Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A10560g5.251ON46846823090.0
Kpol_1032.875.251ON46447220670.0
TDEL0E037505.251ON47147220620.0
CAGL0E06490g5.251ON47247520540.0
TBLA0C030405.251ON46847120360.0
ACR050C5.251ON47546820350.0
TPHA0B025505.251ON46346820290.0
SAKL0G11484g5.251ON45646820200.0
KLTH0G07524g5.251ON44546820180.0
Ecym_82505.251ON45646820190.0
YKL145W (RPT1)5.251ON46746820040.0
Skud_11.825.251ON46847320020.0
KAFR0H036305.251ON44846919970.0
NCAS0F023005.251ON47449420000.0
Smik_11.915.251ON46846919890.0
Suva_11.805.251ON47147219560.0
KNAG0H023005.251ON47747719530.0
KLLA0E13773g5.251ON47547819130.0
Kwal_23.28495.251ON40942718750.0
NDAI0C037805.251ON38538517140.0
Suva_7.2274.57ON4053097921e-101
KLLA0A04752g4.57ON4043097901e-101
Smik_7.2354.57ON4053097891e-100
YGL048C (RPT6)4.57ON4053097891e-100
Skud_7.2364.57ON4053097881e-100
Kwal_26.74744.57ON4053007822e-99
KLTH0D03806g4.57ON4053007812e-99
AGL043C4.57ON4053007788e-99
SAKL0H23672g4.57ON4083007788e-99
CAGL0D06292g4.57ON4003117751e-98
ZYRO0G22330g4.57ON4053097752e-98
Kpol_1041.424.57ON4033007742e-98
NCAS0A058804.57ON4073107734e-98
TDEL0E056604.57ON4063007701e-97
TBLA0B098804.57ON4013107682e-97
KAFR0F031004.57ON4053107682e-97
KNAG0D032004.57ON4003137673e-97
NDAI0D028504.57ON4053107674e-97
TPHA0F004404.57ON4033007655e-97
Skud_15.4258.708ON4373227147e-89
KLLA0C09592g8.708ON4343077121e-88
SAKL0H05764g8.708ON4213077102e-88
KLTH0D11990g8.708ON4333077102e-88
Smik_15.4428.708ON4373227085e-88
KNAG0G027208.708ON4443227052e-87
Suva_8.3088.708ON4373227042e-87
Kwal_26.89128.708ON4343077033e-87
AAL113W8.708ON4323077023e-87
NCAS0A101803.216ON4372977024e-87
YOR259C (RPT4)8.708ON4373227024e-87
CAGL0K08910g8.708ON4363227008e-87
Ecym_23658.708ON4273076991e-86
TDEL0A065308.708ON4353076991e-86
NCAS0B011508.708ON4263226971e-86
YDL007W (RPT2)3.216ON4372606972e-86
Smik_4.2293.216ON4372606963e-86
TDEL0D040603.216ON4372976963e-86
KAFR0F024403.216ON4362606963e-86
KAFR0A040108.708ON4243226944e-86
NDAI0E010208.708ON4433226964e-86
KNAG0K015303.216ON4352606954e-86
Suva_4.2463.216ON4372606955e-86
NDAI0A072903.216ON3762816896e-86
ZYRO0A04224g3.216ON4372606946e-86
Kwal_27.110323.216ON3763106887e-86
Kpol_1010.743.216ON4372606948e-86
Kpol_1064.228.708ON4323206921e-85
SAKL0C11440g3.216ON4363106921e-85
KLLA0E21209g5.428ON4323086912e-85
TBLA0D012408.708ON4433206922e-85
TPHA0H017705.251ON4343086902e-85
NCAS0F033305.428ON4343086903e-85
CAGL0I04884g3.216ON4332606893e-85
Skud_4.2473.216ON4372846903e-85
ZYRO0F11946g8.708ON4443226903e-85
Ecym_55275.428ON4323086893e-85
SAKL0G02376g5.428ON4343086894e-85
TPHA0A042703.216ON4372606894e-85
Ecym_52863.216ON4372976885e-85
AEL011W3.216ON4372976878e-85
TBLA0F006903.216ON4342606869e-85
TPHA0D014708.708ON4553206889e-85
CAGL0A02750g5.428ON4293086832e-84
KLTH0F16214g5.428ON4343086833e-84
KNAG0C049605.428ON4233086823e-84
KLTH0G16698g3.216ON4552976843e-84
Kwal_55.214535.428ON4343086814e-84
Smik_15.2955.428ON4343086815e-84
YOR117W (RPT5)5.428ON4343086815e-84
Suva_8.1705.428ON4343086815e-84
KAFR0E038905.428ON4343086807e-84
Kpol_1062.335.428ON4343086791e-83
Skud_15.2805.428ON4343086791e-83
KLLA0F14707g3.216ON4342606781e-83
AER254W5.428ON4603086792e-83
TDEL0E019705.428ON4343086772e-83
NDAI0B056205.428ON4823086803e-83
TBLA0A037405.428ON4343086754e-83
ZYRO0F09900g5.428ON4343086712e-82
Kpol_543.175.486ON4282786451e-78
ZYRO0D11528g5.486ON4532926434e-78
KLLA0C06534g5.486ON4282626397e-78
NDAI0A042905.486ON4262936398e-78
Ecym_45485.486ON4252626381e-77
CAGL0K09526g5.486ON4312636381e-77
NCAS0A119805.486ON4262796371e-77
Smik_4.6685.486ON4282796362e-77
YDR394W (RPT3)5.486ON4282796362e-77
AFR394W5.486ON4722596393e-77
Skud_4.6685.486ON4282796353e-77
TBLA0D018605.486ON4292796353e-77
TPHA0J028605.486ON4312786353e-77
KAFR0E035805.486ON4252796344e-77
KNAG0C045905.486ON4322966336e-77
Suva_2.5715.486ON4282796328e-77
SAKL0G03828g5.486ON4252626319e-77
TDEL0A035005.486ON4262796119e-74
KLTH0G02662g5.486ON4252626083e-73
TBLA0J006407.288ON8522315124e-56
TDEL0H015607.288ON8382315097e-56
TBLA0C048407.288ON8472315072e-55
Kpol_1020.97.288ON8122345062e-55
KLLA0F05676g7.288ON8302315062e-55
SAKL0F09834g7.288ON8422315062e-55
NCAS0E035807.288ON6012314972e-55
KLTH0A05324g7.288ON8322315043e-55
KNAG0B029407.288ON8382315053e-55
NCAS0A137607.288ON8252315044e-55
Smik_4.1117.288ON8352315026e-55
NDAI0A022807.288ON8252315026e-55
Kwal_23.59967.288ON8312315027e-55
Kpol_2000.157.288ON8232315019e-55
Suva_4.1197.288ON8362315011e-54
Skud_4.1297.288ON8352315001e-54
CAGL0J09350g7.288ON8302315001e-54
NDAI0A030407.288ON8422315001e-54
YDL126C (CDC48)7.288ON8352315001e-54
ZYRO0C09262g7.288ON8302314992e-54
KAFR0L011907.288ON8242314982e-54
Ecym_80377.288ON8362314973e-54
TPHA0A032607.288ON8262314964e-54
AFR158W7.288ON8322314965e-54
NCAS0E040505.34ON13292794891e-52
ZYRO0D07414g5.34ON14202694863e-52
KLTH0B09130g5.34ON13332794846e-52
Kwal_47.18848singletonOFF3021564536e-52
KAFR0D019005.34ON12612694811e-51
TDEL0G005905.34ON12942344783e-51
TPHA0L022105.34ON14002704783e-51
CAGL0G00528g5.34ON13172714774e-51
TBLA0C068505.34ON14262694767e-51
KLLA0A09823g5.34ON13192714751e-50
KNAG0K002805.34ON14082714751e-50
Kpol_513.195.34ON13772704751e-50
Kpol_483.204.259ON7832614701e-50
NDAI0B007805.34ON13482694741e-50
Kwal_23.42535.34ON13292794732e-50
KNAG0B061604.259ON7722624682e-50
ABR139W5.34ON12702684722e-50
Ecym_47695.34ON13392694705e-50
NCAS0J015504.259ON7722424646e-50
SAKL0H01276g5.34ON13372694687e-50
Skud_13.2452.472ON8242574631e-49
Smik_16.385.34ON13892694661e-49
Skud_7.6035.34ON13862344642e-49
Kwal_26.77492.472ON8142574594e-49
TDEL0A024802.472ON8162574594e-49
TBLA0I011902.472ON8352654604e-49
KAFR0A058904.259ON7722824585e-49
CAGL0C02585g4.259ON7713124576e-49
Suva_13.2662.472ON8232574561e-48
Suva_7.5665.34ON13982714591e-48
SAKL0H02750g4.259ON7762944551e-48
YLR397C (AFG2)4.259ON7802674551e-48
KLTH0D05412g2.472ON8132574551e-48
YGR270W (YTA7)5.34ON13792344581e-48
TPHA0B007304.259ON7763114542e-48
Ecym_74002.472ON8042564542e-48
KNAG0L010607.168ON7132614522e-48
Kpol_401.37.168ON7862624542e-48
SAKL0E03014g2.472ON8302574542e-48
ZYRO0D15290g7.168ON7272644522e-48
Ecym_12587.168ON7472624513e-48
KAFR0A007402.472ON7842574524e-48
YMR089C (YTA12)2.472ON8252574524e-48
CAGL0J01353g2.472ON8272554525e-48
Suva_10.5144.259ON7802674506e-48
Smik_13.2732.472ON8272574516e-48
KLTH0F13904g7.168ON7392634488e-48
NDAI0J023204.259ON7782424498e-48
NCAS0A078202.472ON7912574499e-48
Klac_YGOB_Anc_7.168b7.168ON7792614489e-48
NDAI0H022102.472ON8032574491e-47
Kpol_467.232.472ON8592574491e-47
AAR025C7.168ON7262644452e-47
Smik_12.4844.259ON7802664462e-47
KLLA0B03234g4.259ON8042454454e-47
Suva_5.1097.168ON7612594434e-47
Skud_12.4824.259ON7772714444e-47
NCAS0A029404.23ON8572884437e-47
SAKL0H25630g4.23ON8302584438e-47
KLTH0D14586g4.259ON7742424418e-47
Kwal_23.41944.259ON7742774419e-47
Ecym_62184.23ON8382574411e-46
KLLA0F13706g2.472ON8422574411e-46
ABL041W2.472ON8182564402e-46
TDEL0E011104.259ON7782684392e-46
NDAI0E035807.168ON7822624392e-46
YLL034C (RIX7)4.23ON8372574392e-46
TPHA0G031302.472ON7922664383e-46
Smik_5.1387.168ON7602594373e-46
Suva_10.384.23ON8372574383e-46
Smik_12.224.23ON8372734383e-46
Skud_5.1217.168ON7622594373e-46
Skud_12.334.23ON8372574384e-46
KNAG0E025502.472ON8452574384e-46
TBLA0D044907.168ON7822924364e-46
SAKL0F03894g7.168ON7422614356e-46
ZYRO0G08008g4.23ON8262894366e-46
NCAS0E020207.168ON7732624356e-46
KLLA0E00837g4.23ON8142584366e-46
YER017C (AFG3)7.168ON7612594349e-46
CAGL0D02838g4.23ON8342574351e-45
CAGL0H09416g7.168ON7502644331e-45
KNAG0E010404.23ON7852574331e-45
TPHA0C015207.168ON7842624331e-45
TBLA0A063804.259ON8082844331e-45
TDEL0G016804.23ON8062954331e-45
ZYRO0G03212g2.472ON8302554331e-45
TDEL0H027707.168ON7442644312e-45
ZYRO0B12606g4.259ON7772784303e-45
Kpol_1044.154.23ON8392574304e-45
TBLA0E014504.23ON8612574287e-45
TPHA0K022204.23ON8202484279e-45
KNAG0C033207.430ON7662544261e-44
KAFR0L002604.23ON7942574261e-44
NDAI0D048904.23ON8702894262e-44
ZYRO0F13024g7.430ON7402544232e-44
KAFR0G028007.168ON7832624242e-44
NCAS0A146407.430ON7502544223e-44
KLTH0E06006g4.23ON8192574224e-44
KLLA0E06711g7.430ON7692544214e-44
KAFR0K020607.430ON7262544196e-44
AFR188W4.23ON8272484209e-44
Ecym_71237.430ON7272554171e-43
TDEL0C029307.430ON7402544171e-43
Suva_16.3517.430ON7472544162e-43
SAKL0F13376g7.430ON7412544152e-43
YPR024W (YME1)7.430ON7472544153e-43
NDAI0A013907.430ON7122554143e-43
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A10560g
         (468 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   894   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   800   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   798   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   795   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   788   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   788   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   786   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   782   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   781   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   782   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   776   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   775   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   773   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   775   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   770   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   758   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   756   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   741   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   726   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   664   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   309   e-101
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   308   e-101
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   308   e-100
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   308   e-100
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   308   e-100
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   305   2e-99
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   305   2e-99
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   304   8e-99
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   304   8e-99
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   303   1e-98
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   303   2e-98
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   302   2e-98
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   302   4e-98
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   301   1e-97
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   300   2e-97
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   300   2e-97
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   300   3e-97
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     300   4e-97
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   299   5e-97
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   279   7e-89
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   278   1e-88
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   278   2e-88
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   278   2e-88
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   277   5e-88
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   276   2e-87
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   275   2e-87
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   275   3e-87
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   275   3e-87
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   275   4e-87
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   275   4e-87
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   274   8e-87
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   273   1e-86
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   273   1e-86
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    273   1e-86
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   273   2e-86
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   272   3e-86
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   272   3e-86
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   272   3e-86
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   271   4e-86
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    272   4e-86
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   272   4e-86
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   272   5e-86
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   270   6e-86
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   271   6e-86
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   269   7e-86
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   271   8e-86
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   271   1e-85
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   271   1e-85
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   270   2e-85
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   271   2e-85
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   270   2e-85
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    270   3e-85
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   270   3e-85
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   270   3e-85
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   270   3e-85
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   270   3e-85
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   270   4e-85
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   270   4e-85
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   269   5e-85
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   269   8e-85
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   268   9e-85
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   269   9e-85
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   267   2e-84
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   267   3e-84
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   267   3e-84
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   268   3e-84
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   266   4e-84
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   266   5e-84
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   266   5e-84
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   266   5e-84
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   266   7e-84
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   266   1e-83
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   266   1e-83
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   265   1e-83
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   266   2e-83
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   265   2e-83
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   266   3e-83
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   264   4e-83
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   263   2e-82
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   253   1e-78
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   252   4e-78
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   250   7e-78
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   250   8e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   250   1e-77
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   250   1e-77
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   249   1e-77
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   249   2e-77
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   249   2e-77
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   250   3e-77
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   249   3e-77
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   249   3e-77
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   249   3e-77
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   248   4e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   248   6e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   248   8e-77
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   247   9e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   239   9e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   238   3e-73
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   201   4e-56
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   200   7e-56
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   199   2e-55
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   199   2e-55
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   199   2e-55
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   199   2e-55
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    196   2e-55
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   198   3e-55
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   199   3e-55
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            198   4e-55
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   197   6e-55
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   197   6e-55
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   197   7e-55
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   197   9e-55
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   197   1e-54
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   197   1e-54
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   197   1e-54
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   197   1e-54
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   197   1e-54
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   196   2e-54
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   196   2e-54
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   196   3e-54
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   195   4e-54
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   195   5e-54
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    192   1e-52
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   191   3e-52
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   191   6e-52
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   179   6e-52
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   189   1e-51
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   188   3e-51
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   188   3e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   188   4e-51
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   187   7e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   187   1e-50
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   187   1e-50
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   187   1e-50
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   185   1e-50
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   187   1e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   2e-50
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   184   2e-50
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   186   2e-50
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   185   5e-50
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   183   6e-50
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   184   7e-50
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   182   1e-49
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   184   1e-49
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   183   2e-49
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   181   4e-49
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   181   4e-49
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   181   4e-49
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   181   5e-49
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   180   6e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   180   1e-48
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   181   1e-48
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   179   1e-48
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   179   1e-48
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   179   1e-48
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   181   1e-48
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   179   2e-48
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   179   2e-48
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   178   2e-48
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   179   2e-48
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   179   2e-48
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   178   2e-48
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   178   3e-48
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   178   4e-48
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   178   4e-48
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   178   5e-48
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   177   6e-48
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   178   6e-48
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   177   8e-48
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   177   8e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   177   9e-48
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   177   9e-48
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   177   1e-47
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   177   1e-47
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   176   2e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   176   2e-47
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   176   4e-47
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   175   4e-47
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   175   4e-47
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     175   7e-47
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   175   8e-47
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   174   8e-47
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   174   9e-47
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   174   1e-46
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   174   1e-46
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   174   2e-46
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   173   2e-46
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    173   2e-46
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   173   2e-46
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   173   3e-46
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   172   3e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   173   3e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   173   3e-46
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   172   3e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   173   4e-46
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   173   4e-46
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   172   4e-46
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   172   6e-46
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   172   6e-46
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    172   6e-46
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   172   6e-46
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   171   9e-46
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   172   1e-45
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   171   1e-45
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   171   1e-45
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   171   1e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   171   1e-45
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   171   1e-45
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   171   1e-45
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   170   2e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   170   3e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   170   4e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   169   7e-45
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   169   9e-45
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   168   1e-44
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   168   1e-44
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   168   2e-44
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   167   2e-44
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   167   2e-44
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   167   3e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   167   4e-44
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   166   4e-44
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   166   6e-44
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   166   9e-44
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   165   1e-43
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   165   1e-43
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   164   2e-43
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   164   2e-43
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   164   3e-43
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   164   3e-43
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   164   3e-43
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   164   3e-43
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   164   4e-43
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   164   4e-43
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   163   4e-43
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   163   4e-43
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   162   8e-43
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   161   3e-42
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   159   1e-41
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   159   2e-41
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   158   2e-41
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   157   2e-40
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   157   2e-40
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   155   4e-40
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   152   6e-40
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   155   7e-40
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     155   7e-40
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   153   2e-39
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   152   5e-39
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   152   5e-39
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   152   7e-39
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   152   8e-39
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   151   2e-38
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   150   3e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   150   3e-38
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   150   3e-38
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   149   5e-38
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   149   5e-38
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   148   1e-37
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   147   4e-37
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   146   5e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   140   6e-37
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   144   2e-36
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   143   7e-36
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   141   3e-35
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   140   6e-35
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   134   5e-34
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              132   9e-34
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   136   1e-33
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   136   1e-33
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   133   1e-33
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   136   1e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   132   1e-33
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   132   1e-33
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   131   2e-33
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   130   3e-33
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   132   3e-33
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   135   3e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   131   5e-33
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   129   5e-33
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   134   6e-33
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   130   7e-33
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   130   8e-33
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   130   1e-32
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   133   2e-32
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              128   2e-32
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   128   2e-32
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   129   3e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   129   3e-32
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   129   3e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   132   4e-32
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   128   5e-32
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   128   6e-32
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   128   6e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   131   7e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   127   8e-32
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   127   9e-32
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   127   9e-32
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   130   1e-31
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   130   1e-31
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   130   1e-31
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   130   2e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   129   2e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   129   3e-31
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   125   3e-31
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   129   3e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   125   4e-31
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   128   6e-31
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   123   8e-31
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   123   1e-30
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   123   1e-30
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   122   2e-30
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   127   2e-30
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   126   2e-30
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   126   2e-30
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   126   2e-30
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   124   2e-30
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   126   3e-30
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   126   3e-30
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   125   3e-30
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   122   6e-30
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   125   6e-30
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   125   7e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   124   9e-30
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   125   9e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   124   1e-29
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   124   1e-29
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   120   1e-29
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   124   1e-29
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   124   1e-29
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   120   2e-29
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   120   2e-29
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   123   2e-29
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   122   3e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   122   5e-29
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   122   7e-29
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   122   8e-29
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   121   9e-29
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   117   1e-28
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   120   2e-28
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    120   2e-28
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   120   3e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   119   5e-28
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   119   5e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   115   7e-28
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   119   7e-28
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   119   8e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   118   9e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   118   9e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    118   1e-27
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    117   4e-27
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   116   6e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   116   6e-27
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   112   7e-27
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   115   7e-27
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   115   1e-26
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   112   7e-26
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   111   3e-25
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   110   3e-25
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   110   4e-25
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   108   2e-24
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   107   3e-24
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   107   6e-24
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   107   6e-24
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   106   1e-23
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   106   1e-23
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   105   2e-23
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   105   2e-23
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   104   4e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   102   4e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   103   7e-23
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   103   1e-22
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   103   1e-22
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   100   2e-22
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   102   2e-22
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   102   2e-22
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   102   3e-22
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   101   4e-22
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   100   5e-22
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   100   8e-22
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...   100   1e-21
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              100   2e-21
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...    99   2e-21
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...    99   2e-21
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...    99   3e-21
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...    99   5e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    97   2e-20
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   7e-12
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    59   8e-09
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   6e-08
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    55   2e-07
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    55   2e-07
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    54   6e-07
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    53   9e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    53   9e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    53   1e-06
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    52   1e-06
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    52   2e-06
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    52   2e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    52   2e-06
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    51   4e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    51   4e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    51   4e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    51   4e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    51   5e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    51   5e-06
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    50   6e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    50   6e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    50   7e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    50   9e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    50   9e-06
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    49   2e-05
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    46   2e-04
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    46   2e-04
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    45   2e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    45   3e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   5e-04
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    43   0.002
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    42   0.002
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    42   0.002
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    42   0.002
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    42   0.003
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    42   0.003
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    42   0.004
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.010
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.012
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.014
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    40   0.016
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    39   0.028
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    39   0.029
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    38   0.039
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    38   0.043
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    38   0.043
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    38   0.060
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    37   0.13 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    37   0.14 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    37   0.15 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    36   0.16 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    36   0.16 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    36   0.17 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    36   0.18 
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    36   0.19 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    36   0.25 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    36   0.27 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    35   0.32 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    35   0.35 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    35   0.41 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    35   0.43 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.44 
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    35   0.50 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    35   0.55 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    35   0.60 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    34   0.63 
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    34   0.64 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.70 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    34   0.73 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    34   0.78 
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    34   1.0  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   1.2  
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    33   1.2  
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    33   1.2  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   1.3  
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    33   1.3  
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    33   1.3  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    33   1.3  
KLTH0D05852g Chr4 (522837..524945) [2109 bp, 702 aa] {ON} simila...    33   1.4  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    33   1.4  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   1.5  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.6  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.6  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.7  
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    33   1.8  
Ecym_2429 Chr2 (833794..836133) [2340 bp, 779 aa] {ON} similar t...    33   1.8  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   2.0  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   2.0  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    33   2.2  
Kpol_223.4 s223 (4546..6036) [1491 bp, 496 aa] {ON} (4546..6036)...    33   2.3  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               33   2.3  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    33   2.3  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   2.7  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    32   2.8  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    32   2.8  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    32   3.0  
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...    32   3.4  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    32   3.4  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   3.7  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.9  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   4.1  
KLLA0E06491g Chr5 complement(585024..587207) [2184 bp, 727 aa] {...    32   4.2  
NCAS0B01320 Chr2 (217380..219995) [2616 bp, 871 aa] {ON} Anc_8.637     32   4.5  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    32   4.6  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    32   4.6  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   4.7  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    32   5.0  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   5.3  
TDEL0A05830 Chr1 (1026554..1029124) [2571 bp, 856 aa] {ON} Anc_8...    32   5.4  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    32   5.5  
Skud_15.384 Chr15 (688341..690929) [2589 bp, 862 aa] {ON} YOR217...    32   6.1  
Ecym_8322 Chr8 (654654..657074) [2421 bp, 806 aa] {ON} similar t...    31   6.5  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   6.8  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   6.9  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    31   7.0  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   7.0  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   7.8  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    31   7.9  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.9  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   8.2  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    31   8.5  
SAKL0A03982g Chr1 complement(369575..373072) [3498 bp, 1165 aa] ...    31   9.2  
CAGL0M08822g Chr13 (880145..882508) [2364 bp, 787 aa] {ON} highl...    31   9.2  
Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C...    30   9.6  

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/468 (94%), Positives = 442/468 (94%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
           DGAAGPGATSENR           KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 DGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG
Sbjct: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           SKKACIVFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 SKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/472 (83%), Positives = 422/472 (89%), Gaps = 12/472 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDEN-AEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKD 59
           MPP+EDWEKYKAP+EG  +E+ ++D K +PL+E DIQVLKTYGAAPYA+KLKETEKDLKD
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 60  IEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK---STSDSNEN 116
           IE RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK   ST   N+N
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 117 GEGLDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 176
           G G +G +     +++            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 121 GNGENGESASANDADD--------DEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 172

Query: 177 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERF 236
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGG K+QIEKLREVVELPLLSPERF
Sbjct: 173 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPERF 232

Query: 237 AKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 296
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 233 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 292

Query: 297 EMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 356
           EMAR+KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 293 EMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 352

Query: 357 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST 416
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+K+MSVERGIRWELISRLCPNST
Sbjct: 353 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPNST 412

Query: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           GAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 413 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/472 (85%), Positives = 418/472 (88%), Gaps = 5/472 (1%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAP E    E + D K +PL+EGDIQVLKTYGAAPYA KLKETEKDLKDI
Sbjct: 1   MPPKEDWEKYKAPAE-EDKEKSNDEKNTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDS-NENGEG 119
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+S  +  + N +G
Sbjct: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119

Query: 120 LDGA--AGPGATS-ENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 176
           LD A  A  G  S E R           KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179

Query: 177 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERF 236
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERF
Sbjct: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239

Query: 237 AKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 296
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299

Query: 297 EMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 356
           EMAR+KKACIVFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 300 EMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 359

Query: 357 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST 416
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNST
Sbjct: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419

Query: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           GAELRSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/475 (84%), Positives = 416/475 (87%), Gaps = 10/475 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           M P+EDWEKYKAP+E   D   +D K  PL+EGDIQVLKTYGAAPYA KLKETEKDLK+I
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAPYAAKLKETEKDLKEI 60

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNE----- 115
           EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKS++ SNE     
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSA-SNEVSDES 119

Query: 116 --NGEGLDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGM 173
             NG     +A  G  S N            KYVINLKQIAKFVVGLGERVSPTDIEEGM
Sbjct: 120 AVNGANTTNSATTG--SGNDGDAEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGM 177

Query: 174 RVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSP 233
           RVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSP
Sbjct: 178 RVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP 237

Query: 234 ERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 293
           ERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR
Sbjct: 238 ERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 297

Query: 294 ELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVM 353
           ELFEMAR+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVM
Sbjct: 298 ELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVM 357

Query: 354 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCP 413
           FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVER IRWELISRLCP
Sbjct: 358 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCP 417

Query: 414 NSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           NSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 418 NSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/471 (83%), Positives = 412/471 (87%), Gaps = 6/471 (1%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           M P+EDW+KYKAPIE   D+   D K +PLSEGDIQVLKTYGAAP A KLK+TEKDLK+I
Sbjct: 1   MAPKEDWDKYKAPIED--DKTTVDEKITPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKEI 58

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
            +RIKEK G+KESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKIIK+ SD  EN   +
Sbjct: 59  RKRIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDL-ENSNSM 117

Query: 121 DGAAG---PGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 177
           D  +    P   + +            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 118 DNNSTNNTPLDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 177

Query: 178 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFA 237
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGG KDQIEKLREVVELPLLSPERFA
Sbjct: 178 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFA 237

Query: 238 KLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 297
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 238 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 297

Query: 298 MARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 357
           MAR+KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 298 MARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 357

Query: 358 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTG 417
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNSTG
Sbjct: 358 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTG 417

Query: 418 AELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           AELRSVCTEAGMFAIRARRKVA+EKDFLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 418 AELRSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/468 (83%), Positives = 411/468 (87%), Gaps = 15/468 (3%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAP+E   ++   D K  PLSEGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           EQRIKEK+G+KESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+S   ++ +  G 
Sbjct: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSG- 141

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
              A  G   E+            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 142 ---ANTGEDDED-----------AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 187

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERFA LG
Sbjct: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 308 TKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 427

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 428 RSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/468 (83%), Positives = 414/468 (88%), Gaps = 5/468 (1%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           M P+EDWEKYKAP+EG   +  ED K  PLSEGDIQVLK+YGAAPY +K+KETEKDLK I
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNED-KIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E +IKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK +S   ENG+  
Sbjct: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSS---ENGDES 116

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
           +  +  G  + N            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 117 NSESTEGNGTAN-TNTAADDNEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 175

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGG KDQIEKLREVVELPLLSPERFA LG
Sbjct: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 296 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 415

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 416 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/468 (83%), Positives = 407/468 (86%), Gaps = 12/468 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+E+WEKY APIE    E  +  K  PLSEGDIQVLKTYGAAPYA KLKE EKDLKDI
Sbjct: 1   MPPKENWEKYTAPIEEEETEEEK--KVVPLSEGDIQVLKTYGAAPYANKLKEIEKDLKDI 58

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK  S S       
Sbjct: 59  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKGDSSS------- 111

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
              + P  T  N            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 112 ---SSPEDTQSNSSPNSEEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 168

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QI+KLREVVELPLLSPERFA LG
Sbjct: 169 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFATLG 228

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 229 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 288

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 289 TKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 348

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 349 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 408

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIRARRKVATEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 409 RSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/468 (83%), Positives = 408/468 (87%), Gaps = 23/468 (4%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEK+KAP E   +E  E+    PL+EGDIQVLKTYGAAPYA KLKETEKDLKDI
Sbjct: 1   MPPKEDWEKFKAPAE---EEKQEEKPNVPLTEGDIQVLKTYGAAPYADKLKETEKDLKDI 57

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK------------ 105

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
                P A+ E+            KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 106 -----PEASDES---PADEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 157

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QI+KLREVVELPLLSPERFA LG
Sbjct: 158 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALG 217

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 218 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 277

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           ++KACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 278 TRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 337

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 338 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 397

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN
Sbjct: 398 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/468 (82%), Positives = 408/468 (87%), Gaps = 12/468 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           M P+EDWEKYK P+E   ++   D K  PL+EGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDKIKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 60

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           EQRIKEK+G+KESDTGLAPSHLWDI+GDRQ+LSE HPLQVARCTKIIKS    +  G G 
Sbjct: 61  EQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSEPSRDSAG-GS 119

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
             A   G   E+            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 120 SSATTVGDDDED-----------AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 168

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERFA LG
Sbjct: 169 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALG 228

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 229 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 288

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 289 TKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 348

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 349 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 408

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 409 RSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/468 (82%), Positives = 410/468 (87%), Gaps = 1/468 (0%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAP+E    +  +D    PL+EGDIQVLK+YGAAPYA KLK+TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDDDKI-VPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK   +S+E     
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDN 119

Query: 121 DGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180
           + +    + S  +           KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 120 NNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 179

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLLSPERFA LG
Sbjct: 180 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 239

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 240 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 299

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 300 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 359

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 360 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 419

Query: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           RSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 420 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/473 (82%), Positives = 412/473 (87%), Gaps = 10/473 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAP++    +  +D    PL+EGDIQVLK+YGAAPYA KLK+TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDDDKI-VPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKST-----SDSNE 115
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK +     S ++ 
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTDN 119

Query: 116 NGEGLDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 175
           N + ++G     + S              KYVINLKQIAKFVVGLGERVSPTDIEEGMRV
Sbjct: 120 NNDSVNG----NSNSNQESADVDEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 175

Query: 176 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPER 235
           GVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLLSPER
Sbjct: 176 GVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPER 235

Query: 236 FAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 295
           FA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL
Sbjct: 236 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 295

Query: 296 FEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFA 355
           FEMAR+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFA
Sbjct: 296 FEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFA 355

Query: 356 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNS 415
           TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNS
Sbjct: 356 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS 415

Query: 416 TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           TGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 416 TGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/469 (82%), Positives = 409/469 (87%), Gaps = 22/469 (4%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP++DWEKYK PI+    +  ++ + +PL+EGDIQVLKTYGAAPYA KLK TE+DLK I
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQIAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKKI 60

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENG-EG 119
           E RIKEK+G+KESDTGLAPSH+WD+MGDRQRLSEEHPLQVARCTKIIKS+S+    G E 
Sbjct: 61  EARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKSSSEEGAEGNED 120

Query: 120 LDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179
            D A                     KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 121 EDDA---------------------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 159

Query: 180 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKL 239
           SKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERFA L
Sbjct: 160 SKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATL 219

Query: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 220 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 279

Query: 300 RSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359
           R+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 280 RTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 339

Query: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAE 419
           NTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSK+MSVER IRWELISRLCPNSTGAE
Sbjct: 340 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPNSTGAE 399

Query: 420 LRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           LRSVCTEAGMFAIRARRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 400 LRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/494 (79%), Positives = 412/494 (83%), Gaps = 46/494 (9%)

Query: 1   MPPREDWEKYKAPIEGTGD-ENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKD 59
           MPP+EDWEKYKAP++   + E A++ K  PLSEGDIQVLKTYGAAPYA KLKE EKDLK 
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 60  IEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSD------- 112
           IE +IKEKSG++ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKS  +       
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 113 ------------------SNENGEGLDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIA 154
                             S ENGE  D  A                    KYVINLKQIA
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDA--------------------KYVINLKQIA 160

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           KFVVGLGERVSPTDIEEGMRVGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG
Sbjct: 161 KFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 220

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
            KDQIEKLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR
Sbjct: 221 CKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 280

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTM 334
           VIGSELVQKYVGEGARMVRELFEMAR+KKACI+FFDEI               NEVQRTM
Sbjct: 281 VIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTM 340

Query: 335 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHS 394
           LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHS
Sbjct: 341 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHS 400

Query: 395 KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVING 454
           KSMSVER IRWELISRLCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AVEKVING
Sbjct: 401 KSMSVERDIRWELISRLCPNTTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVING 460

Query: 455 YKKFSSTSRYMQYN 468
           YKKFSSTSRYMQYN
Sbjct: 461 YKKFSSTSRYMQYN 474

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/469 (82%), Positives = 410/469 (87%), Gaps = 2/469 (0%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAP+E    +  +D    PL+EGDIQVLK+YGAAPYA KLK+TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPNDDKI-VPLTEGDIQVLKSYGAAPYAAKLKQTESDLKDI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNE-NGEG 119
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK   ++++   + 
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDPTTDN 119

Query: 120 LDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179
              +    + S  +           KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 120 NSNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179

Query: 180 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKL 239
           SKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLLSPERFA L
Sbjct: 180 SKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATL 239

Query: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299

Query: 300 RSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359
           R+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 300 RTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359

Query: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAE 419
           NTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRLCPNSTGAE
Sbjct: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 419

Query: 420 LRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           LRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 420 LRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/472 (81%), Positives = 408/472 (86%), Gaps = 5/472 (1%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+E+WEKYKAP+E    ++ ED    PL+EGDIQVLK+YGAAPYA KLK+TE DLKDI
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDEDKI-VPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E RIKEK+G+KESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK   +++++    
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTNN 119

Query: 121 DGAAGPGATSE----NRXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 176
           +        +                  KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 120 NNDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179

Query: 177 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERF 236
           VDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLLSPERF
Sbjct: 180 VDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERF 239

Query: 237 AKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 296
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299

Query: 297 EMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 356
           EMAR+KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 300 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 359

Query: 357 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST 416
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVER IRWELISRLCPNST
Sbjct: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNST 419

Query: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           GAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/477 (79%), Positives = 401/477 (84%), Gaps = 9/477 (1%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKG-SPLSEGDIQVLKTYGAAPYATKLKETEKDLKD 59
           MPP+EDWEK K  +E   D+ A+  +  +PL+E DIQVLKTYG APYA KLKETE DLK+
Sbjct: 1   MPPKEDWEKQKPAVENAEDDAAKKGEDVAPLTEDDIQVLKTYGVAPYAVKLKETENDLKE 60

Query: 60  IEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEG 119
           IE RIKEK+G++ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIKS          
Sbjct: 61  IEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSGN 120

Query: 120 LDGAAGPGATSENRXXXXXXXXXX--------XKYVINLKQIAKFVVGLGERVSPTDIEE 171
               A                            KYVINLKQIAKFVVGLGERVSPTDIEE
Sbjct: 121 NSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIEE 180

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
           GMRVGVDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTYSDVGG KDQIEKLREVVELPLL
Sbjct: 181 GMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 240

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
           SPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 241 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 300

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VRELFEMAR+K+ACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 301 VRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 360

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRL 411
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVERGIRWELISRL
Sbjct: 361 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 420

Query: 412 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           CPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 CPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/478 (80%), Positives = 406/478 (84%), Gaps = 13/478 (2%)

Query: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60
           MPP+EDWEKYKAPIE    +  +     PLSEGDI+VLKTYGAAPYA KLK  E DLK+I
Sbjct: 1   MPPKEDWEKYKAPIEDEESKEEKKV--VPLSEGDIEVLKTYGAAPYAKKLKSIENDLKEI 58

Query: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120
           E++IKEK+G+KESDTGLAPSHLWDI+GDRQRLSEE PLQVARCTKIIK+      +G  L
Sbjct: 59  EKKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEK-PQRSGNAL 117

Query: 121 DGAA-GPGATSENRXXXXXXXXXX---------XKYVINLKQIAKFVVGLGERVSPTDIE 170
            G A G G  +                       KYVINLKQIAKFVVGLGERVSPTDIE
Sbjct: 118 GGDADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIE 177

Query: 171 EGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPL 230
           EGMRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPL
Sbjct: 178 EGMRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPL 237

Query: 231 LSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 290
           LSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR
Sbjct: 238 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 297

Query: 291 MVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNI 350
           MVRELFEMAR+KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNI
Sbjct: 298 MVRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNI 357

Query: 351 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISR
Sbjct: 358 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISR 417

Query: 411 LCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468
           LCPNSTGAELRSVCTEAGMFAIRARRKV TEKDFL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 418 LCPNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/427 (84%), Positives = 374/427 (87%), Gaps = 20/427 (4%)

Query: 42  GAAPYATKLKETEKDLKDIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 101
           GAAPYA KLK  +KDLKDIE +IKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 102 RCTKIIKSTSDSNENGEGLDGAAGPGATSENRXXXXXXXXXXXKYVINLKQIAKFVVGLG 161
           RCTKIIK  +  +  GE                          KY+INLKQIAKFVVGLG
Sbjct: 63  RCTKIIKPEASEDNTGE--------------------EDEEDSKYIINLKQIAKFVVGLG 102

Query: 162 ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEK 221
           ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QI+K
Sbjct: 103 ERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDK 162

Query: 222 LREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 281
           LREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV
Sbjct: 163 LREVVELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELV 222

Query: 282 QKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQL 341
           QKYVGEGARMVRELFEMAR++KACI+FFDEI               NEVQRTMLELITQL
Sbjct: 223 QKYVGEGARMVRELFEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQL 282

Query: 342 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVER 401
           DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIHSKSMSVER
Sbjct: 283 DGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVER 342

Query: 402 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST 461
           GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST
Sbjct: 343 GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSST 402

Query: 462 SRYMQYN 468
           S+YMQYN
Sbjct: 403 SQYMQYN 409

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/385 (86%), Positives = 341/385 (88%), Gaps = 2/385 (0%)

Query: 86  MGDRQRLSEEHPLQVARCTKIIKSTSDSNENGE-GLDGAAGPGATSENRXXXXXXXXXXX 144
           MGDRQRLSEEHPLQVARCTKIIK  + S   GE G D    P +TS N            
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTSTSNNSNAENAEEDEED 60

Query: 145 -KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 203
            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE
Sbjct: 61  NKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 120

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           KPD+TYSDVGG KDQIEKLREVVELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARA
Sbjct: 121 KPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 180

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
           VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR+KKACI+FFDEI           
Sbjct: 181 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDG 240

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL
Sbjct: 241 AGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 300

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
           EGRAN+FRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA+EKD
Sbjct: 301 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVASEKD 360

Query: 444 FLQAVEKVINGYKKFSSTSRYMQYN 468
           FL+AVEKVINGYKKFSSTSRYMQYN
Sbjct: 361 FLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  309 bits (792), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 207/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            RA + RIHS+ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDF 382

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  308 bits (790), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 207/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKV 141

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSG 261

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 262 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVA 321

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            R  + RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 322 ARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 381

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 382 ELAVAKVMN 390

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  308 bits (789), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            RA + RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  308 bits (789), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            RA + RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  308 bits (788), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 207/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            RA + RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 203/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 92  KYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVGG 151

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 152 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 211

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 212 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 271

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA + RIH
Sbjct: 272 MLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIH 331

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+N
Sbjct: 332 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMN 391

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  305 bits (781), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 203/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 92  KYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVGG 151

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 152 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 211

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 212 VSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 271

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA + RIH
Sbjct: 272 MLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIH 331

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+N
Sbjct: 332 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMN 391

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  304 bits (778), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 152/300 (50%), Positives = 202/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 92  KYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVGG 151

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 152 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 211

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 212 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 271

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  + RIH
Sbjct: 272 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIH 331

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+N
Sbjct: 332 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMN 391

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  304 bits (778), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 202/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VGG
Sbjct: 95  KYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVGG 154

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 155 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 214

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 215 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 274

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  + RIH
Sbjct: 275 MLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRIH 334

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+N
Sbjct: 335 SRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMN 394

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  303 bits (775), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 207/311 (66%), Gaps = 2/311 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 76  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVEKV 135

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 136 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 195

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI--XXXXXXXXXX 322
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 196 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGG 255

Query: 323 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 382
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 256 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 315

Query: 383 LEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           +  RA + RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 316 VAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 375

Query: 443 DFLQAVEKVIN 453
           DF  AV KV+N
Sbjct: 376 DFELAVGKVMN 386

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  303 bits (775), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 151/309 (48%), Positives = 205/309 (66%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVEKV 142

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  +GG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAV 202

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEGSG 262

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPTVA 322

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
            R  + RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D 
Sbjct: 323 ARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDL 382

Query: 445 LQAVEKVIN 453
             AV KV+N
Sbjct: 383 ELAVGKVMN 391

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  302 bits (774), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 151/300 (50%), Positives = 201/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ PD TY  VGG
Sbjct: 90  KYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGG 149

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 150 LTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 209

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 210 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 269

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  + RIH
Sbjct: 270 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIH 329

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+N
Sbjct: 330 SRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVSKVMN 389

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  302 bits (773), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 84  KVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 143

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 144 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 203

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 204 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 263

Query: 325 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 264 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 323

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
             R  + RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 324 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 383

Query: 444 FLQAVEKVIN 453
           F  AV KV+N
Sbjct: 384 FELAVGKVMN 393

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  301 bits (770), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 200/300 (66%)

Query: 154 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 213
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 214 GSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 273
           G   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 274 RVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRT 333
           RV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  + RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  300 bits (768), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 78  RVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVEKV 137

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 138 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 197

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 198 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 257

Query: 325 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
              + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 258 GGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 317

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
             R  + RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 318 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 377

Query: 444 FLQAVEKVIN 453
           F  AV KV+N
Sbjct: 378 FELAVAKVMN 387

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  300 bits (768), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 141

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESGS 261

Query: 325 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
             R  + RIHS+ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 444 FLQAVEKVIN 453
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  300 bits (767), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 205/313 (65%), Gaps = 4/313 (1%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 74  KVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKV 133

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 134 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 193

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXX----XXXXX 320
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 194 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESSS 253

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPA 313

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 440
           P L  R  + RIHS+ M++ RGI    I       +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 441 EKDFLQAVEKVIN 453
           ++DF  AV KV+N
Sbjct: 374 QEDFELAVGKVMN 386

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  300 bits (767), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 206/310 (66%), Gaps = 1/310 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVEKV 141

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           PD TY  VGG   QI++++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     I+F DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEGGS 261

Query: 325 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
             RA + RIHS+ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 444 FLQAVEKVIN 453
           F  AV KV+N
Sbjct: 382 FELAVGKVMN 391

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  299 bits (765), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 150/300 (50%), Positives = 201/300 (67%), Gaps = 1/300 (0%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
           K++V +   ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  VGG
Sbjct: 90  KYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVEKVPDSTYDMVGG 149

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              QI +++EV+ELP+  PE F  LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FIR
Sbjct: 150 LTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIR 209

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN-EVQRT 333
           V G+ELVQKY+GEG+RMVRELF MAR     I+F DEI               + EVQRT
Sbjct: 210 VSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRT 269

Query: 334 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIH 393
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA + +IH
Sbjct: 270 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILKIH 329

Query: 394 SKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVIN 453
           S+ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+N
Sbjct: 330 SRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMN 389

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  279 bits (714), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++T+  +GG  DQI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH++ +       +E   ++     GA++R+  TEAG FAIR  R   T  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  278 bits (712), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 197/307 (64%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 413 MKAVRKV 419

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  278 bits (710), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 194/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  DQI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 400 MKAVRKV 406

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  278 bits (710), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 195/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            D+T+  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 412 MKAVRKV 418

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++T+  +GG  DQI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  276 bits (705), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 202/322 (62%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++T+  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+ ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV +  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  275 bits (704), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++T+  +GG  DQI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  275 bits (703), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 194/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            D+T+  +GG  +QI +LREV+ELPL +PE F ++GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IHS  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 413 MKAVRKV 419

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  275 bits (702), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 194/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 170

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 230

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 350

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           G   +F+IH+  +       +E   ++C    GA++R+  TEAG FAIR  R    ++D 
Sbjct: 351 GMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 410

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 411 MKAVRKV 417

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  275 bits (702), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 197/297 (66%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +YSD+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 187

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 ESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F++A  +   I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  +  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTS 367

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
            M++ + + +E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 368 KMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  275 bits (702), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++T+  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  274 bits (700), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  DQI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 415 MKAVRKVAE-VKKLEGTLEYQK 435

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 195/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 106 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 165

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI+ PKG+LLYGPPGTGKTL A+AV
Sbjct: 166 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAKAV 225

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 226 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 285

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 286 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 345

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 346 GRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 405

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 406 MKAVRKV 412

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  273 bits (699), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 194/307 (63%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            D+++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 445 LQAVEKV 451
           ++AV KV
Sbjct: 414 MKAVRKV 420

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  273 bits (697), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +  +    +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   +  Y +
Sbjct: 405 MKAVRKVAE-VKKLEGSLEYQK 425

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  273 bits (697), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  272 bits (696), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  272 bits (696), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 195/297 (65%)

Query: 169 IEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVEL 228
           +E G  V +      I   L    DP +++M +++ P  +YSD+GG ++QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDTDPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVEL 200

Query: 229 PLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 288
           PL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 289 ARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 348
            R+ R++F++A      IVF DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 349 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELI 408
           ++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PDL  +  +  IH+  MS+   +  E +
Sbjct: 321 DVKVIMATNKIESLDPALIRPGRIDRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEEL 380

Query: 409 SRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYM 465
                + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+    + +    YM
Sbjct: 381 VTSKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  272 bits (696), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 164 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 223

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 224 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 283

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 284 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 343

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 344 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLAL 403

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 404 RERRMQVTSEDFEQAKERVL 423

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  271 bits (694), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 202/322 (62%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            +++++ +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           +    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV +  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  272 bits (696), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            +VT+  +GG  +QI  LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH++ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   +  Y +
Sbjct: 422 MKAVRKVAE-VKKLEGSLEYQK 442

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  272 bits (695), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 163 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 222

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 223 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEI 282

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 283 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 342

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA++++VCTEAG+ A+
Sbjct: 343 DRKILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLAL 402

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 403 RERRMQVTAEDFKQAKERVM 422

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  272 bits (695), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  270 bits (689), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 187/281 (66%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
           G  V +      I   L   +DP V++M +++ P  +Y D+GG + QI++++E VELPL 
Sbjct: 83  GCAVSLHHKTMSIVGVLQDDVDPMVSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLT 142

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
            PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+
Sbjct: 143 HPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRL 202

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F++A      I+F DEI                E+QRTMLEL+ QLDGFD    +K
Sbjct: 203 VRQIFKVASENSPSIIFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVK 262

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRL 411
           V+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  +  IH+  M++   + +E +   
Sbjct: 263 VIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTT 322

Query: 412 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
             + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 323 KDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 363

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  271 bits (694), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 181/260 (69%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP +  M +++ P   YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PD+  +  +  IH+  M++   +R + +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  269 bits (688), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 132/310 (42%), Positives = 197/310 (63%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP + +M +++ P  +YSD+GG 
Sbjct: 67  FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTESYSDIGGL 126

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 127 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 186

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F+ A      IVF DEI                E+QRTML
Sbjct: 187 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 246

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  +  IH+ 
Sbjct: 247 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILTIHTS 306

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGY 455
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+++   
Sbjct: 307 KMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERILKNK 366

Query: 456 KKFSSTSRYM 465
            + +  S Y+
Sbjct: 367 VEENLESLYL 376

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  271 bits (694), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL+ +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF Q  E+V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  271 bits (692), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 137/320 (42%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 445 LQAVEKVINGYKKFSSTSRY 464
           ++AV KV    KK   +  Y
Sbjct: 411 MKAVRKVAE-VKKLEGSLEY 429

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  271 bits (692), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 199/310 (64%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +YSD+GG 
Sbjct: 127 FYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 186

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 187 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 246

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F++A      IVF DEI                E+QRTML
Sbjct: 247 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 306

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  +  IH+ 
Sbjct: 307 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILGIHTS 366

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGY 455
            M++   I  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+   
Sbjct: 367 KMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNK 426

Query: 456 KKFSSTSRYM 465
            + +  S Y+
Sbjct: 427 VEENLESLYL 436

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/320 (42%), Positives = 200/320 (62%), Gaps = 1/320 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR ++F+IH+  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 445 LQAVEKVINGYKKFSSTSRY 464
           ++AV KV +  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F +LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F +LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 183/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 161 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 220

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 221 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 280

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 281 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 340

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 341 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLAL 400

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF QA E+V+
Sbjct: 401 RERRMQVTAEDFKQAKERVM 420

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 190/284 (66%)

Query: 169 IEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVEL 228
           +E G  V +      I   L    DP V++M +++ P  +YSD+GG + QI++++E VEL
Sbjct: 141 LEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVEL 200

Query: 229 PLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEG 288
           PL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G
Sbjct: 201 PLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDG 260

Query: 289 ARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRG 348
            R+ R++F++A      IVF DEI                E+QRTMLEL+ QLDGFD RG
Sbjct: 261 PRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRG 320

Query: 349 NIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELI 408
           ++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  +  IH+  M++   +  E +
Sbjct: 321 DVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLCEDVNLETL 380

Query: 409 SRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
                + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 381 VTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  DQI +LREV+ELPL +PE F ++GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  VF+IH+ ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 445 LQAVEKVINGYKKFSSTSRYMQ 466
           ++AV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QAR 423

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 182/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF Q  E+V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  269 bits (688), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 193/297 (64%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPMVSVMKIDKSPAESYNDIGGL 187

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F++A      IVF DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  +  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILGIHTS 367

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
            M++   +  E +       +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 368 KMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  269 bits (687), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 194/297 (65%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYNDIGGL 187

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F++A      IVF DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  +  IH+ 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDVSTKRKILGIHTS 367

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+V+
Sbjct: 368 KMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  268 bits (686), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 181/260 (69%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P  TYSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      IVF DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEI 281

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRI 341

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PDL  +  +  IH+  MS+   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLAL 401

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T KDF Q  E+V+
Sbjct: 402 RERRMQVTAKDFEQGKERVL 421

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  269 bits (688), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 145 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 204
           KY++      +++VG+   +  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 134 KYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 193

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
            ++++  +GG  +QI +LREV+ELPL +PE F ++GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 194 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 253

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A    A FI    S +V KY+GE AR++RE+F  A+  + CI+F DE+            
Sbjct: 254 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGRRFSEGT 313

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
               E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 314 SADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 373

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 444
           GR  +F+IH++ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 374 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHIIPEDL 433

Query: 445 LQAVEKVINGYKKFSSTSRY 464
           ++AV KV    KK   +  Y
Sbjct: 434 MKAVRKVAE-VKKLEGSLEY 452

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F +LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  267 bits (683), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEG+++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  267 bits (682), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV--QAR 414

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  268 bits (684), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 191/297 (64%)

Query: 156 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGS 215
           F V +   V    +E G  V +      I   L    DP + +M +++ P   YSD+GG 
Sbjct: 146 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTENYSDIGGL 205

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
           + QI++++E VELPL  PE + ++GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 206 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 265

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTML 335
           +GSEL+QKY+G+G R+ R++F+ A      IVF DEI                E+QRTML
Sbjct: 266 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 325

Query: 336 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSK 395
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  +  IH+ 
Sbjct: 326 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILAIHTS 385

Query: 396 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVI 452
            M++   +  + +     + +GA+++++CTEAG+ A+R RR   T +DF QA E+++
Sbjct: 386 KMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERIL 442

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  266 bits (681), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEG+++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  266 bits (680), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  266 bits (679), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (679), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 189/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ Y+GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+    I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  265 bits (678), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 182/260 (70%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           DP V++M +++ P   YSD+GG + QI++++E VELPL  PE + ++GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      IVF DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 281

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 341

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           DRK+ F  PD+  +  +  IH+  M++   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLAL 401

Query: 433 RARRKVATEKDFLQAVEKVI 452
           R RR   T +DF +A E+V+
Sbjct: 402 RERRMQVTAQDFKEAKERVL 421

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  266 bits (679), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V    +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QAR 451

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  265 bits (677), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  266 bits (680), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F +LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  264 bits (675), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F +LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  263 bits (671), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 157 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSK 216
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 217 DQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 276
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 277 GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 336
             +LVQ ++GEGA++VR+ F +A+ K   I+F DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 337 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS 396
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA + +IHS+ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 397 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYK 456
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 457 KFSSTSRY 464
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  253 bits (645), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 179/278 (64%), Gaps = 5/278 (1%)

Query: 173 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLS 232
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 233 PERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 292
            + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 293 RELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 352
           R++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 353 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISRL 411
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 412 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  252 bits (643), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 182/292 (62%), Gaps = 8/292 (2%)

Query: 173 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLS 232
           M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q +++RE VELPL  
Sbjct: 160 MSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLTQ 219

Query: 233 PERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 292
            + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMV
Sbjct: 220 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMV 279

Query: 293 RELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 352
           R++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 280 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVKV 339

Query: 353 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISRL 411
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S +
Sbjct: 340 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 397

Query: 412 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 458
             N   +GA + ++  EAG+ A+R  R V  + D  +A +   K  N   KF
Sbjct: 398 IRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  250 bits (639), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 425
           RPGR+DRK+EF SL D   R  +F   +  MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 426 EAGMFAIRARRKVATEKDFLQA 447
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  250 bits (639), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 182/293 (62%), Gaps = 8/293 (2%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSL 369

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVE---KVINGYKKF 458
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A     K  N   KF
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYTAQVKTDNDVDKF 422

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 175/262 (66%), Gaps = 3/262 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 425
           RPGR+DRK+EF SL D   R  +F   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 426 EAGMFAIRARRKVATEKDFLQA 447
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 173/263 (65%), Gaps = 5/263 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     IV
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNS--TGAELRSVC 424
           RPGR+DRK+EF SL D   R  +F   +  MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 425 TEAGMFAIRARRKVATEKDFLQA 447
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  249 bits (637), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 179/279 (64%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (636), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  249 bits (636), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  250 bits (639), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/259 (49%), Positives = 172/259 (66%), Gaps = 3/259 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 425
           RPGR+DRK+EF SL D   R  +F   +  MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 426 EAGMFAIRARRKVATEKDF 444
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (635), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  249 bits (635), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 372

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  249 bits (635), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 179/278 (64%), Gaps = 5/278 (1%)

Query: 173 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLS 232
           M V + R    +   LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+ 
Sbjct: 138 MSVALYRYSNALVDILPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQ 197

Query: 233 PERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 292
            + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 198 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 257

Query: 293 RELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 352
           R++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 258 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 317

Query: 353 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISRL 411
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S +
Sbjct: 318 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 375

Query: 412 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 376 VRNDSLSGAIIAAIMQEAGLRAVRKNRYVILQSDLEEA 413

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  248 bits (634), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSL 368

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 369 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  248 bits (633), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 132/296 (44%), Positives = 183/296 (61%), Gaps = 5/296 (1%)

Query: 155 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 214
            +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY+DVGG
Sbjct: 121 NYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGG 180

Query: 215 SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 274
              Q +++RE VELPL   + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIR
Sbjct: 181 LDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIR 240

Query: 275 VIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTM 334
           V GSE V KY+GEG RMVR++F +AR     I+F DE+                EVQR +
Sbjct: 241 VNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRIL 300

Query: 335 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIH 393
           +EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   
Sbjct: 301 IELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTV 360

Query: 394 SKSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  M++      +L S +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 361 AAKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  248 bits (632), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 130/279 (46%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  247 bits (631), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 130/262 (49%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 425
           RPGR+DRK+EF SL D   R  +F   +  MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 426 EAGMFAIRARRKVATEKDFLQA 447
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  239 bits (611), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 178/279 (63%), Gaps = 5/279 (1%)

Query: 172 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLL 231
            M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q +++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 232 SPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 291
             + + ++GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 292 VRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 351
           VR++F +AR     I+F DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 352 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWELISR 410
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  +F   +  MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSL 369

Query: 411 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLQA 447
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  238 bits (608), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/262 (48%), Positives = 174/262 (66%), Gaps = 3/262 (1%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M+  EKPDV+YSDVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 367
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 368 RPGRIDRKVEF-SLPDLEGRANVFRIHSKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 425
           RPGR+DRK+EF SL D   R  +F   +  M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 426 EAGMFAIRARRKVATEKDFLQA 447
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  201 bits (512), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  D   +L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 433 R 433
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  200 bits (509), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 147/254 (57%), Gaps = 4/254 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 433 R----ARRKVATEK 442
           +    A+R++  +K
Sbjct: 710 KDSIEAQRQLEAKK 723

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  199 bits (507), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           D+ Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  181 bits (459), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 141/241 (58%), Gaps = 2/241 (0%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  D   +LRE VE P+L P+++ K G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 433 R 433
           +
Sbjct: 715 K 715

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  199 bits (506), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 102/234 (43%), Positives = 144/234 (61%), Gaps = 5/234 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  V RIH+K+M +   +  E I+       GA++ S+C+EA M  IR + ++
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREKMEL 431

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 144/251 (57%), Gaps = 3/251 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +   +L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 433 RARRKVATEKD 443
           +   +   E++
Sbjct: 699 KDSIQANIERE 709

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  199 bits (506), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 142/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD  GR ++     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  199 bits (506), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 147/255 (57%), Gaps = 4/255 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG     E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 433 R----ARRKVATEKD 443
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  196 bits (497), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 141/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  + RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  179 bits (454), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 144/250 (57%), Gaps = 1/250 (0%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 433 RARRKVATEK 442
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  198 bits (504), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 146/254 (57%), Gaps = 4/254 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 433 R----ARRKVATEK 442
           +    A+R+   E+
Sbjct: 710 KDSIEAQRRALAEQ 723

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  199 bits (505), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (458), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  198 bits (504), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  181 bits (460), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 141/241 (58%), Gaps = 2/241 (0%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 433 R 433
           +
Sbjct: 709 K 709

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  197 bits (502), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (460), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 433 R----ARRKVATEKD 443
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  197 bits (502), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 145/241 (60%), Gaps = 2/241 (0%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT++D+GG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD E R ++ R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 433 R 433
           +
Sbjct: 707 K 707

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  197 bits (502), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  197 bits (501), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 146/254 (57%), Gaps = 3/254 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG +D   +L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 433 RAR---RKVATEKD 443
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  197 bits (501), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 433 R----ARRKVATEKD 443
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQREAEKE 724

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  197 bits (500), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  197 bits (500), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  197 bits (500), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           DV Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  + RIH+K+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 144/250 (57%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++ R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 433 RARRKVATEK 442
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  197 bits (500), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 433 R----ARRKVATEKD 443
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  196 bits (499), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 142/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +V+++DVGG ++  E+LRE VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R  + +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  196 bits (498), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  + RIH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 140/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  D  E+L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD   R ++     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 433 R 433
           +
Sbjct: 710 K 710

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  196 bits (497), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 141/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  +  IH+K+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  188 bits (478), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 147/254 (57%), Gaps = 4/254 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD  GR ++ +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 433 R----ARRKVATEK 442
           R    A+++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  195 bits (496), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 141/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  V RIH+K+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  181 bits (460), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 140/241 (58%), Gaps = 3/241 (1%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++ K G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD  GR ++     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 433 R 433
           +
Sbjct: 707 K 707

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  195 bits (496), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V Y D+GG + Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 266 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX 325
           N T A F  + G E++ K  GE    +R+ FE A      I+F DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 326 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 385 GRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  +  IH+K+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  186 bits (472), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 140/241 (58%)

Query: 193 DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGP 252
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++ K G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 253 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEI 312
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR+    +VF DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 313 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 372
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 373 DRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           D+ +   LPD  GR ++ +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 433 R 433
           R
Sbjct: 711 R 711

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  192 bits (489), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 159/279 (56%), Gaps = 25/279 (8%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PDL+ RA + +IH+K  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 433 -RARRKVATE--------KDFLQAVEKVINGYKKFSSTS 462
            R+  K+  +         DF+ A+EK++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  191 bits (486), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 158/269 (58%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+ ++  ++FFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PD+ GR  + +IH+K+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 433 -RARRKVATE--------KDFLQAVEKVI 452
            R+  K+A +        KDF+ A++K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  191 bits (484), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 156/279 (55%), Gaps = 45/279 (16%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E+V LPLL PE + K GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 431
           PDL  R+ +  IH+K        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 432 IRARRKV------------------ATEKDFLQAVEKVI 452
           I  +RKV                     +DF+ A+EK++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  179 bits (453), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 109/156 (69%)

Query: 188 LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGI 247
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + + ++GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 248 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIV 307
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     I+
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 308 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 343
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  189 bits (481), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 152/269 (56%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++++ DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR------ 433
           PD + RA + +IH+K+        + E + ++     GA+LR++CTEA +F I+      
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 434 ----------ARRKVATEKDFLQAVEKVI 452
                      R    T  DF+ A++K++
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIV 612

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  188 bits (478), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+LE RA + RIH+KS        + + ++ L     GA+LR++CTEA + +I+
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQ 602

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  188 bits (478), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 155/270 (57%), Gaps = 27/270 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 381 PDLEGRANVFRIHSKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--- 435
           PD++ RA +  IH++  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 436 -------------RKVATEKDFLQAVEKVI 452
                        +   +  DF+ A+EK++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  188 bits (477), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + IE+L+E+V LPLL PE + K  I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 432
           PD   R  + +IH+K  S    +  ELI RL   +    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSP--PLSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 433 ---RARRKV--------ATEKDFLQAVEKVI 452
              R+  K+            DF +A+EK++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  187 bits (476), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 154/269 (57%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PDLE R  +  IH+K  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 433 -RARRKVATE--------KDFLQAVEKVI 452
            R+ +K+  +         DF+ A+EK+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  187 bits (475), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 155/271 (57%), Gaps = 29/271 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 432
           PDL+ R  +  IH+K  +    I  + IS+L   +    GA+LR++CTEA + +I     
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 433 ---RARRKVATE--------KDFLQAVEKVI 452
              ++  K+  +        +DF+ A+EK++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  187 bits (475), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 156/271 (57%), Gaps = 29/271 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ ++DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 266 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXX 319
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  I+FFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 320 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 379
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 380 LPDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 432
           LPD + RA +  IH+K         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 433 -----------RARRKVATEKDFLQAVEKVI 452
                      +++ KV T KDF+ A++K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  187 bits (475), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 159/270 (58%), Gaps = 27/270 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           D+ + +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 266 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXX 319
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  I+FFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 320 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 379
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 380 LPDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 432
           LPD++ R+ +  IH+K  +     +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 433 --RARRKVATEK--------DFLQAVEKVI 452
             ++ +K+  +         DF+ A+EK++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 144/261 (55%), Gaps = 7/261 (2%)

Query: 177 VDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLS 232
           +DRSK  + L         I PS       E P V +SD+GG  D   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 233 PERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 292
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 293 RELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 352
           RE+F  AR+    I+FFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 353 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVE-RGIRWELISRL 411
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  + +  +   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 412 CPNSTGAELRSVCTEAGMFAI 432
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  169 bits (427), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 136/230 (59%), Gaps = 8/230 (3%)

Query: 209 YSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRT 268
           Y+DVGG K +I+ L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 269 DATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN 328
           +A  + + G  +V KY+GE    +RE+F+ A+  +  I+F DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 329 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 387
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 388 NVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 433
           ++ +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 154/269 (57%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++++ DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                +    TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PD + R+ + +IH+K  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 433 -RARRKV--------ATEKDFLQAVEKVI 452
            R+  K+         T  DF+ A+EK++
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIV 676

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (473), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 156/279 (55%), Gaps = 45/279 (16%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + DVGG  + I++L+E+V LPLL PE + K GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  I+FFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 431
           P LE R+ +  IH+K        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 432 IRARRKV------------------ATEKDFLQAVEKVI 452
           I  +RK+                     +DF+ A+EK++
Sbjct: 640 I--QRKLPQIYQSDIKLHIDPSTVNVKARDFMLALEKIV 676

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  184 bits (468), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 148/262 (56%), Gaps = 6/262 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           + PS       E P V +SD+GG  +   KL+E+++LPL + E FA+LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD + R  + R  +   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 431 AIRARRKVATEKDFLQAVEKVI 452
           +I     V TEK   +  EK +
Sbjct: 727 SI--MENVETEKVSTEHFEKAL 746

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           VTY+ VGG   +IE L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            T+A  + + G  +V KY+GE    +R++F  A   +  IVF DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 327 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 386
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 387 ANVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 433
            ++     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  186 bits (472), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 149/268 (55%), Gaps = 25/268 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRAR---- 435
           PD+  RA +  IH++         + E ++ L     GA+LR++CTEA + +I+ R    
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRRFPQY 602

Query: 436 ------------RKVATEKDFLQAVEKV 451
                       +     KDF+ A+EK+
Sbjct: 603 IKVSQVGNKPKGKCQVKAKDFMIAMEKI 630

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  185 bits (470), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 152/269 (56%), Gaps = 27/269 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                ++   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 436
           PD   RA +  IH+K  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 437 --------------KVATEKDFLQAVEKV 451
                         KV T KDF+ A++K+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  183 bits (464), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 140/242 (57%), Gaps = 3/242 (1%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG ++   K++E+++LPL + E FA+LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +  + PD E R  + R  +K   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 431 AI 432
           AI
Sbjct: 727 AI 728

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 130/232 (56%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +TY  VGG   +++ L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
             +A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 386 RANVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  184 bits (468), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 156/269 (57%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++++ +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 266 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
                 +   TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 381 PDLEGRANVFRIHSKSMSVERG-IRWELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PDL+ R+ + +IH+K        +  E ++ L     GA+LR++CTEA + +I       
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRKFPQI 623

Query: 433 -RARRKVATE--------KDFLQAVEKVI 452
            ++  K++ +        +DF+ A++K+I
Sbjct: 624 YQSNLKLSIDPKDVKVKARDFMIALDKII 652

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H   + +  GI ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  184 bits (466), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 154/269 (57%), Gaps = 25/269 (9%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 432
           PD++ R+ + +I ++  S    I + + ++ L     GA+LRS+CTEA + +I       
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQI 651

Query: 433 -RARRKVATE--------KDFLQAVEKVI 452
            R+  K+  +         DF+ A++K++
Sbjct: 652 YRSNDKLLVDPSKIKVKVSDFMLALKKIV 680

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  183 bits (464), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  ++FFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 433
           PD++ R+ + +I +K  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           VT+ DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P+R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     +VF DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H K + +   I ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 443 DFLQAVEKVINGYKKFS 459
            F QAVE+VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  181 bits (460), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 199 MTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKT 258
              E    + ++DV G  +  E++ E V+  L  P R+ K+G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 259 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXX 318
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 319 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 377
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 378 FSLPDLEGRANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 434
             LP+LEGR  +F +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 435 RRKVATEKDFLQAVEKVINGYKKFS 459
                    F +A+E+VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  181 bits (458), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 151/282 (53%), Gaps = 14/282 (4%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG  +   K++E+++LPL + E FA+LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD E R  +    +K   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 431 AI--RARRKVATEKDFLQAVEKVING--------YKKFSSTS 462
           AI    + K      F +A+E +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  161 bits (407), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 130/232 (56%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + Y  VGG   +I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 234 LLYEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 293

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 294 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDD 350

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E 
Sbjct: 351 SGEVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEA 410

Query: 386 RANVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++      +MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 411 RLDILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQ 462

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  180 bits (457), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 115/312 (36%), Positives = 167/312 (53%), Gaps = 26/312 (8%)

Query: 165 SPTDIEEGMRVGV-DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLR 223
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG +D   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 224 EVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 283
           E+++LPL + + FA LGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 284 YVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 343
           YVGE  R +RE+F  AR+    I+FFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 344 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGI 403
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  + +  +K+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 404 RWELISRLCPNS---TGAELRSVCTEAGMFAIR--ARRKVATEKDF---LQAVEKVING- 454
             EL++ L   +   +GAE+  +C EAG+ AI      K      F   LQ + K I   
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAIMDDIHTKKVDANHFEVALQGISKCITPE 755

Query: 455 ----YKKFSSTS 462
               Y++F+S S
Sbjct: 756 MLEYYQEFASRS 767

 Score =  166 bits (420), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y  VGG K +I+ L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +RE+F  A+  +  I+F DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 386 RANVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++ +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 443 DFLQAVEKVINGYKKFS 459
           +F QA+E+VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  181 bits (459), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/271 (36%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+ ++  I+FFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAI----- 432
           PD++ R  + +I +K  +    +  E I++L        GA+LRS+CTEA + +I     
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQRNFP 655

Query: 433 ---RARRKVATE--------KDFLQAVEKVI 452
              R+  K+  +         DF+ A++K++
Sbjct: 656 QIYRSNDKLLVDPSKIKVKVNDFMLALKKIV 686

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 158/294 (53%), Gaps = 9/294 (3%)

Query: 169 IEEGMRVGVDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLRE 224
           I+ G+   +DR K  + L         I PS       E P V +SD+GG ++  +K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 225 VVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 284
           +++LPL + E F +LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 285 VGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 344
           VGE  R +RE+F  AR+    I+FFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 345 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSV-ERGI 403
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  +F+  +K   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 404 RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 457
             E ++      +GAE+  +C EAG+ AI     + T K   +  EK ++G  K
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAI--MEDLETSKVEARHFEKALSGISK 755

 Score =  157 bits (398), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 140/249 (56%), Gaps = 8/249 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + Y+ VGG   +I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            T+A  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 386 RANVFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 441
           R ++       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 442 KDFLQAVEK 450
           ++ L+ + K
Sbjct: 476 REKLKVILK 484

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 147/267 (55%), Gaps = 6/267 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG ++   K++E+++LPL + E FA+LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  ARS    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD+  R  + +  +K  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 431 AIRARRKVATEKDFLQAVEKVINGYKK 457
           AI     VA  K  L+  EK   G  +
Sbjct: 735 AIMEDLDVA--KVELRHFEKAFKGIAR 759

 Score =  166 bits (419), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/232 (37%), Positives = 134/232 (57%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG   +IE L+  +E+PL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 386 RANVFRIHSKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++       MS +R +      + I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTIQ 470

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           VT+ DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F++H   + +  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  181 bits (458), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 93/234 (39%), Positives = 139/234 (59%), Gaps = 9/234 (3%)

Query: 206 DVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVA 265
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 266 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXX 320
               +     TF    G++++ K+VGE  R +R LFE A+  +  I+FFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 321 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 381 PDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 433
           PD++ R  + +I ++  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 168/311 (54%), Gaps = 19/311 (6%)

Query: 169 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKL 222
           I+ G++   D S   +++ +         I PS       E P V +SD+GG ++   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 223 REVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 282
           +E+++LPL + + F +LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 283 KYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 342
           KYVGE  R +RE+F  ARS    I+FFDEI               +     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEI--DALSPDRDGGSSSSAASHVLTSLLNEID 641

Query: 343 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERG 402
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  + + ++K+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 403 -IRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--RKVATEKDFLQAVEKVING----- 454
            I  E ++R     +GAE+  +C EAG+ AI         T + F +A++ +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 455 ---YKKFSSTS 462
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  166 bits (420), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 136/239 (56%), Gaps = 6/239 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V+Y+ VG    +IE LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            +DA  + + G  +V KY+G+    +R++F  A+  +  I+F DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 327 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 386
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 387 ANVFRIHSKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 441
            ++       MS +R    +    +I+       GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 386 RANVFRIHSKSMSVERGI--RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
           R  +F++H   +++   I      ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 513 RKEIFKVHLSKITLAEDIVDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLEH 572

Query: 444 FLQAVEKVINGYKKFS 459
           F  A+E+VI G ++ S
Sbjct: 573 FEHAIERVIGGVERKS 588

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 147/261 (56%), Gaps = 9/261 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V++ DV G  +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXX--XX 324
                F+ V GSE V+ +VG GA  VR+LFE ARS    I+F DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 385 GRANVFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  ++ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 439 ATEKDFLQAVEKVINGYKKFS 459
            T   F QA+E+VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 148/262 (56%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ DV G  +  +++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE ARS    I+F DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 385 GRANVFRIHSKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR +++ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
            K    + F QA+E+VI G +K
Sbjct: 540 DKYVELRHFEQAIERVIAGLEK 561

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ KLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  178 bits (452), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V++ DV G  +  +++ E V   L  PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR++FE AR     I+F DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 385 GRANVFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 436 RKVATEKDFLQAVEKVINGYKKFS 459
               T K F QA+E+VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  178 bits (451), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 145/262 (55%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +   ++ E V   L +P+++  LG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 385 GRANVFRIHSKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
            +    K F QA+E+VI G +K
Sbjct: 510 DEYVELKHFEQAIERVIAGLEK 531

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + ++DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 443 DFLQAVEKVINGYKKFS 459
            F  A+E+VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  178 bits (452), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L +P+R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 443 DFLQAVEKVINGYKK 457
            F QA+E+VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  177 bits (450), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 148/267 (55%), Gaps = 6/267 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG +D   K++E+++LPL + E F +LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  ARS    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD+  R  + +  +K  ++E  GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 431 AIRARRKVATEKDFLQAVEKVINGYKK 457
           AI     V   K  L+  EK   G  +
Sbjct: 735 AIMEDLDVT--KVELRHFEKAFKGISR 759

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 135/232 (58%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG + +IE L+  +++PL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 386 RANVFRIHSKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++       MS +R        +LI+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTIQ 470

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  178 bits (451), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  177 bits (448), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +   ++ E V   L  P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 385 GRANVFRIHSKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARR 436
           GR  ++++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 437 KVATEKDFLQAVEKVINGYKKFS 459
                 +F QA+E+VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  177 bits (449), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 139/242 (57%), Gaps = 3/242 (1%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG ++   K++E+++LPL +   FA+LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +  + PD + R  + +  +K   +E   I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 431 AI 432
           AI
Sbjct: 733 AI 734

 Score =  160 bits (404), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 138/250 (55%), Gaps = 10/250 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +TY  +GG + ++E L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
             +A  + + G  +V KY+GE    +R++F  A+  +  I+F DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 386 RANVFRIHSKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 441
           R ++   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 442 KDFLQAVEKV 451
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  177 bits (449), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H   + +   I ++L +RL    P   GA++ +VC EA + A R  +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  177 bits (448), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 145/261 (55%), Gaps = 11/261 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +   ++ E V   L  P+++ KLG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 385 GRANVFRIHSKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRARR 436
           GR  ++++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 437 KVATEKDFLQAVEKVINGYKK 457
                + F QA+E+VI G +K
Sbjct: 536 AFVEFRHFEQAIERVIAGLEK 556

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H + + +  G   +L +RL    P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P+R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 386 RANVFRIHSKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H K + +   I ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G  +   ++ E V+  L +PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 385 GRANVFRIHSKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 436 RKVATEKDFLQAVEKVINGYKKFS 459
                 + F QA+E+VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/266 (36%), Positives = 147/266 (55%), Gaps = 6/266 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG ++  +K++E+++LPL + E F++LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  ARS    I+FFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD+  R  + +  +K  +  E G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADRTEGYSGAEVVLLCQEAGLA 734

Query: 431 AIRARRKVATE--KDFLQAVEKVING 454
           AI     V     + F +A E +  G
Sbjct: 735 AIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  169 bits (427), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 91/234 (38%), Positives = 136/234 (58%), Gaps = 12/234 (5%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG   +IE L+  +E+PL  PE F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 386 RANVFRIHSKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           R ++       MS ER      GI+   I+       GA+L ++C E+ M  I+
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTIQ 470

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  176 bits (445), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 8/245 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V Y+ VGG K +   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            TDA  + + G  +V KY+GE    +R++F  A+  +  I+F DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 386 RANVFRIHSKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 441
           R ++ R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 442 KDFLQ 446
           +D L+
Sbjct: 504 RDDLK 508

 Score =  174 bits (442), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V + D+GG ++  +K++E+++LPL + E FAKLG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    P  + R  + +  +K  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 431 AI 432
           AI
Sbjct: 759 AI 760

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  175 bits (443), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ +V G  +  +++ E V   L +P ++ KLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
             +  F  V GSE V+ +VG GA  VR+LF  ARS    I+F DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 385 GRANVFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  ++ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 439 ATEKDFLQAVEKVINGYKK 457
            T   F QA+E+VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  175 bits (444), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 147/271 (54%), Gaps = 10/271 (3%)

Query: 169 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKL 222
           I+ G+ +  D  K+ + + L         I PS       E P V +SD+GG  +   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 223 REVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 282
           +E+++LPL + E FA+LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 283 KYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 342
           KYVGE  R +RE+F  ARS    I+FFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 343 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVE-R 401
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  + +  +K  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 402 GIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           G+  + ++      +GAE+  +C EAG+ AI
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAI 733

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/283 (34%), Positives = 149/283 (52%), Gaps = 16/283 (5%)

Query: 164 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGS 215
           VS  D+      G    +Y++  P   R   +    T E +          ++Y+ VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
             +IE L+  +E+PL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 334
            G  +V KY+GE    +RE+F  AR  +  I+F DEI                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 335 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHS 394
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R ++     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 395 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 433
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  175 bits (443), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 158/288 (54%), Gaps = 13/288 (4%)

Query: 150 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 209
           L  I KF+    E   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTW 549

Query: 210 SDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTD 269
           ++VG       +L   +  P+  PE + K+GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 270 ATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNE 329
           A FI + G EL+ KYVGE  R +R++F  AR+   C++FFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 330 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANV 389
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + ++
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 390 FRIHSKS--MSVERGIRWELI--SRLCPNSTGAELRSVCTEAGMFAIR 433
               S+S    +  G+ +  I     C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  145 bits (367), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P    + +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +RELFE A+S   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  175 bits (443), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 149/258 (57%), Gaps = 9/258 (3%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG-SKDQIEKLREVVELPLLSPERFAKL 239
           KY   L   P I P+         PDVT+S+VG   K +IE    +V+ P+  PE + K+
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQ-PIKRPELYEKV 556

Query: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299
           GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  A
Sbjct: 557 GISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRA 616

Query: 300 RSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359
           R+   CI+FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP
Sbjct: 617 RASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRP 673

Query: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS----MSVERGIRWELISRLCPNS 415
           + +DPA+LRPGR+D+ +   LP+ + + ++ +   KS    +S +  I+  +    C N 
Sbjct: 674 DMIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNF 733

Query: 416 TGAELRSVCTEAGMFAIR 433
           +GA+L ++  E+ + A++
Sbjct: 734 SGADLAALVRESSVLALK 751

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P    + +GG  D I +L E++ LP+L PE +A  G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A++   C+VFFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 325 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  174 bits (441), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 136/242 (56%), Gaps = 3/242 (1%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG +D   K++E+++LPL +PE F++L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD E R  + R  +K    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 431 AI 432
           AI
Sbjct: 729 AI 730

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 133/228 (58%), Gaps = 8/228 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG + +IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 386 RANVFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 429
           R ++     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVM 461

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 150/277 (54%), Gaps = 6/277 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V +SD+GG  D   K++E+++LPL + E F +LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMF 430
           +DR +    PD + R  +    +K+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 431 AIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQY 467
           AI     + TE    +  EK ++G  +    +  +QY
Sbjct: 729 AI--MENLETENVEQRHFEKALSGISR-GINAEMLQY 762

 Score =  160 bits (404), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 132/228 (57%), Gaps = 8/228 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG   +IE L+  +ELPL  P  FA+ G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
             +A  + + G  +V KY+GE    +R++F  AR  +  IVF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 386 RANVFRIHSKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGM 429
           R ++     + +S +R  +  E I  +   +    GA+L ++C EA M
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVM 461

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG       +L   +  P+  PE + K+G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFR--IHSKSMSVERGIRWELI--SRLCPNST 416
            +DPA+LRPGR+D+ +   LPDL  + ++ +  I S    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  149 bits (377), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P    S +GG  D + +L E++ LP+L PE +A  GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A+S   C+VFFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 325 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  + ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  174 bits (441), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ ++G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F++H K +++  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ ++G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 386 RANVFRIHSKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
           R  +F++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 444 FLQAVEKVINGYKKFS 459
           F QA+E+VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/268 (35%), Positives = 148/268 (55%), Gaps = 7/268 (2%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           + PS       E P V +SD+GG ++   K+ E+++LPL + E F++LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 429
           +DR +  + PD   R  +    S   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 430 FAIRARRKVATEKDFLQAVEKVINGYKK 457
            AI     + T++   +  EK ++G  +
Sbjct: 732 AAI--MENLDTKRVEARHFEKALSGISR 757

 Score =  152 bits (384), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/229 (35%), Positives = 128/229 (55%), Gaps = 6/229 (2%)

Query: 209 YSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRT 268
           YS VGG   +I+ L++ +ELPL  P  F +  + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 269 DATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN 328
           +A  + + G  +V K++GE    +RE+F+ A+  +  I+F DEI                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 329 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 388
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 389 VFRIHSKSMSVERGIRWELISRLCPNST----GAELRSVCTEAGMFAIR 433
           + +     M+ +     +   R   + T    GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLSDDDIRNIASRTHGYVGADLIALCRESVMKAIQ 469

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 143/262 (54%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V++ +V G  +   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 385 GRANVFRIHSKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H K +++E  +             ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
               T + F QA+E+VI G +K
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEK 564

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 147/257 (57%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE + K+G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVG 563

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMS--VERGIRWELISR--LCPNST 416
            +DPA+LRPGR+D+ +   LP+ E + ++ +  +KS    +   + +E I R   C N +
Sbjct: 681 MIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFS 740

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  149 bits (376), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P+ +   +GG  D + +L E++ LP+L PE F   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ ARS   C+VFFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 143/266 (53%), Gaps = 6/266 (2%)

Query: 198 MMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGK 257
           M   +    V ++ V G  +  E++ E V   L  P R+ ++G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 258 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXX 317
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     IVF DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 318 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 376
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 377 EFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 433
               P+L GR  +F +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 434 ARRKVATEKDFLQAVEKVINGYKKFS 459
                     F QAVE+VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ +V G  +  +++ E V   L +P ++ KLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
             +  F+ V GSE V+ +VG GA  VR+LF  ARS    I+F DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 385 GRANVFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  ++ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 439 ATEKDFLQAVEKVINGYKK 457
            T   F QA+E+VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE + K+G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS----MSVERGIRWELISRLCPNST 416
            +DPA+LRPGR+D+ +   LP+ E + ++ +  +KS    +S +      + +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  146 bits (369), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 128/232 (55%), Gaps = 6/232 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P+ +   +GG  D I +L E++ LP+L PE F   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A+S   C+VFFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 432
           P+   R ++ +  S  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 152/273 (55%), Gaps = 15/273 (5%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE + K+G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS----MSVERGIRWELISRLCPNST 416
            +DPA+LRPGR+D+ +   LP+ E + ++ +  +KS    +S +      + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 417 GAELRSVCTEAGMFAIRARRKVATEKDFLQAVE 449
           GA+L ++  E+ + A++        ++F Q+ E
Sbjct: 741 GADLAALVRESSVLALK--------RNFFQSEE 765

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P+ +   +GG  D + +L E++ LP+L PE F   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A+S   C+VFFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ +V G  +  +++ E V   L +P ++ KLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
             +  F+ V GSE V+ +VG GA  VR+LF  ARS    I+F DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 385 GRANVFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  ++ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 439 ATEKDFLQAVEKVINGYKK 457
            T   F QA+E+VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 148/257 (57%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE + K+G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMS--VERGIRWELI--SRLCPNST 416
            +DPA+LRPGR+D+ +   LP++E + ++ +  +KS    +   + +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  149 bits (377), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P+ +   +GG  D + +L E++ LP+L PE F   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A+S   C+VFFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ R  S  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  173 bits (438), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ K+G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     IVF DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R ++F +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 443 DFLQAVEKVINGYKKFS 459
            F QA+E+VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 153/292 (52%), Gaps = 25/292 (8%)

Query: 176 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPER 235
           GV +SK H              +   E    VT+ DV G ++  +++ E V+  L +P +
Sbjct: 293 GVGKSKAH--------------LFNKETDVKVTFKDVAGCQEAKQEIMEFVDF-LKNPHK 337

Query: 236 FAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 295
           + +LG   P+G +L GPPGTGKTL A+AVA      F+ V GSE V+ +VG GA  VR+L
Sbjct: 338 YTELGAKIPRGAILSGPPGTGKTLLAKAVAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL 397

Query: 296 FEMARSKKACIVFFDEIXXXXXXXXXXXXX--XXNEVQRTMLELITQLDGFDPRGNIKVM 353
           FE A      I+F DEI                 +E + T+ +L+ ++DGF     + V+
Sbjct: 398 FEQASKMAPSIIFVDEIDAIGKARGKNGSLGGSNDEREATLNQLLVEMDGFSTSDQVVVL 457

Query: 354 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSV--------ERGIRW 405
             TNRP+ LD ALLRPGR DR V+   PD+EGR  ++ +H K +++        ++ +  
Sbjct: 458 AGTNRPDVLDKALLRPGRFDRHVQIDAPDVEGRKLIYLVHLKKLNLDPLYSEDKQKQLLA 517

Query: 406 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKK 457
             ++ L P  TGA++ + C E+ + A R          F +A+E+VI G +K
Sbjct: 518 GKLAALTPGFTGADIANACNESALIAARKMDPYVQFTHFEEAIERVIAGLEK 569

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  172 bits (435), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 142/261 (54%), Gaps = 11/261 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 385 GRANVFRIHSKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRARR 436
           GR  ++++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 437 KVATEKDFLQAVEKVINGYKK 457
                K F QA+E+VI G +K
Sbjct: 506 PYVEFKHFDQAIERVIAGLEK 526

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  172 bits (436), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 159/289 (55%), Gaps = 15/289 (5%)

Query: 150 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 209
           L  I KF+    E   P + E+   + +   +Y   L   P I P+         PDVT+
Sbjct: 462 LTIIQKFIQNFPE---PLNDEQLSNLSI---QYEDFLKALPTIQPTAKREGFATVPDVTW 515

Query: 210 SDVGG-SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRT 268
           + VG  +K ++E    +V+ P+  PE + K+GI  P G+LL+GPPG GKTL A+AVAN +
Sbjct: 516 ASVGALTKVRVELNMAIVQ-PIKKPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANES 574

Query: 269 DATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN 328
            A FI + G EL+ KYVGE  R +R++F  AR+   C++FFDE+               +
Sbjct: 575 RANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDSTLSESSS 634

Query: 329 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 388
            V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +
Sbjct: 635 RVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNAEEKLD 691

Query: 389 VF----RIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           +     R +   MS +  +   +    C N +GA++ S+  E+ + A++
Sbjct: 692 ILKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVRESSVLALK 740

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P      +GG +D + +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      F+ +    +V    GE  + +R+LF+ ARS   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  172 bits (435), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 144/262 (54%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V++ +V G  +   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 385 GRANVFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
                   F QA+E+VI G +K
Sbjct: 534 DPYILLSHFEQAIERVIAGLEK 555

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  172 bits (436), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 145/258 (56%), Gaps = 9/258 (3%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG-SKDQIEKLREVVELPLLSPERFAKL 239
           KY   L   P I P+         PDVT+S VG   K +IE    +V+ P+  PE + K+
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQ-PIKRPELYEKV 543

Query: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299
           GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  A
Sbjct: 544 GISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRA 603

Query: 300 RSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359
           R+   CI+FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP
Sbjct: 604 RASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRP 660

Query: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANVFR--IHSKSMSVERGIRWELI--SRLCPNS 415
           + +DPA+LRPGR+D+ +   LP+ E + ++ R  I S    +   +    I     C N 
Sbjct: 661 DMIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNF 720

Query: 416 TGAELRSVCTEAGMFAIR 433
           +GA++ ++  E+ + A++
Sbjct: 721 SGADIAALVRESSVLALK 738

 Score =  145 bits (367), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P    S +GG  D I +L E++ LP+L PE ++  G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +RELF+ A+S   C+VFFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 325 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R  + +  + S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  171 bits (434), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ +V G  +  +++ E V   L +P ++ KLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
             +  F+ V GSE V+ +VG GA  VR+LF  ARS    I+F DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 385 GRANVFRIHSKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 438
           GR  ++ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 439 ATEKDFLQAVEKVINGYKK 457
            T   F QA+E+VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  172 bits (435), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+S+VG  +    +L   +  P+  PE + K+G
Sbjct: 503 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVG 562

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 563 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 622

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 623 ASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRPD 679

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS----MSVERGIRWELISRLCPNST 416
            +DPA+LRPGR+D+ +   LP+ + + ++ R  + S    +S +  ++  +    C N +
Sbjct: 680 MIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFS 739

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 740 GADLAALVRESSVLALK 756

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P  + S +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +RELF+ A+S   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  +  + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           +++ DV G  +  +++ E V   L +P ++ +LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 385 GRANVFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 436 RKVATEKDFLQAVEKVINGYKKFS 459
            K      F QA+E+VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 147/257 (57%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT++++G   +   +L   +  P+  PE + K+G
Sbjct: 454 KYEDFLKALPTIQPTAKREGFATVPDVTWNNIGALSNVRLELNMAIVQPIKRPELYEKVG 513

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 514 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 573

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 574 ASIPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 630

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFR--IHSKSMSVERGIRW-ELISRL-CPNST 416
            +DPA+LRPGR+D+ +   LP  E + ++ +  + S    V   I + E+I+   C N +
Sbjct: 631 MIDPAMLRPGRLDKTIFIELPTKEEKLDILQTLLRSNGTPVAHDIDFAEIINDFRCQNFS 690

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 691 GADLAALVRESSVSALK 707

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P+     +GG  D + +L E++ LP+L PE F   GIDPP+G+LL+GPPG GKT  A A+
Sbjct: 167 PETNLQSLGGMDDVVAQLMELIGLPILHPEIFETTGIDPPRGVLLHGPPGCGKTSIANAL 226

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI V    +V    GE  + +R+LFE A+    C++FFDEI            
Sbjct: 227 AGELKVPFISVSAPSVVSGMSGESEKKIRDLFEEAQQIAPCLIFFDEIDAITPKRDGGAQ 286

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D    +      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 287 REME--KRIVAQLLTSMDELTLQKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 344

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 345 PNEVSRLHILKKLSSTLKLDGEIDFLQLAKLTPGFVGADLKALITAAGTCAIK 397

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 144/262 (54%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE AR+    I+F DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 385 GRANVFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR +++ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
            +    + F QA+E+VI G +K
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEK 554

>TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON}
           Anc_4.259 YLR397C
          Length = 808

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 150/284 (52%), Gaps = 15/284 (5%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           + PS       E P V +SD+GG ++  +K++E+++LPL + E F KLG+  PKG+LLYG
Sbjct: 523 VRPSAMREIFLEMPKVYWSDIGGQEELKQKMKEMIQLPLEASETFNKLGVTAPKGVLLYG 582

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR+    I+FFDE
Sbjct: 583 PPGCSKTLTAKALATESGINFFAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 642

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 643 IDAISSSREGGSGSDVS--NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 700

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNS---TGAELRSVCTEAG 428
           +DR +    PD   R  + +  +     E       +  L   +   +GAE+  +C EAG
Sbjct: 701 LDRHLYVGPPDFNARLQIIKKCTIKFGSEIQNDEPFLRELSAKTGGCSGAEVVLLCQEAG 760

Query: 429 MFAIRARRKV--ATEKDFLQAVEKVING--------YKKFSSTS 462
           + AI A  +V    +  F  A+E +  G        Y++F+S S
Sbjct: 761 LSAIMADYQVDKVGKHHFQNALEGLSRGITEDMLGYYQQFASRS 804

 Score =  164 bits (416), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 137/232 (59%), Gaps = 8/232 (3%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           ++Y+ VGG   +IE L+  +ELPL  P+ F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 269 LSYNLVGGLNKEIEILKNAIELPLHKPKLFSRFGVSPPRGILLHGPPGTGKTMLLRCVAN 328

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            ++A  + + G  +V KY+GE    +R+ F  A+  +  I+F DEI              
Sbjct: 329 NSNAHVLTINGPSIVSKYLGETESSLRDFFNEAKKYQPSIIFIDEI---DSIAPNRSSDD 385

Query: 327 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
             EV+ R +  L+T +DG    G + V+ ATNRPN++D AL RPGR D+++E  +PD++G
Sbjct: 386 SGEVESRVVATLLTLMDGMGNSGRVVVVGATNRPNSIDSALRRPGRFDQEIEIGIPDVDG 445

Query: 386 RANVFRIHSKSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 433
           R ++       MS ER  +  E I  +   +    GA+L ++C E+ M AI+
Sbjct: 446 RKDILLKQFHKMSSERHSLSDEDIQSIASKTHGYVGADLSALCRESVMKAIQ 497

>TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.23
           YLL034C
          Length = 806

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 161/295 (54%), Gaps = 23/295 (7%)

Query: 148 INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDV 207
           I L  I KF+    E   P + E+   + +   KY   L   P I P+         PDV
Sbjct: 457 IPLSTIQKFIKNFPE---PLNDEQLQHLTI---KYEDFLKALPTIQPTAKREGFATVPDV 510

Query: 208 TYSDVGG-SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           T+++VG  SK +IE    +V+ P+  PE + K+GI  P G+LL+GPPG GKTL A+AVAN
Sbjct: 511 TWANVGALSKIRIELNMAIVQ-PIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVAN 569

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
            + A FI + G EL+ KYVGE  R +R++F  AR+   C++FFDE+              
Sbjct: 570 ESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTTLSES 629

Query: 327 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 386
            + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ + +
Sbjct: 630 SSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKTLFIELPNTQEK 686

Query: 387 ANVFRIHSKSMSVERG--------IRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
            ++     K++ V  G        +   +    C N +GA++ ++  EA + A++
Sbjct: 687 LDII----KTLKVSNGTPIADDVDLEKVIADERCRNFSGADIAALLREASVLALK 737

 Score =  142 bits (359), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 128/233 (54%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P      +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PSTNLESLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI V    +V    GE  + +R+LF+ A+    C+VFFDEI            
Sbjct: 247 AGELQVPFISVSAPSIVSGMSGESEKKLRDLFDEAKQLAPCLVFFDEIDAITPKRDGGAQ 306

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D    +      + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDEISMQKTDGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 364

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S+ + ++  I +  +++L P   GA+L+++ T +G  AI+
Sbjct: 365 PNEISRIHILKKMSQHLKIDGEIDFIKLAKLTPGFVGADLKALITASGTCAIK 417

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 6/255 (2%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  E++ E V   L  P R+ K+G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXX 326
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 327 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 385
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 386 RANVFRIHSKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 442
           R  +F +H K + +   I ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 443 DFLQAVEKVINGYKK 457
            F QA+E+VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 143/264 (54%), Gaps = 12/264 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           V + DV G  +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXX--XXX 324
                F+ V GSE V+ +VG GA  VR+LFE  R     I+F DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 325 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 385 GRANVFRIHSKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 436 RKVATEKDFLQAVEKVINGYKKFS 459
                   F QA+E+VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  170 bits (430), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 144/278 (51%), Gaps = 5/278 (1%)

Query: 192 IDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYG 251
           I PS       E P V ++D+GG      K++E+++LPL + E FA+LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 252 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDE 311
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  ARS    I+FFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 312 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 371
           I                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 372 IDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 429
           +DR +    PD   R  + +  +   S++    + L  ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 430 FAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQY 467
            AI     V   K   +  EK ++G  +  +      Y
Sbjct: 731 AAI--MEDVEANKVESRHFEKALSGISRIITPEMLAYY 766

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 153/283 (54%), Gaps = 16/283 (5%)

Query: 164 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGS 215
           VS  D+ +     V+ S  ++  P+  R   +    T   KP         + Y  VGG 
Sbjct: 185 VSKCDLNQDSTTTVEDSSPYLSPPVIFRRGSTKVEFTKASKPSSRFNLSHSIGYDSVGGL 244

Query: 216 KDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 275
             +IE L+  + LPL  P+ F++ G+ PP+GILL+GPPGTGKT+  R VAN TDA  + +
Sbjct: 245 AKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVANTTDAHILTI 304

Query: 276 IGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 334
            G  +V KY+GE    +RE+F+ A+  +  I+F DEI                EV+ R +
Sbjct: 305 NGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDDSGEVESRVV 361

Query: 335 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHS 394
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E R ++     
Sbjct: 362 ATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEERIDILMKQF 421

Query: 395 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 433
           + MS E+  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 422 ERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

>Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {ON}
           complement(29676..32195) [2520 nt, 840 aa]
          Length = 839

 Score =  170 bits (430), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+++VG       +L   +  P+  PE + K+G
Sbjct: 512 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALDKTRVELNMAIVQPIKRPELYEKVG 571

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 572 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 631

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 632 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 688

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRL----CPNST 416
            +DPA+LRPGR+D+ +   LP+ + + ++ +  ++S         EL + +    C N +
Sbjct: 689 MIDPAMLRPGRLDKTLFIELPNEDEKLDIIKTLTRSNGTPLADDVELQTIISDERCRNFS 748

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 749 GADLAALVRESSVLALK 765

 Score =  144 bits (362), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P      +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 205 PSSDLKSLGGMDDVIAQLMELIGLPILHPEIYQSTGVEPPRGVLLHGPPGCGKTSIANAL 264

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 265 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKAIAPCLMFFDEIDAITPKRDGGAQ 324

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 325 REME--RRIVAQLLTSMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 382

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S+++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 PNEVSRLHILKKMSENLKIDGEIDFAQLAKLTPGFVGADLKALSTAAGTCAIK 435

>TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {ON}
           Anc_4.23 YLL034C
          Length = 861

 Score =  169 bits (428), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDVT+  +G       +L   +  P+  PE + K+G
Sbjct: 506 KYEDFLKALPTIQPTAKREGFATVPDVTWESIGALDKIRAELNLAIVQPVKRPELYEKVG 565

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 566 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFSRAR 625

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 626 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 682

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVF----RIHSKSMSVERGIRWELISRLCPNST 416
            +DPA+LRPGR+D+ +   LP+ E + ++     +++   ++ +  +   +    C N +
Sbjct: 683 MIDPAMLRPGRLDKTLFIELPNFEEKLDILKTITKVNGTPLASDVDLSIIINDERCRNYS 742

Query: 417 GAELRSVCTEAGMFAIR 433
           GA++ S+  E+ + A++
Sbjct: 743 GADIASLVRESSVLALK 759

 Score =  149 bits (377), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 128/233 (54%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P  + S +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 202 PTSSLSSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 261

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI V    +V    GE  + VRELFE A+S   C++FFDEI            
Sbjct: 262 AGELQVPFISVSAPSVVSGMSGESEKKVRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 321

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 322 REME--RRIVAQLLTSMDELSMEKTDGKPVIVIGATNRPDALDAALRRAGRFDREICLNV 379

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P    R ++ +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 380 PSEVSRLHILKKMSNNLRIDGHIDFSKLAKLTPGFVGADLKALVTAAGTCAIK 432

>TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4.23
           YLL034C
          Length = 820

 Score =  169 bits (427), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 140/248 (56%), Gaps = 7/248 (2%)

Query: 190 PRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILL 249
           P I P+         PDVT++ VG   +   +L   +  P+  PE + K+GI  P G+LL
Sbjct: 503 PTIQPTAKREGFATVPDVTWASVGALGNIRIELNMAIVQPIKRPELYEKVGISAPAGVLL 562

Query: 250 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFF 309
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR+   C++FF
Sbjct: 563 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFF 622

Query: 310 DEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 369
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 623 DELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRNGIFVIGATNRPDMIDPAMLRP 679

Query: 370 GRIDRKVEFSLPDLEGRANVFRIHSK--SMSVERGIRWELISR--LCPNSTGAELRSVCT 425
           GR+D+ +   LP+ + + ++    +K     ++  +    I R   C N +GA+L S+  
Sbjct: 680 GRLDKTLFIELPNFQEKLDIINTITKVNGTPLDDSVNLSEIIRDDRCKNFSGADLASLVR 739

Query: 426 EAGMFAIR 433
           E+ + A++
Sbjct: 740 ESSVLALK 747

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/262 (32%), Positives = 141/262 (53%), Gaps = 15/262 (5%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P    S++GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 189 PTSLLSNLGGMDDVIAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 248

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +RELF+ A+S   C++FFDEI            
Sbjct: 249 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 308

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 309 REME--RRIVAQLLTAMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 366

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR------- 433
           P+   R ++ +  S+ + ++  I +  +++L P   GA+L+++ T AG  AI+       
Sbjct: 367 PNEVSRLHILKKMSEHLKIKGEIDYLKLAKLTPGFVGADLKALVTAAGTCAIKRIFQSYA 426

Query: 434 --ARRKVATEKDFLQAVEKVIN 453
               ++++T  D ++  EK  N
Sbjct: 427 ELEEKQISTTSDSMEIDEKTPN 448

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   I+F DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23
           YLL034C
          Length = 794

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           KY   L   P I P+         PDV++S VG  +    +L   +  P+  PE + K+G
Sbjct: 463 KYDDFLKALPTIQPTAKREGFATVPDVSWSSVGALQKIRLELNMAIVQPIKRPELYEKVG 522

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 523 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFARAR 582

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   CI+FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 583 ASIPCIIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 639

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFR--IHSKSMSVERGIRWELI--SRLCPNST 416
            +DPA+LRPGR+D+ +   LP+ E + ++F+  I S    +   +    I       N +
Sbjct: 640 MIDPAMLRPGRLDKTLFIELPNAEEKLDIFKTLIRSNGTPIANDVDLAKIIEDDRSKNYS 699

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 700 GADLAALVRESSILALK 716

 Score =  149 bits (375), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P +T   +GG  D + +L E++ LP+L PE +A  GI+PP+G+LL+GPPG GKT  A A+
Sbjct: 178 PSITLKSLGGMDDVVAQLMELIGLPILHPEIYAATGIEPPRGVLLHGPPGCGKTTIANAL 237

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A   +  FI +    +V    GE  + +R++F+ A+S   C++FFDEI            
Sbjct: 238 AGELNVPFINISAPSIVSGMSGESEKKLRDVFQEAKSIAPCLIFFDEIDAITPKRDGGAQ 297

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP+ LD AL R GR DR++  ++
Sbjct: 298 REME--KRIVAQLLTSMDELTMEHTDGKPVIVIGATNRPDALDSALRRAGRFDREICLNV 355

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 356 PNEISRLHILKKMASNLKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 408

>NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON}
           Anc_7.215 YER047C
          Length = 870

 Score =  168 bits (426), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 162/289 (56%), Gaps = 15/289 (5%)

Query: 150 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 209
           L  I KF+    +   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 512 LSIIQKFIKNFPD---PLNTEQLGQLAI---KYEDFLKALPTIQPTAKREGFATVPDVTW 565

Query: 210 SDVGG-SKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRT 268
           ++VG   K +IE    +V+ P+  PE + K+GI  P G+LL+GPPG GKTL A+AVAN +
Sbjct: 566 ANVGALGKIRIELNMAIVQ-PIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANES 624

Query: 269 DATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXN 328
            A FI + G EL+ KYVGE  R +R++F  AR+   C++FFDE+               +
Sbjct: 625 RANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSS 684

Query: 329 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 388
            V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ + + +
Sbjct: 685 RVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNYDEKLD 741

Query: 389 VFRIHSKS--MSVERGIRWELISR--LCPNSTGAELRSVCTEAGMFAIR 433
           +    ++S    +   +++  I +   C N +GA+L ++  E+ + A++
Sbjct: 742 IITTLARSNGTPLADDVQFSEIIKDERCRNFSGADLAALVRESSVLALK 790

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 205 PDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAV 264
           P      +GG  D I +L E++ LP+L PE +   G++PP+G+LL+GPPG GKT  A A+
Sbjct: 219 PTSNLESLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 278

Query: 265 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXX 324
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 279 AGELKVPFISISAPSVVSGMSGESEKKIRELFEEAKALAPCLMFFDEIDAITPKRDGGAQ 338

Query: 325 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 380
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 339 REME--RRIVAQLLTSMDELTMEQTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 396

Query: 381 PDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           P+   R ++ +  S+++ ++  I +  +++L P   GA+L+S+ T AG  AI+
Sbjct: 397 PNEVSRLHILKKMSQNLKIDGSIDFLKLAKLTPGFVGADLKSLTTAAGTCAIK 449

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ VRELF  ARS+   IVF DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/262 (34%), Positives = 140/262 (53%), Gaps = 12/262 (4%)

Query: 207 VTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVAN 266
           + + DV G ++  +++ E V   L SP+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 267 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXX- 325
                F+ V GSE V+ +VG GA  VR+LFE AR     I+F DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 326 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 384
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 385 GRANVFRIHSKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 435
           GR  ++ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 436 RKVATEKDFLQAVEKVINGYKK 457
                   F QA+E+VI G +K
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEK 563

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   I+F DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 819

 Score =  167 bits (422), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240
           +Y   L   P I P+         PDV+++++G       +L   +  P+  PE + K+G
Sbjct: 493 RYEDFLKALPTIQPTAKREGFATVPDVSWANIGALNRVRIELNMAIVQPIKRPELYEKVG 552

Query: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 553 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFSRAR 612

Query: 301 SKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360
           +   C++FFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 613 ASVPCVIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 669

Query: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKS--MSVERGIRWELISR--LCPNST 416
            +D A+LRPGR+D+ +   LP+ E + ++ +  +++    +   + +E I R   C N +
Sbjct: 670 MIDAAMLRPGRLDKTLFIELPNFEEKLDIIKTLARTNGTPLSSDVDFEAIIRDESCRNFS 729

Query: 417 GAELRSVCTEAGMFAIR 433
           GA+L ++  E+ + A++
Sbjct: 730 GADLAALIRESSVLALK 746

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 130/225 (57%), Gaps = 6/225 (2%)

Query: 213 GGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATF 272
           GG  D + +L E++ LP+L PE FA  G++PP+G+LL+GPPG GKT  A A+A      F
Sbjct: 205 GGMDDVVAQLMELIGLPILHPEIFASTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPF 264

Query: 273 IRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQR 332
           I +    +V    GE  + +R+LFE A+S   C+VFFDEI                  +R
Sbjct: 265 ISISAPSVVSGMSGESEKKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREME--RR 322

Query: 333 TMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 388
            + +L+T +D   F+  G   + ++ ATNRP++LD AL R GR DR++  ++P+   R +
Sbjct: 323 IVAQLLTSMDELSFEKTGGKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEISRLH 382

Query: 389 VFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           + +  S ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 ILKKMSSTLKIDGSIDFLKLAKLTPGFVGADLKALSTAAGTCAIK 427

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  166 bits (421), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   I+F DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  166 bits (419), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K DV + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF+ AR++   I+F DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 444 FLQAVEKVINGYKK 457
           F  A +K + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLL034C (RIX7)
          Length = 827

 Score =  166 bits (420), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 138/248 (55%), Gaps = 7/248 (2%)

Query: 190 PRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILL 249
           P I P+         PDVT+S VG   +   +L   +  P+  PE + K+GI  P G+LL
Sbjct: 503 PTIQPTAKREGFATVPDVTWSSVGALSNIRVELNMAIVQPIKRPELYEKVGISAPAGVLL 562

Query: 250 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFF 309
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR+   C++FF
Sbjct: 563 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFF 622

Query: 310 DEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 369
           DE+               + V  T+L   T+LDG + R  I VM ATN+P+ + PA+LRP
Sbjct: 623 DELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVMGATNKPDMMTPAMLRP 679

Query: 370 GRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRL----CPNSTGAELRSVCT 425
           GR+D+ +   LP+ + + ++     KS         +L + +    C N +GA+L ++  
Sbjct: 680 GRLDKTLFIELPNADEKLDIMHTLVKSNGTPLAPDVDLSAVVNDERCRNFSGADLAALLR 739

Query: 426 EAGMFAIR 433
           E+ + A++
Sbjct: 740 ESSVLALK 747

 Score =  158 bits (399), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 147/274 (53%), Gaps = 7/274 (2%)

Query: 165 SPTDIEEGMRVGVDRSKYHIELPLPPRI-DPSVTMMTVEEKPDVTYSDVGGSKDQIEKLR 223
           +P   E+GM V  D  K + + P    I  P    +     P    S +GG  D I +L 
Sbjct: 159 TPKSAEDGMAVESDSKKGNKKRPTKDAIIKPKRQKVQDRTPPSADLSSLGGMDDVIAQLM 218

Query: 224 EVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 283
           E+V LP+L PE FA  G++PP+GILL+GPPG GKT  A A+A      FI +    +V  
Sbjct: 219 ELVALPILHPEIFASTGVEPPRGILLHGPPGCGKTSIANALAGELQVPFISISAPSVVSG 278

Query: 284 YVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD- 342
             GE  + +R+LFE A+S   C+VFFDEI                  +R + +L+T +D 
Sbjct: 279 MSGESEKKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREME--RRIVAQLLTSMDE 336

Query: 343 -GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSV 399
             F+      + ++ ATNRP++LD AL R GR DR++  ++P+   R ++ +  + ++ V
Sbjct: 337 LSFEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREISLNVPNELSRMHILKKMTSNLKV 396

Query: 400 ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 433
           +  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 397 DGEIDFLKLAKLTPGFVGADLKALATAAGTCAIK 430

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 146/255 (57%), Gaps = 6/255 (2%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR+    I+F DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 444 FLQ-AVEKVINGYKK 457
            L+ A +K++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   IVF DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GR+++ + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  164 bits (416), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 139/254 (54%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +R+LF  ARS+   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   I+F DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 139/254 (54%), Gaps = 4/254 (1%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +R+LF  ARS+   I+F DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 444 FLQAVEKVINGYKK 457
           F  A +K++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  164 bits (414), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 204 KPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARA 263
           K +V + DV G  +   +L E+V+  L  P ++  LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 264 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIXXXXXXXXXXX 323
            A      F  + GSE  + YVG GA+ +RELF  AR++   I+F DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 324 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 383
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 384 EGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 443
            GRA++ + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 444 FLQ-AVEKVINGYKK 457
            L+ A +K++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,479,349
Number of extensions: 1845638
Number of successful extensions: 6069
Number of sequences better than 10.0: 542
Number of HSP's gapped: 5556
Number of HSP's successfully gapped: 647
Length of query: 468
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 355
Effective length of database: 40,524,141
Effective search space: 14386070055
Effective search space used: 14386070055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)