F   KK LV+DLDETL+HS+ + +           +   P      ++  YV 
Sbjct: 273 LPPRAPAF-NGKKCLVLDLDETLVHSSFKYL--------RTADFVLPVDIDDQIHNVYVI 323

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL +V   Y++++FTAS+  Y DP++D L+   T     RL+R +C   EG  
Sbjct: 324 KRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKT--IHHRLFRESCYNYEG-N 380

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 381 YIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 426

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 117/241 (48%), Gaps = 37/241 (15%)

Query: 86  QKVESTSRKGEIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKA---FGTK---------KM 133
           Q+  +T ++GE +     D D+A ++     D V   +   A   +G +         ++
Sbjct: 231 QETTTTVQEGENVSSSADDTDVALNQSKSHEDEVDPDMDVDAVPPYGEEEEFVDLTELQL 290

Query: 134 GRFLFP--KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVE 184
           G++       L+P        KK LV+DLDETL+HS+ + +  ++         Q H V 
Sbjct: 291 GQYHAAGCNTLLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGADFVLPVDIDDQIHNV- 349

Query: 185 VRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFC 244
                       YV KRP  D FL KV   ++++IFTAS+  Y DP++D L+   +    
Sbjct: 350 ------------YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKS--VH 395

Query: 245 KRLYRHNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDT 304
            RL+R  C   EG  YIK+LS +   L E++++DNSP SY  +  +AI +  W SD  D 
Sbjct: 396 HRLFREACYNYEG-NYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSWFSDTHDN 454

Query: 305 D 305
           +
Sbjct: 455 E 455

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 99/176 (56%), Gaps = 11/176 (6%)

Query: 132 KMGRFLFP--KKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPP 189
           + G++  P    L+P      + KK L++DLDETL+HS+ + +  ++      VE+    
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQV 291

Query: 190 SSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYR 249
            ++    YV KRP  + FL +V K +++++FTAS+  Y DP++D L++        RL+R
Sbjct: 292 HNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKV--IHHRLFR 345

Query: 250 HNCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
             C   EG  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 346 EACYNYEG-NYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 400

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 95.5 bits (236), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 93/172 (54%), Gaps = 25/172 (14%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P       RKK LV+DLDETL+HS+ + +  ++         Q H V           
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFKYLKSADFVLPVDIDDQIHNV----------- 350

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGK-FCKRLYRHNCV 253
             YV KRP  D FL +V + +++++FTAS+  Y DP++D L+    GK    RL+R  C 
Sbjct: 351 --YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDK---GKSIHHRLFREACY 405

Query: 254 VREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
             EG  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 406 NYEG-NYIKNLSQLGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 456

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (52%), Gaps = 23/171 (13%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P        +K LV+DLDETL+HS+ + +  ++         Q H V           
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFKYLKSADFVLPVDIDDQIHNV----------- 348

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  D FL +V K Y++++FTAS+  Y DP++D L+   +     RL+R  C  
Sbjct: 349 --YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKS--IHHRLFREACYN 404

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L  ++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 405 YEG-NYIKNLSQIGRPLSNIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 454

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 92/171 (53%), Gaps = 23/171 (13%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P      + KK L++DLDETL+HS+ + +  ++         Q H V           
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLPVEIDDQVHNV----------- 282

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  + FL +V K +++++FTAS+  Y DP++D L++        RL+R  C  
Sbjct: 283 --YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKV--IHHRLFREACYN 338

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 339 YEG-NYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 388

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 97/171 (56%), Gaps = 16/171 (9%)

Query: 138 FPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY- 196
           F   L P    FA+RK  LV+DLDETL+HS+ + ++        + +   P    + +  
Sbjct: 268 FDTLLPPIEKKFADRKC-LVLDLDETLVHSSFKYLN--------IADFVLPVDIDNQVQN 318

Query: 197 -YVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCK-RLYRHNCVV 254
            YV KRP  D FL  V   Y++I+FTAS+  Y +P++D L+     K+   RL+R +C V
Sbjct: 319 VYVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPH---KYIHHRLFRDSCYV 375

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  Y+K+LS +   L +++++DNSP SY  +  +AI +  W SD  D++
Sbjct: 376 YEG-NYVKNLSQIGRPLGDIIILDNSPASYIFHPQHAIPISSWFSDSHDSE 425

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 93/171 (54%), Gaps = 23/171 (13%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSIST 194
           L+P      + KK L++DLDETL+HS+ + +  ++         Q H V           
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLPVEIDDQVHNV----------- 282

Query: 195 LYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVV 254
             YV KRP  + FL +V K +++++FTAS+  Y DP++D L+++       RL+R  C  
Sbjct: 283 --YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKV--IHHRLFREACYN 338

Query: 255 REGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
            EG  YIK+LS +   L +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 339 YEG-NYIKNLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 388

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 94.4 bits (233), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 93/166 (56%), Gaps = 14/166 (8%)

Query: 142 LVPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLY--YVH 199
           L PQ   F  RK  LV+DLDETL+HS+ + +        H  +   P    + ++  YV 
Sbjct: 298 LPPQRPEFRGRKC-LVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVYVI 348

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL +V + +++++FTAS+  Y DP++D L+         RL+R +C   EG  
Sbjct: 349 KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQ--YKAVHHRLFRDSCYNYEG-N 405

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           YIK+LS +   L +++++DNSP SY  +  +A+ +  W SD  D +
Sbjct: 406 YIKNLSQIGRPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNE 451

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 91/153 (59%), Gaps = 9/153 (5%)

Query: 153 KKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVS 212
           KK LV+DLDETL+HS+ + +  ++     ++ V    + I  +Y + KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTAD----FVIPVEID-NQIHNVYVI-KRPGVDEFLKLVG 293

Query: 213 KWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLD 272
           + Y++++FTAS+  Y DP++D L+   T     RL+R +C   +G  YIK+LS +   L 
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQ--TQCIHHRLFRDSCYNYDG-NYIKNLSQIGRPLS 350

Query: 273 EVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 351 DLIILDNSPASYIFHPQHAIPISSWFSDVHDNE 383

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 91.3 bits (225), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 91/153 (59%), Gaps = 9/153 (5%)

Query: 153 KKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVS 212
           KK LV+DLDETL+HS+ + +  ++     ++ V    + +  +Y + KRP  D FL  V 
Sbjct: 239 KKCLVLDLDETLVHSSFKFLRTAD----FVIPVEID-NQVHNVYVI-KRPGVDDFLRLVG 292

Query: 213 KWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLD 272
           + Y++++FTAS+  Y DP++D L+ +       RL+R +C   +G  YIK+LS +   L 
Sbjct: 293 QLYEVVVFTASVSRYGDPLLDVLDQNHC--IHHRLFRDSCYNYDG-NYIKNLSQIGRPLS 349

Query: 273 EVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           +++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 350 DLIILDNSPASYIFHPQHAIPISSWFSDVHDNE 382

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 89/162 (54%), Gaps = 26/162 (16%)

Query: 153 KKRLVVDLDETLIHSATRSVSHSN-------SAQGHMVEVRFPPSSISTLYYVHKRPHCD 205
           KK LV+DLDETL+HS+ + +  ++         Q H V             YV KRP  +
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQTADFVLPVNIDEQIHNV-------------YVIKRPGVE 348

Query: 206 LFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGK--FCKRLYRHNCVVREGVGYIKD 263
            FL +V + +++++FTAS+  Y DP++D L+    G+     RL+R  C   EG  YIK+
Sbjct: 349 EFLKRVGELFEVVVFTASVARYGDPLLDILD---PGRQLIHHRLFREACYNYEG-NYIKN 404

Query: 264 LSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTD 305
           LS +   L E++++DNSP SY  +  +AI +  W SD  D +
Sbjct: 405 LSQMGRPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNE 446

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP CD FL  +S++Y++++F+++   Y+D + + L+          L++ +CV ++G+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKD+S +   + +VV+ID  P  Y    +NAI  + W   P D
Sbjct: 279 HIKDISKMNRDVGKVVMIDTDPNCYKSQPENAIPAKPWDGTPDD 322

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y+D + + L+          L++ +CV ++GV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID  P SY    +NAI +E W  +  D
Sbjct: 275 HIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 318

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP CD FL  +S++Y++++F+++   YA+ + + L+          L++ +CV ++GV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKD+S +   L +VV ID  P +Y    +NAI ++ W  +  D
Sbjct: 266 HIKDISKLNRDLGKVVTIDTDPNTYKLQPENAIPMDPWTGEADD 309

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y++ + + L+          LY+ +CV +EG  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLYKEHCVYKEGT- 274

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   LD+V++ID  P +Y    +NAI V+ W     D
Sbjct: 275 HIKDLSKLNRDLDKVLIIDCDPNNYKFQPENAIPVKPWNGQADD 318

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S+++++++F+++   Y+D + + L+          L++ +CV ++GV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 274

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID  P SY    +NAI ++ W  +  D
Sbjct: 275 HIKDLSKLNRDLSKVIIIDTEPNSYKLQPENAIPMDPWNGEADD 318

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S+++++++F+++   Y++ + + L+          L++ +CV ++GV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 279

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID  P SY    +NAI +E W  +  D
Sbjct: 280 HIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 323

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 62/104 (59%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y + + + L+          L++ +CV ++GV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYSLFKEHCVYKDGV- 293

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   +++V++ID  P +Y    +NAI +E W  +  D
Sbjct: 294 HIKDLSKLNRDVNKVLIIDTDPNNYKLQPENAIPMEPWKGEADD 337

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   YA+ V + ++          LY+ +C+ ++GV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDP-IHAFVTYNLYKEHCLYKDGV- 273

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGW 297
           +IKDLS +   L + ++ID  P SY    +NAI V+ W
Sbjct: 274 HIKDLSKLNRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y++ + + L+          LY+ +CV +EG  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDP-IHAFISYNLYKEHCVYKEG-D 283

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGW 297
           +IKDLS +   L +V+++D  P SY    +NAI ++ W
Sbjct: 284 HIKDLSKLNRDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y + + + L+          L++ +CV ++GV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDP-LHAFISYNLFKEHCVYKDGV- 285

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   +++V++ID  P +Y    +NAI V+ W     D
Sbjct: 286 HIKDLSKLNRDVNKVLIIDTEPNNYKLQPENAIPVKPWDGKADD 329

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  + FL  +S++Y++++F+++   Y++   + L+          L++ +CV ++GV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYKDGV- 277

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID  P SY    +NAI ++ W  +  D
Sbjct: 278 HIKDLSKLKRDLSKVIIIDTDPNSYKLQPENAIPMDPWNGEADD 321

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y+D V + L+          L++ +C+ ++GV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L + V+ID  P +Y    +NAI ++ W     D
Sbjct: 270 HIKDLSKLNRDLGKTVIIDCDPNAYKLQPENAIPMKPWDGKADD 313

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   YA+ + + ++          L++ +CV ++GV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDP-IHAFISYNLFKEHCVYKDGV- 280

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID    SY    +NAI ++ W     D
Sbjct: 281 HIKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADD 324

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y+D V + L+          L++ +C+ ++GV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L + +++D  P +Y    +NAI +  W     D
Sbjct: 271 HIKDLSKLNRDLGKTIIVDCDPNAYKLQPENAIPMRPWDGKADD 314

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   YA+ + + L+          L++ +C+ ++GV 
Sbjct: 220 KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYKDGV- 277

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   L +V++ID    S+    +NAI +E W     D
Sbjct: 278 HIKDLSKLNRDLGKVLIIDTDENSFKLQPENAIYLEPWDGKADD 321

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y+D + + L+          L++ +C+ ++GV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV- 278

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGW 297
           +IKDLS +     +V++ID  P SY    +NAI ++ W
Sbjct: 279 HIKDLSKLNRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 70/138 (50%), Gaps = 3/138 (2%)

Query: 191 SISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRH 250
           S  T +   KRP  D FL  +S++Y++++F+++   Y++ + + L+          L++ 
Sbjct: 202 SQKTGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDP-LHAFISYNLFKE 260

Query: 251 NCVVREGVGYIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDT-DXXXX 309
           +CV ++ V +IKDLS +   + +VV++D    SY    +NA+ +  W   P D       
Sbjct: 261 HCVYKDHV-HIKDLSKLNRDVRKVVIMDTDANSYKLQPENALPMAPWDGKPDDKLIQMIP 319

Query: 310 XXXXXXXRYVTDVRSILG 327
                  + V DVR +LG
Sbjct: 320 FLEYLATQQVDDVRPVLG 337

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 57/98 (58%), Gaps = 2/98 (2%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   +++ + + L+          L++ +CV ++G+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGW 297
           +IKDLS +   L + ++ID    ++    +NAI  E W
Sbjct: 285 HIKDLSHLNRDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 200 KRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVG 259
           KRP  D FL  +S++Y++++F+++   Y++ + + L+          L++ +CV ++G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDP-IHAFISYNLFKEHCVYKKG-K 248

Query: 260 YIKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSD 303
           +IKDLS +   +++V++ID    +Y    +NAI ++ W     D
Sbjct: 249 HIKDLSKLNRDVNKVIIIDTDKNNYKLQPENAIPMKPWSGTADD 292

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 2/104 (1%)

Query: 201 RPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGY 260
           RP  D  L  +S +Y+ ++F ++   Y+  V++ L+          L++ +CV ++G+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDP-IRAFITYNLFKDHCVYKDGI-H 274

Query: 261 IKDLSVVTEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDT 304
           IKDLS +   L + ++ID  P S     +NAI  E W     D 
Sbjct: 275 IKDLSHLNRDLGKTLIIDTDPNSVKLQMENAILAEPWDGKADDA 318

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 23/126 (18%)

Query: 148 LFAERKKRLVVDLDETLIHSATRSV------SHSNSAQGHMVEVR---------FPPSSI 192
           L  E+K  LVVDLD+T+IH              +N     + +V+          PP  +
Sbjct: 159 LIREKKLILVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYM 218

Query: 193 S-------TLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCK 245
                     YYV  RP    F  +VSK Y++ I+T + + YA  +   ++   T  F  
Sbjct: 219 GPKPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGT-LFAD 277

Query: 246 RLYRHN 251
           R+   N
Sbjct: 278 RILSRN 283

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 42/108 (38%), Gaps = 26/108 (24%)

Query: 145 QSILFAERKKRLVVDLDETLIHSATRSVSH------SNSAQGHMVEV------------- 185
           Q  L   +K  LVVDLD+T+IH       H      SN     +  V             
Sbjct: 157 QKHLREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPP 216

Query: 186 -----RFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYA 228
                R PP      YYV  RP    F  K++  ++L I+T + + YA
Sbjct: 217 FYMGPRPPPRKCQ--YYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 22/95 (23%)

Query: 156 LVVDLDETLIHSATRSV------SHSNSAQGHMVEVR---------FPPSSIS------- 193
           LVVDLD+T+IH               N     + +VR          PPS +        
Sbjct: 185 LVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRPPVRK 244

Query: 194 TLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYA 228
             YYV  RP    F +K++  Y++ I+T + + YA
Sbjct: 245 CWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYA 279

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 22/106 (20%)

Query: 145 QSILFAERKKRLVVDLDETLIHSAT----------------RSVSHSNSAQGHMVEVRFP 188
           Q  L   RK  LVVDLD+T+IH                    S+    S   H   V  P
Sbjct: 159 QKQLREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPP 218

Query: 189 ------PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYA 228
                 P +    YYV  RP    F S ++  ++L I+T + + YA
Sbjct: 219 FYMGPKPPTRKCWYYVKLRPGLQDFFSNIAPHFELHIYTMATRTYA 264

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 22/109 (20%)

Query: 145 QSILFAERKKRLVVDLDETLIHSATRSV--------SHSNSAQGHMV-------EVRFPP 189
           +S L   +K  LVVDLD+T+IH              S+ N      V       E   PP
Sbjct: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218

Query: 190 SSIS-------TLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPV 231
             +          YYV  RP    F  KV+  Y++ I+T + + YA+ +
Sbjct: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267

>SAKL0B02926g Chr2 (273721..275148) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|P43635 Saccharomyces cerevisiae
           YPR001W CIT3 Citrate synthase catalyzes the condensation
           of acetyl coenzyme A and oxaloacetate to form citrate
           mitochondrial isozyme involved in the TCA cycle
          Length = 475

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 62  KPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEVDDDLAEDEMFLQRDTVKG 121
           +PF    F+ TS L L   GLK+  K    +R+ E++  K+   D+  DE+ +   ++ G
Sbjct: 4   RPFLSRCFLTTSNLRLQHKGLKATLKALIPARRDELVNLKKNYGDVRVDEITV--GSIIG 61

Query: 122 GLRGK 126
           G+RG 
Sbjct: 62  GMRGN 66

>ZYRO0A08976g Chr1 complement(718141..720719,721035..721059) [2604
           bp, 867 aa] {ON} similar to uniprot|P34160 Saccharomyces
           cerevisiae YMR125W STO1 Large subunit of the nuclear
           mRNA cap-binding protein complex interacts with Npl3p to
           carry poly(A) mRNA from the nucleus to the cytoplasm
           also involved in mRNA degradation in the nucleus
           orthologous to mammalian CBP80
          Length = 867

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 24/35 (68%)

Query: 148 LFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHM 182
           + A  +K ++V L +T++HS +RS+SH+N   G +
Sbjct: 631 IIANFEKFIIVVLIQTVVHSGSRSLSHANKYIGDL 665

>TDEL0C00850 Chr3 complement(138626..139687) [1062 bp, 353 aa] {ON}
           Anc_8.59 YLR049C
          Length = 353

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 82  LKSKQKVESTSRKGEIIRKKEVDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRFLFPKK 141
            KS+ +V     +G I     +D+ + ED +      V GG    +  + + G  LF   
Sbjct: 12  FKSRHRVSRRELQGLIDWTTTLDESIEEDSLISYAVPVVGGESRFSVLSSESGESLFEPD 71

Query: 142 LVPQ-------SILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVR 186
           L  Q         L  E KKR+  + ++  +  A R+ S SNSA+  + +++
Sbjct: 72  LRTQLQSNMSLESLIQENKKRISANQEDLELFIAARNPSLSNSARDQVSKLQ 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,011,571
Number of extensions: 1185901
Number of successful extensions: 3569
Number of sequences better than 10.0: 85
Number of HSP's gapped: 3514
Number of HSP's successfully gapped: 90
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)