Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A04994g3.186ON60860830540.0
Smik_4.2213.186ON61961814130.0
YDL013W (SLX5)3.186ON61961313680.0
NCAS0I019103.186ON61361713640.0
Suva_4.2363.186ON63062013580.0
Skud_4.2403.186ON61961713570.0
NDAI0A065103.186ON71265112321e-161
SAKL0C07964g3.186ON62363012081e-158
KAFR0A012203.186ON64764911991e-157
AER213C3.186ON55758511631e-152
Kwal_27.98243.186ON58555910301e-132
KLTH0E15884g3.186ON58661510081e-129
TDEL0D043503.186ON5566149341e-118
TBLA0F007203.186ON6495269011e-112
KLLA0C04411g3.186ON6076298651e-107
Kpol_1036.523.186ON5916397796e-95
KNAG0J012703.186ON5473616711e-79
TPHA0A043703.186ON6642595699e-64
CAGL0K01881g3.186ON5062675413e-61
Kpol_1045.247.416ON18631780.36
Ecym_63311.286ON55092800.38
Kwal_27.107237.416ON22935780.48
Suva_11.2491.286ON55186771.1
KLTH0G15532g3.111aON41657742.4
YKR017C (HEL1)1.286ON55186715.7
TBLA0B04595singletonON53686706.3
Ecym_71377.416ON26391696.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A04994g
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...  1181   0.0  
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   548   0.0  
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   531   0.0  
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   530   0.0  
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   527   0.0  
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   527   0.0  
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   479   e-161
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   469   e-158
KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...   466   e-157
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   452   e-152
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   401   e-132
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   392   e-129
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   364   e-118
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   351   e-112
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   337   e-107
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   304   6e-95
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   263   1e-79
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   223   9e-64
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   213   3e-61
Kpol_1045.24 s1045 (56271..56831) [561 bp, 186 aa] {ON} (56273.....    35   0.36 
Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}...    35   0.38 
Kwal_27.10723 s27 (468604..469293) [690 bp, 229 aa] {ON} YER116C...    35   0.48 
Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {...    34   1.1  
KLTH0G15532g Chr7 (1358507..1359757) [1251 bp, 416 aa] {ON} cons...    33   2.4  
YKR017C Chr11 complement(471694..473349) [1656 bp, 551 aa] {ON} ...    32   5.7  
TBLA0B04595 Chr2 (1066340..1067950) [1611 bp, 536 aa] {ON}             32   6.3  
Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to...    31   6.6  

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/608 (94%), Positives = 574/608 (94%)

Query: 1   MDLRGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLN 60
           MDLRGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLN
Sbjct: 1   MDLRGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLN 60

Query: 61  RFVNSEGTNVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVI 120
           RFVNSEGTNVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVI
Sbjct: 61  RFVNSEGTNVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVI 120

Query: 121 EVXXXXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ 180
           EV              GLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ
Sbjct: 121 EVNDNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ 180

Query: 181 DRTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNI 240
           DRTRRQAMERSARRASRLLFHTS      SGNGTVENGRLPPSV              NI
Sbjct: 181 DRTRRQAMERSARRASRLLFHTSDDDDDDSGNGTVENGRLPPSVLQLRRQEEERSRLRNI 240

Query: 241 TRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQEC 300
           TRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQEC
Sbjct: 241 TRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQEC 300

Query: 301 DNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGG 360
           DNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGG
Sbjct: 301 DNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGG 360

Query: 361 GFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKK 420
           GFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKK
Sbjct: 361 GFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKK 420

Query: 421 YMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEV 480
           YMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEV
Sbjct: 421 YMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEV 480

Query: 481 PVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRT 540
           PVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRT
Sbjct: 481 PVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRT 540

Query: 541 FVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTR 600
           FVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTR
Sbjct: 541 FVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTR 600

Query: 601 GKMREAFF 608
           GKMREAFF
Sbjct: 601 GKMREAFF 608

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/618 (49%), Positives = 400/618 (64%), Gaps = 49/618 (7%)

Query: 21  DEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTN--------VAT 72
           DE  I+I+SD+EED  IR+   P+RL+PD R+ R RD LNRFV S+  N          T
Sbjct: 21  DEAVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRNRNAQRIHTTTT 80

Query: 73  TRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVXXX------- 125
           +   +  G++D+V I+ E+    G +EGPI   A YVDLD + G + +E           
Sbjct: 81  SEYSNTQGNNDDVTIIREVGRFFG-DEGPIDPSAHYVDLDEEPGSETLEAPRTIRVDNAN 139

Query: 126 ---XXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-D 181
                         GL IV+ERTT PR+TLNLPGGE L+++A+ TD P RRSFE+Q+   
Sbjct: 140 GYLNDSHDDNENDDGLTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRSFEFQEDLA 199

Query: 182 RTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNIT 241
            +RRQ + RSA RA  L    S        + T     LP ++                 
Sbjct: 200 ASRRQLLRRSATRARSLFVDRSDENDE---DWTEHTHSLPETIQRARRESHMRMNRRIAE 256

Query: 242 RR---------RDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSV 292
           R+         RD+  S + +    L  +RERI S+ PDVRSAF HA+SL+EFRSILQ+V
Sbjct: 257 RQLMAQQQRISRDENTSTSFR----LQSIRERIQSYTPDVRSAFHHAESLHEFRSILQNV 312

Query: 293 APLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHF 352
           AP+TLQEC+ EL+ LFTE+R++++QNWA  RV++ Q+E+ RL+ E  ERQ R     R+F
Sbjct: 313 APVTLQECEEELMALFTEFRNQLLQNWAIERVRNTQEEALRLHREALERQGRT--TGRNF 370

Query: 353 RIHMGVGGGFGESLANYILMNAN-GMGSNDAAWLYNGYV-GDMDEEESTQSIVSMIQERE 410
             H GV   F ES+ANY+  N + G  S     L++G V  D DEE  TQ+I+ MIQERE
Sbjct: 371 --HRGV---FRESIANYLNFNGDDGFLSR----LWSGSVLNDADEERHTQNIIDMIQERE 421

Query: 411 EREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKD 470
           ERE D   K  M KT+ QQ+ +  RA  LP+GYSASFDT PK+KLDI+++GKEET++V D
Sbjct: 422 ERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTTPKMKLDIMKNGKEETIIVTD 481

Query: 471 DSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPS 530
           D ++    ++PVC LCG ELGVGIPD+F G+++ DRG+SFE LV KY+FHCPYQTLARPS
Sbjct: 482 DDLAKTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGISFEGLVSKYKFHCPYQTLARPS 541

Query: 531 QLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPA 590
            LDRDLS+RTF+A CGH YCGRCFARIDNA+ KS+  K+KLAQLKGSAHPDNYGPK+CPA
Sbjct: 542 VLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPKKKLAQLKGSAHPDNYGPKLCPA 601

Query: 591 KGCKSPIRTRGKMREAFF 608
           + CK  IR+RGK++E +F
Sbjct: 602 ESCKKLIRSRGKLKEVYF 619

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/613 (48%), Positives = 395/613 (64%), Gaps = 41/613 (6%)

Query: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFV-------NSEGTNV-ATT 73
           E  I+I+SD+EED  IR+   P+RL+PD R+ R RD LNRFV       NS+ T++ A++
Sbjct: 22  ETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRSRNSQRTHITASS 81

Query: 74  RSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVXXXXXXXXXX- 132
              D   ++D++ I+ E+    G ++GPI   A YVDLD + G + +E            
Sbjct: 82  ERPDFQANNDDITIIREVGRFFG-DDGPIDPSAHYVDLDQEPGSETLETPRTIQVDNTNG 140

Query: 133 ---------XXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-DR 182
                        GL IV+ERTT PRVTLNLPGGE L++ A+ TD P RRSFE+Q+    
Sbjct: 141 YLNDNGNNNESDDGLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQEDLGA 200

Query: 183 TRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXX----XXX 238
           +RRQ + RSA RA  L    S        + T +   LP ++                  
Sbjct: 201 SRRQLLRRSATRARNLFVDRSDENDE---DWTDDTHNLPEAIQRARRESRMRMSRRIAER 257

Query: 239 NITRRRDQMRSDAMQGNPV-LMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTL 297
               ++ ++ SD      + L  +RERI S+ PD+RSAF  A+SL+EFRSILQ+VAP+TL
Sbjct: 258 QRRVQQQRVSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVAPITL 317

Query: 298 QECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMG 357
           QEC+ EL+ LFTE+R++++QNWA +RV++ Q+E+ RL+ E  ERQ R      H      
Sbjct: 318 QECEEELMALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALERQERTAGRVFH------ 371

Query: 358 VGGGFGESLANYILMNA-NGMGSNDAAWLYNG-YVGDMDEEESTQSIVSMIQEREEREHD 415
             G   ES+ NY+  N  +G  S     L++G  + D DEE  TQ+I+ MIQEREERE D
Sbjct: 372 -RGTLRESITNYLNFNGEDGFLSR----LWSGPALSDADEERHTQNIIDMIQEREERERD 426

Query: 416 SRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSD 475
              K  M KT+ QQ+ +  RA  LP+GYSASFDT PK+KLDI ++GKEET++V DD ++ 
Sbjct: 427 VVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTPKMKLDITKNGKEETIIVTDDDLAK 486

Query: 476 QWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRD 535
             +++PVC LCG ELGVGIPD+F GI++ DRGVSFE LV KY+FHCPYQTLARPS LDRD
Sbjct: 487 TLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFEGLVSKYKFHCPYQTLARPSMLDRD 546

Query: 536 LSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKS 595
           LS+RTF+A CGH +CGRCFARIDNA+ KS+M K+KLAQLKGSAHPDNYGPK+CPA  CK 
Sbjct: 547 LSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKLAQLKGSAHPDNYGPKLCPADSCKK 606

Query: 596 PIRTRGKMREAFF 608
            IR+RG+++E +F
Sbjct: 607 LIRSRGRLKEVYF 619

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 22  EDPII-IESDQEEDQRIRDDARPI-RLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQD-- 77
           +DPII IESD E+D RIR+D + I RL+PD R  RPRD +NRFV+++G+N A   + D  
Sbjct: 10  QDPIITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNRFVDAQGSNRAIRSTPDLS 69

Query: 78  --------NGGSDDEVAIVGEINNTR-GNEEGPIGSDAEYVDLDAD------NGPQVIEV 122
                   +   DD++ IV EI N     ++ PI  DAE++DLD +        P+   +
Sbjct: 70  HLNDDQDQDQDDDDDITIVREIVNPNVARDDAPINPDAEFIDLDQEVPYANATIPRPRTI 129

Query: 123 XXXXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-D 181
                          LVI QERT  P VTLNLPGG++LQ+DA+PTD+  R SFEWQ+   
Sbjct: 130 QIITPSPPQQQQDDDLVITQERTMRPTVTLNLPGGQTLQVDATPTDQLARSSFEWQENIP 189

Query: 182 RTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNIT 241
             RRQ + RS  RA+ L FH        + NG+V    LPP+V                 
Sbjct: 190 LARRQLLRRSTNRANSLFFHDDHESD--NDNGSVP---LPPNVIRLRQRQQQQNREEPPP 244

Query: 242 RRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECD 301
               Q   DA   NP++ RLR RI+++ PD++SAF HA SL+EF SILQ+VAPLTLQEC 
Sbjct: 245 PPPPQ--DDA---NPIMTRLRTRINTYSPDIQSAFNHAHSLHEFTSILQNVAPLTLQECG 299

Query: 302 NELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGGG 361
           +EL+ LFT+YRS+++ NWAT RV+S+QQ +   N      +    +     R+      G
Sbjct: 300 DELLSLFTQYRSQLMVNWATRRVRSSQQNTSSSNHRQRNLRNLRRNGA--LRVTPN-ANG 356

Query: 362 FGESLANYILMNANGMGS-NDAAWLYNG---------YVGDMDEEESTQSIVSMIQEREE 411
           F  +LA   LMN  G+ + ND    + G         + GD +++  TQ+I++MIQ REE
Sbjct: 357 FNVNLARLFLMNQLGINNGNDEDQYFTGAYNSEDDADHNGDDEDDTQTQNIINMIQRREE 416

Query: 412 REHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDD 471
           +EHD+RTK +M +T+ QQ ++ +RA ELP+ YSA+F+TEP +KLDI ++GKEET++V+D+
Sbjct: 417 QEHDTRTKSFMARTKPQQDAFKKRANELPENYSANFNTEPTMKLDIKKNGKEETIIVEDN 476

Query: 472 SVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQ 531
             +  + EVP CTLCGVELGVGIP +F+GI   DRG SFE LV KY+FHCPYQ+LA+PSQ
Sbjct: 477 DAAKNYIEVPACTLCGVELGVGIPKDFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQ 536

Query: 532 LDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAK 591
           LD+DLS+R F+A CGHT+CGRC+ARIDNA+ KS++ K+ L QLKGS+HPDNYGP++CPA 
Sbjct: 537 LDKDLSQRVFMASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPAD 596

Query: 592 GCKSPIRTRGKMREAFF 608
            C+S +R + KMRE FF
Sbjct: 597 SCRSLLRVKTKMREVFF 613

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/620 (47%), Positives = 392/620 (63%), Gaps = 42/620 (6%)

Query: 21  DEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVA------TTR 74
           D   I+I+SD+EED  IR+   P+RL+PD R+ R RD LNRF+ S+ T+        T R
Sbjct: 21  DNSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLR 80

Query: 75  SQ--DNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNG------PQVIEVXXXX 126
           S   D     D+V I+ E+    G++ GPI   A YVDLD + G      P++I+V    
Sbjct: 81  SDGPDTQNDIDDVTIIREVGRFFGDD-GPIDPSALYVDLDQEPGSETVETPRIIQVNNTN 139

Query: 127 ----------XXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176
                               GL IV+ERT  PR+TLNLPGGE L+++A+P D P RRSFE
Sbjct: 140 GYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGGERLEVNATPRDIPIRRSFE 199

Query: 177 WQQQ-DRTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXX 235
           +Q+    +RRQ + RSA RA  L    S          T     LP ++           
Sbjct: 200 FQEDLAASRRQLLRRSAARARNLFVERSDEDDENDEEWTENTNDLPETIQRARRESHMRM 259

Query: 236 X------XXNITRRRDQMRSDAMQGNPV-LMRLRERIDSFPPDVRSAFVHAQSLYEFRSI 288
                     I  ++ +M S+   G  + L  +RERI ++ PD+RSAF HA+SL+EFRSI
Sbjct: 260 SRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFRSI 319

Query: 289 LQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHN 348
           LQ+VAP+TLQEC+ EL+ LFTE+R++++QNWA +RV++ Q+E+ RL+ E  E Q R+   
Sbjct: 320 LQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNTQEEALRLHREALEGQERVAGG 379

Query: 349 RRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQE 408
             H        G + ES+++Y  +N NG             + + DEE  TQ+I+ MIQE
Sbjct: 380 ALHH-------GPYRESISSY--LNFNGEDGFLTRLWGGPVLNEADEERHTQNIIDMIQE 430

Query: 409 REEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVV 468
           REERE D   K  M KT+ QQ  + +RA  LP+GYSASFDT PK+KLDI+++GKEET+ V
Sbjct: 431 REERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTTPKMKLDIMKNGKEETITV 490

Query: 469 KDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLAR 528
            DD ++   ++V VC LCGVELGVGIPD+F G+++ DRG+SFE LV +Y+FHCPYQTLAR
Sbjct: 491 LDDDLAKTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGISFEGLVSRYKFHCPYQTLAR 550

Query: 529 PSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKIC 588
           PS LDRDLS+RTFVA CGHTYCGRC+ARIDNA+ KS+  K+KLA+LKGSAHPDNYGPK+C
Sbjct: 551 PSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPKKKLAELKGSAHPDNYGPKLC 610

Query: 589 PAKGCKSPIRTRGKMREAFF 608
           PA  CK  IR+RG+++E +F
Sbjct: 611 PADSCKKLIRSRGRLKEVYF 630

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/617 (47%), Positives = 385/617 (62%), Gaps = 38/617 (6%)

Query: 17  INGRDEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQ 76
           +N  D+  I+IESD+EED  IR+   P+RL+PD R+ R RD LNRFV S+   +   R  
Sbjct: 16  VNHPDDSVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSVGINPQRIH 75

Query: 77  --------DNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVXXXXXX 128
                   D    +D+V IV E+    G++ GPI   A +VDLD +   + +E       
Sbjct: 76  TTARPNRSDPQNDNDDVTIVREVGRFFGDD-GPIDPSAHFVDLDHEPDSETLETPTTLQV 134

Query: 129 -----------XXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEW 177
                              GL IV+ERTT PRVTLNLPGGE L+++A+ TD P RRSFE+
Sbjct: 135 DNINGYLNDNFNDNDNNDDGLTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSFEF 194

Query: 178 QQQ-DRTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXX 236
           Q     +RRQ + RSA RA  L    S          T +   +P ++            
Sbjct: 195 QDDLAVSRRQLLRRSAARARTLFVDRSDENDE---EWTEDTDNVPEAIQRARRESHMRMS 251

Query: 237 XXNITR--RRDQMR---SDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQS 291
                R  R  Q R   ++ M  +     +RERI ++ PD+RSAF HA+SL+EFRSILQ+
Sbjct: 252 RRIAERQLRAQQHRMASNENMNTSIRFQSIRERIQAYAPDIRSAFYHAESLHEFRSILQN 311

Query: 292 VAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRH 351
           VAP+TLQEC+ EL+ LFTE+R++++Q+WA +RV++ Q+E+ RL+ E  ERQ R      H
Sbjct: 312 VAPVTLQECEGELMALFTEFRNQLLQDWAIDRVRNTQEEALRLHREALERQERATGRVFH 371

Query: 352 FRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREE 411
                   G F ES+ NY  +N +G          +  + D DEE  TQ+I+ MIQEREE
Sbjct: 372 -------RGPFRESITNY--LNFSGENGFLTRLWGSPVLNDADEERHTQNIIDMIQEREE 422

Query: 412 REHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDD 471
           RE D   K  M KT+ QQ+ +  RA  LP+GYSASFDT PK+KLDI+++ KEET+ V DD
Sbjct: 423 RERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTTPKMKLDIMKNDKEETITVTDD 482

Query: 472 SVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQ 531
            ++   + +PVC LCGVELGVGIPD+F G+ + DRG+SFE LV KY+FHCPYQTLARPS 
Sbjct: 483 DLARTLEVIPVCCLCGVELGVGIPDDFIGMNQKDRGISFEGLVSKYKFHCPYQTLARPSM 542

Query: 532 LDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAK 591
           LDRDLSRRTF+A CGH YCGRCFARIDNA+ KS+  K+KLA L+GSAHPDNYGPK CPA+
Sbjct: 543 LDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKKKLASLRGSAHPDNYGPKFCPAE 602

Query: 592 GCKSPIRTRGKMREAFF 608
            CK PIR+RG+++E +F
Sbjct: 603 SCKKPIRSRGRLKEVYF 619

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  479 bits (1232), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 290/651 (44%), Positives = 393/651 (60%), Gaps = 84/651 (12%)

Query: 25  IIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQD------- 77
           I+IESD EED RIR+++R I L PD RI RPRD L+RF+++   N  TT  +D       
Sbjct: 79  ILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISTNPNNTNTTSRRDAQEENEE 138

Query: 78  NGGSDDEVAIVGEI-----NNTRGNEEGPIGSDAEYVDLDADNGPQVI------------ 120
           N  +DD+ AI+ EI     NN   NE GPI   AEYVDLDA+  P+ I            
Sbjct: 139 NDENDDDFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAE--PEYITNSRPRTIIINN 196

Query: 121 ----EVXXXXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176
                                ++I++ERT+ P VTLNLPGGE L+I+A P +RP R SFE
Sbjct: 197 NSSNNNIENSNGDANDDDDDEVMILEERTSTPTVTLNLPGGERLRINADPNERPTRSSFE 256

Query: 177 WQQQD---RTRRQAMERSARRASR-LLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXX 232
              ++    +RRQ + R+ RRA+  L FH S      S N T E   LP S+        
Sbjct: 257 SLNENIVPLSRRQLLRRATRRATNSLFFHGSDENE--SDNDTDEVS-LPASILGMRQRAR 313

Query: 233 XXXXXXNITRRRDQMRSDA---MQGNPV--------LMRLRERIDSFPPDVRSAFVHAQS 281
                    +R+ Q +  +     GN V        L+ LRERI ++PPDVR AF HAQS
Sbjct: 314 MMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGAFDHAQS 373

Query: 282 LYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHER 341
           L EF SI+QSVAP T  EC ++L+ LFT+YR +++ +W   R++ +Q+++ RL  E H R
Sbjct: 374 LQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLLRERHAR 433

Query: 342 QRR-LWHNRRHFRIHMGVGGGFGESLANYILMNANGMGSND------------------- 381
            R  +  N RHF          G +LA++ LMN  G+G  D                   
Sbjct: 434 VRSTIRANNRHF----------GSNLASFFLMNQLGLGYGDVGAADDEDDGDYGIGEEDN 483

Query: 382 ----AAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAM 437
               AA  Y GY  + D++  TQ+I++MIQ RE+ E DSRTK +M KT+ QQ  + +RA+
Sbjct: 484 DTGRAAGAY-GYEYE-DDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRAL 541

Query: 438 ELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDE 497
            LP+GYS+SF TEPK+K+ + ++GK+ETV+++D  ++  W +VP C LCGVELGVGIP +
Sbjct: 542 ALPEGYSSSFSTEPKVKMTVKKNGKDETVIMEDVDLAKYWMDVPACILCGVELGVGIPKD 601

Query: 498 FEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARI 557
           F G +  D GVSFE LV KY FHCPYQ+L++PSQLDRDLS++ +VA CGHT+CGRC+ RI
Sbjct: 602 FVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGHTFCGRCYVRI 661

Query: 558 DNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF 608
           DNA+ KS++ K+KLA+LKGS+HPDNYGPK CP   CK+ +R+RG+MRE +F
Sbjct: 662 DNAKSKSKLPKKKLAELKGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIYF 712

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 282/630 (44%), Positives = 376/630 (59%), Gaps = 76/630 (12%)

Query: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQD--NG 79
           +D I IESD EED+RIR   R  RL  D RI+RPRD LNRF+NS+G N  T  + +  + 
Sbjct: 27  QDVIEIESDPEEDERIRQQYRQQRLVGDRRINRPRDSLNRFLNSQGENRNTRAALEPDDD 86

Query: 80  GSDDEVAIVGEINNTRGNEEGPIGSDAEYVDL--------------DADNG-PQVIEVXX 124
             DD++ +VGE   T  +  GPIG DA++VDL              D  NG P    +  
Sbjct: 87  EDDDDLQVVGE---TMLDRHGPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTAIIR 143

Query: 125 XXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQ----- 179
                        + I++ERTTAP   LNLPGGESL+I  +  D+P RRSF+ QQ     
Sbjct: 144 HSTGANGSDRGDDIEILEERTTAPNFVLNLPGGESLRISGTTADQPVRRSFQNQQPSRTR 203

Query: 180 ----QDRTRRQAMERSARRASRLLFHTSXXXXXXSGNG-----TVENG--RLPPSVXXXX 228
                   RR+ + R+AR A+ L F         SG G     + EN    +P  V    
Sbjct: 204 AVSAAAAARRRLLNRTARSATNLFF--------SSGQGPQDGYSEENDPDYIPAGVRQLR 255

Query: 229 XXXXXXXXXXNITRRRDQMRSDAMQ--GNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFR 286
                     ++ +RR+Q R + M    N  L  LR RI+ +P D++SAF HAQSLYEF 
Sbjct: 256 QQNAMRDRQASLEQRREQQRLNGMDPGANAELTALRSRINGYPLDIQSAFDHAQSLYEFE 315

Query: 287 SILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNE----ENHERQ 342
            I+QSV P   +    EL  L++ YR  ++ +WA NR ++ ++++ R  +    E  +RQ
Sbjct: 316 GIIQSVEPRMNENRKQELRELYSRYRGHVMHSWAQNRRRTYREQAARAQQTRAREQEQRQ 375

Query: 343 RRL----WHNRRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEES 398
           R L    +HNR               SL  +++  A G       + + G     DEE  
Sbjct: 376 RELENQVFHNR--------------HSLTEFLIARAFG------PFHWGGQ--QADEEIE 413

Query: 399 TQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIV 458
           TQ+I+ MIQ REERE D+R K+YME T+ QQQ +++RA  +P+GYSASFDT PK+K+ + 
Sbjct: 414 TQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFDTAPKMKIAMT 473

Query: 459 RDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQ 518
           R+G+EE V V DD  + Q+++VP C LCG+ELGVGIPDEF GITK DRGVSFE LV KY 
Sbjct: 474 RNGREEEVTVTDDHAAKQYEDVPACCLCGIELGVGIPDEFSGITKEDRGVSFESLVAKYG 533

Query: 519 FHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSA 578
           FHCPYQ+LARPS  DRDLS+RT+VA CGHT+CGRCFAR+DNAR  SR +K+KLA L+G++
Sbjct: 534 FHCPYQSLARPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRASKKKLAGLQGAS 593

Query: 579 HPDNYGPKICPAKGCKSPIRTRGKMREAFF 608
           HPDNYGPK CPA+GC   +R++G+M+E FF
Sbjct: 594 HPDNYGPKTCPAEGCSMQLRSKGRMKEVFF 623

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score =  466 bits (1199), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 285/649 (43%), Positives = 394/649 (60%), Gaps = 48/649 (7%)

Query: 4   RGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFV 63
           R  E+    + +  +G  +  I+IE+D+EED+RIRD+ R  RL PD RI RPRD LNRFV
Sbjct: 3   RSEEASTYYRNMGSSGDQDSVILIETDEEEDERIRDENRYRRLVPDRRIGRPRDILNRFV 62

Query: 64  NSEG---TNVATTRSQDNGGSDDE---VAIVGEINNTRGNEEGPIGSDAEYVDLDAD--- 114
           ++      N  TT     G ++D+   V IVG I   R +  GPI   AEY+DLD +   
Sbjct: 63  STRDPGDDNETTTHVSQEGDNNDDDDDVEIVGAIEAPR-DPNGPIDPGAEYIDLDTEDQY 121

Query: 115 -------NGPQVIEVXXXXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPT 167
                  N P+++ +              GL I++ERTT P VTLNLPGGESLQI+AS +
Sbjct: 122 ASGHHGFNTPRIVVINGDSNNGNNEDD--GLEIIEERTTRPTVTLNLPGGESLQINASDS 179

Query: 168 DRPYRRSFEWQQQ-DRTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXX 226
           DRP  RSFEWQ      RR+ + RSA R   L  + S      +  G   N  LP ++  
Sbjct: 180 DRPAHRSFEWQDALPEPRRRLLRRSAGRIRSLFLNNSDDENNDTAAGRQNNRYLPSNIRR 239

Query: 227 XXXXXXXXXXXXNITRRR-DQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEF 285
                          RRR ++ R + + GNP    +R RI+++ PD+RSAF HAQ+++EF
Sbjct: 240 LRQEEQAQMRQLAQRRRRMNEQRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEF 299

Query: 286 RSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQES-----RRLNEENHE 340
           +SIL+++AP+TLQ+C  EL+ L+TEYRS ++QNWAT RVQ++   +     R    +   
Sbjct: 300 KSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSAAPATAGRARTDGRDRRR 359

Query: 341 RQRRLWHNRRHFRIHMGVGGGFGESLANYILMNANGMGS--------NDAAWLYNGYVGD 392
           R R     R  F +    GG    +LA   L N NG  +        +D    Y GY+ +
Sbjct: 360 RTRNQRLARLRFDMESNEGGLTANNLARIFLAN-NGFQNVFDGGDIRDDEDGDYYGYMNE 418

Query: 393 MD------------EEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELP 440
            D            E + TQ+I++MIQEREEREHDSRTK +M  T+ Q+++  ++A  LP
Sbjct: 419 YDDYMGEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLP 478

Query: 441 DGYSASFDTEPKIKLDIVRDGKEETVVVKDD-SVSDQWQEVPVCTLCGVELGVGIPDEFE 499
           DGYSA+FD+ PK  +  +++GKEE ++V DD +V +   EVP+CTLCG ELG+GIPD+F+
Sbjct: 479 DGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFK 538

Query: 500 GITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDN 559
           GI + DRG+SF+ LV KY+ +CPYQ+LA+PS++DR LS+RTFVA CGH YCGRC ARI N
Sbjct: 539 GIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISN 598

Query: 560 ARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF 608
           A+  SR  K++LA+L GS+HP+NYGPK CPA  CK  +R+RGK+ E +F
Sbjct: 599 AKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  452 bits (1163), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/585 (44%), Positives = 347/585 (59%), Gaps = 40/585 (6%)

Query: 25  IIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNGGSDDE 84
           I IESD EEDQRI +  R  RL PD R++RPRD  NRFV+  G   A       G  DDE
Sbjct: 12  IEIESDPEEDQRIINQYRQTRLVPDRRLNRPRDAANRFVSVSGRVAAAA-----GEGDDE 66

Query: 85  VAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVXXXXXXXXXXXXXXGLVIVQER 144
           V IV E+     ++EGPI S A++VDLD   GP    V               + I++ER
Sbjct: 67  VEIVNEVY---LDDEGPIDSTADFVDLDEQQGPSSSMVINHDGGGDDD-----VAIIEER 118

Query: 145 TTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQDRTRRQAMERSARRASRLLFHTSX 204
           TT P   LNLP G++L+I  S  DRP RRSFE Q   RT R  M R A R+++ LF  + 
Sbjct: 119 TTHPTFLLNLPNGQTLRISGSVHDRPLRRSFETQ---RTARANMLRRAARSAQRLF-MNE 174

Query: 205 XXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNITRRRDQMRSDAMQGNPVLMRLRER 264
                S     +   LP SV               + R+R+  R      +P       +
Sbjct: 175 NDGEPSEREASDREYLPQSVLRQRQQALMQE---RLQRQREHARQHEHIADP-------Q 224

Query: 265 IDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRV 324
           +D+  P++RS F HA++L+E R++L +    T      +L+ L+ ++RSR + NWA  R 
Sbjct: 225 VDALAPELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQINNWARQRA 284

Query: 325 QSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGGGFGESLANYILMNA-NGMGSNDAA 383
           Q  +  S R  E +H +       R     +  +      S  +Y+L  +  G G     
Sbjct: 285 QEFRHGSAR--EADHAQDDSASRARLR---NPALNAQRRNSFTSYVLARSLGGFG----V 335

Query: 384 WLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGY 443
           W  N + GD DE   TQ+I+ +IQ REER+ DSR +KYME T+ QQQ++V RA  LP+GY
Sbjct: 336 WP-NDFFGDDDE--VTQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARAQRLPEGY 392

Query: 444 SASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITK 503
            ASFD  PK+K+ + ++GK E VVV DD  +  + EVPVC LCGVELG+GIPD+F GI+ 
Sbjct: 393 YASFDPTPKMKMTLEKNGKTEEVVVADDLAAKSYVEVPVCCLCGVELGLGIPDDFAGISA 452

Query: 504 MDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGK 563
           +DRGVSFE LV KY FHCPYQ LA PS  DRDLSR+TFVA CGHT+CGRCFARI+NA+  
Sbjct: 453 VDRGVSFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCFARINNAKRF 512

Query: 564 SRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF 608
           S+++K++LA+L G +HPDNYGP++CPA+GC+  +RTRGKMRE FF
Sbjct: 513 SKISKKRLAELHGPSHPDNYGPRVCPAEGCRGQLRTRGKMREVFF 557

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  401 bits (1030), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/559 (41%), Positives = 325/559 (58%), Gaps = 52/559 (9%)

Query: 69  NVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQVIEVXXXXXX 128
           NV T  + D+   DDE+ +VGE   +      P   + EYVDLD        E       
Sbjct: 60  NVETLCNTDD--DDDELQVVGESILSERQTSYP---ETEYVDLDRSG-----EGSLGQRR 109

Query: 129 XXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQ-----QQDRT 183
                    LVI++ERT++P   LNLPGGE L+I+ SP D+P RRSF+ Q          
Sbjct: 110 PQAASSEEDLVILEERTSSPSFVLNLPGGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGA 169

Query: 184 RRQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNITRR 243
           RR+   R+AR AS L    S      S  G     +LP +V                  R
Sbjct: 170 RRRLARRTARTASNLFMQPSDDEQEESVEGNTY--QLPSTVMARRQRNALLMQRRPQPSR 227

Query: 244 RDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNE 303
           R  +R   M  +P L  L  +I+  PP+VRSAF HAQS++EFRSILQS+      +  ++
Sbjct: 228 RQPVRGFGMIQSPELSALEAQINRLPPNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDD 287

Query: 304 LVPLFTEYRSRMVQNWATNRVQSNQQESR---RLNEENHERQRRLW-----------HNR 349
           L  LF+EYR+ ++++ +  R++   + SR   R+  ++   Q   +            N 
Sbjct: 288 LTSLFSEYRANLLRSRSNQRIRRPGERSRLDSRMAGQDPSAQNLPYSPSLVGIMAQTFNP 347

Query: 350 RHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQER 409
              R+HMG        +  Y                     G++DEE+ TQ+I+ MIQER
Sbjct: 348 VLGRMHMGYDARTHGGIMGY---------------------GEVDEEQQTQNIIQMIQER 386

Query: 410 EEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVK 469
           EE+E+++R +KYME T+ +Q  Y+++A++LP+GYS+SFDT PK+ + I ++GKEE + V 
Sbjct: 387 EEQEYEARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSFDTTPKMNITIKKNGKEEELTVT 446

Query: 470 DDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARP 529
           DD  +  + ++P C+LCGVELGVGIPDEF+G++  DRGVSFE L  KY+FHCPYQ L++P
Sbjct: 447 DDQAAAFYMDLPSCSLCGVELGVGIPDEFQGLSTQDRGVSFEALKAKYEFHCPYQALSKP 506

Query: 530 SQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICP 589
           S +DRDLSRRT+VA CGH++CGRCFARIDNAR  +R +K+KL  LKG++HPDNYGPK CP
Sbjct: 507 SLVDRDLSRRTYVAACGHSFCGRCFARIDNARSFNRASKQKLKDLKGASHPDNYGPKKCP 566

Query: 590 AKGCKSPIRTRGKMREAFF 608
           AK C + +R RGKMRE +F
Sbjct: 567 AKDCNNQLRNRGKMREVYF 585

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  392 bits (1008), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 255/615 (41%), Positives = 349/615 (56%), Gaps = 56/615 (9%)

Query: 9   PEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPIRLH-PD-GRIHRPRDGLNRFVNSE 66
           PE SQ         D I IESD E++ ++     P  L  PD G++H             
Sbjct: 13  PECSQN--------DVIEIESDTEDETQVL----PGTLEAPDIGQMH------------- 47

Query: 67  GTNVATTRSQDNGG-------SDDEVAIVGEINNTRGNEEGPIGSDAEYVDLDADNGPQV 119
           G+ V    SQ+N          DDE+ ++GE      N   P   +         N  + 
Sbjct: 48  GSLVDDLPSQNNASEVFCNTEDDDEIQLLGETVLDGNNAAAPRLGNPNI------NRAES 101

Query: 120 IEVXXXXXXXXXXXXXXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQ 179
           + V               LVI++ER  +P   LNLPGGE LQI  SP D+P RRSF+ Q 
Sbjct: 102 VGVAQIRPHQPSAAGEEDLVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQG 161

Query: 180 QDRTR-----RQAMERSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXX 234
              T      R+ + R+ARRAS L  H S       G        LP  V          
Sbjct: 162 NRHTNSANGRRRLLRRTARRASSLFLHPSDEED--EGFAYENTDLLPTGVRLRRQRNSMM 219

Query: 235 XXXXNITRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAP 294
               N  RR+     D +  +P L+ L  +I+SFP +VRSAF HAQS++EFRSILQSV  
Sbjct: 220 QRRPNPPRRQLLGTGDDVD-DPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDR 278

Query: 295 LTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWHNRRHFRI 354
            + ++  +EL  LFT YR  ++++WA +R++  +  +  +N    +R  +  HN R+   
Sbjct: 279 QSYEQRQDELTHLFTVYRGHVMRSWANDRLRRARDAASGMNTRTTDRTSQ-AHNLRYSPT 337

Query: 355 HMGV-GGGFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREERE 413
             G+    F   L +  +    G+G+  AA+       D DEE  TQ+I+ MIQEREERE
Sbjct: 338 LAGIIARTFNPILGHMHMAYEPGLGTGMAAY------NDADEERQTQNIIQMIQEREERE 391

Query: 414 HDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDSV 473
            +SR +KYME T+ +Q  Y+Q+A +LPDGYSASFDT P++ + I+++G+ E + V DD  
Sbjct: 392 FESRKRKYMEDTKPKQSGYLQKAAKLPDGYSASFDTTPRMNISIMKNGQNEELTVVDDHA 451

Query: 474 SDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLD 533
              + ++P C LCGVELGVGIPD F+G+ + DRGVSFE L  KY FHCPYQTL++PS  D
Sbjct: 452 DALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVSFEALKAKYNFHCPYQTLSKPSVAD 511

Query: 534 RDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGC 593
           RDLSRRT+VA CGH++CGRCFARIDNAR  +R +K+KL++LKG+++PDNYGPK CPAK C
Sbjct: 512 RDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKKKLSELKGASNPDNYGPKNCPAKDC 571

Query: 594 KSPIRTRGKMREAFF 608
            + +R+RGKMRE +F
Sbjct: 572 NNRLRSRGKMREVYF 586

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  364 bits (934), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 239/614 (38%), Positives = 334/614 (54%), Gaps = 103/614 (16%)

Query: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNGGS 81
           +D I+IESD E+    RD           R    RD ++   NS G+N +   S+++  +
Sbjct: 19  DDVILIESDDEQHSS-RDSGL--------RSSTTRDTMS--PNSNGSNQSEVVSRESSRN 67

Query: 82  DDEVAIVGEINNTRGNEEGPIGSDAEYVDLD---ADNGPQV-IEVXXXXXXXXXXXXXXG 137
            D V+              P+GS AEY+DL+   A N  Q  + V               
Sbjct: 68  ADSVS--------------PMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPRDAEDDE 113

Query: 138 LVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQDR--------TRRQAME 189
           L+ VQE+T    + LNLPG   ++I A+  DRP RRSFE Q  +R         RRQ M 
Sbjct: 114 LIFVQEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQASNRQLRHQTRVARRQPMR 173

Query: 190 RSARRASRLLFHTSXXXXXXSGNGTVENGRLPPSVXXXXXXXXXXXXXXNITRRRDQMRS 249
           R+ARRA+    H+        G                            +T  R+Q+  
Sbjct: 174 RAARRAN----HSMNGYESDDGG---------------------------LTSNRNQINY 202

Query: 250 DAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFT 309
           D     P    ++ R+DS+P D+RSAF+HAQ++ EF SI+++V PLT Q+C  +L  LF 
Sbjct: 203 D-----PEFAAIQRRLDSYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFM 257

Query: 310 EYRSRMVQNWAT------------NRVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMG 357
           +YR  M +  A             NR Q N    RRL                   + +G
Sbjct: 258 DYRRMMARRAAQIGQNMPGYRSPPNRTQGNADLLRRLGP---------------LGVRIG 302

Query: 358 VGGGFGESLANYILM-NANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDS 416
           +G G GESL +YIL     G GS        G+   M+EE  TQSI++ IQEREE+E D+
Sbjct: 303 IGTGMGESLTHYILEPGIFGYGSFRMIGNPGGFDDGMEEEARTQSILNAIQEREEQERDA 362

Query: 417 RTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPK-IKLDIVRDGKEETVVVKDDSVSD 475
           +TK  MEKT+ Q+++++++   LP+GYSASFDT P  ++L+ + DG ++ +VV+D+S   
Sbjct: 363 QTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTTVRLEPLNDGNKQAIVVEDESAIA 422

Query: 476 QWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRD 535
           +W+E+ VC LCGVELGVG+PD+F GI+  DR +SF+ LV KY  HCPYQ+L   +  +R 
Sbjct: 423 EWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFDELVTKYCSHCPYQSLTSANGTERA 482

Query: 536 LSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKS 595
           LS +TFVA CGHT+CGRC  RI+NAR  S+ +K++L++ KG  HPDNYGP++CPA GCK 
Sbjct: 483 LSMKTFVASCGHTFCGRCVVRIENARTHSKSSKKELSKFKGPLHPDNYGPRLCPATGCKQ 542

Query: 596 PIRT-RGKMREAFF 608
            IR  R KMREAFF
Sbjct: 543 NIRLGRTKMREAFF 556

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  351 bits (901), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/526 (37%), Positives = 289/526 (54%), Gaps = 40/526 (7%)

Query: 100 GPIGSDAEYVDLDAD---------NGPQVIEVXXXXXXXXXXXXXXG---LVIVQERTTA 147
           GP+    EYVDLD +            + + V              G   LVIVQERT+A
Sbjct: 147 GPLNPSTEYVDLDNEAEYSSNNNYGHSRTLIVDGDNDNADVIDDGNGADDLVIVQERTSA 206

Query: 148 PRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-DRTRRQAMERSARRASRLLFHTSXXX 206
           P VTL LPG  S+QI+A+PTDRP R SF WQ     +RR  + R      +L F++    
Sbjct: 207 PTVTLTLPGNRSIQINAAPTDRPVRSSFGWQGGVPDSRRGMLARRYNSVRQLFFNSDEDA 266

Query: 207 XXXSGNGTVENGRLPPS----VXXXXXXXXXXXXXXNITRRRDQMRSDAMQGNPVLMRLR 262
                +    +    P+    +                 +++   +  +   +P++  LR
Sbjct: 267 SRNGSDSDSYDDDYTPARLQRIQNRERNAVRQRMMQQRRQQQILRQEQSRNESPIMAELR 326

Query: 263 ERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATN 322
            RI+++PPDVRS F HA +L EF +++QS AP+TL++   +L+ +FT YR  + QNW  N
Sbjct: 327 RRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRGNLTQNWMIN 386

Query: 323 RVQSNQQESRRLNEENHERQRRLWHNRRHFRIHMGVGGGFGESLANYILMNANGMGSNDA 382
           R+ S++  S R                R+   H     GF  S+         G+G +  
Sbjct: 387 RMNSSRDNSARTASSTP---------MRNMPAHTRFVQGFLHSIM--------GLGGD-- 427

Query: 383 AWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDG 442
            + Y G   + DEE +TQ+I+ MI+ERE  E DS+ K+ M+KT+ QQ+ +  +A  LP G
Sbjct: 428 -FPYGGT--ESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKAKYLPKG 484

Query: 443 YSASFDTEPKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGIT 502
           +SASF   PK  + I  D  +  +V  D+ ++++++E+PVC LCGVELGVGIPD F GIT
Sbjct: 485 FSASFSLVPKKIISIDGDDSKREIVT-DEFLAEEYEELPVCCLCGVELGVGIPDSFRGIT 543

Query: 503 KMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARG 562
             +  VSF+ LV KY   CPY  L+ P  +DRDLSRRT+VA CGH++CGRC  RI++A+ 
Sbjct: 544 PEESKVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVRRINHAKE 603

Query: 563 KSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF 608
             +++K+KL +L G  +PD YGPK CPA  C   +R +G+MRE +F
Sbjct: 604 SGKISKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 237/629 (37%), Positives = 341/629 (54%), Gaps = 74/629 (11%)

Query: 25  IIIESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFV-NSEGTNVA-TTRSQDNGGSD 82
           I I+SD E D +IR++  P RL PD R +RPRD L+RFV N+E  NVA    + D   S 
Sbjct: 8   IEIDSDPELDAQIREEYAPRRLIPDRRRNRPRDHLSRFVSNAEDRNVAPIAPATDLPVST 67

Query: 83  D--EVAIVGEINNTRGNEEGPIGSDAEYVDLD----ADNGPQVIEVXXXXXXXXXXXXXX 136
           D  ++ I  E++      +GPI  DAEY++LD    ++NG  V++               
Sbjct: 68  DGEDLEITAEVS---LRPDGPINDDAEYINLDNYRASNNGTVVVD---------HREGDD 115

Query: 137 GLVIVQERT--TAPRVTLNLPGGESLQIDASPTDRPYRRSFEWQQQDRTRRQAMERSARR 194
            L++V+ER   +   V L LP G++LQ+DAS  + P  RSF    Q++  R   +   RR
Sbjct: 116 DLMLVEERIQESGRPVLLQLPAGQTLQVDASWNELPVGRSF----QNQVYRNPNQ--LRR 169

Query: 195 ASRLLFHTSXXXX---XXSGNGTVENG-----RLPPSVXXXXXXXXXXXXXXNITRRRDQ 246
             R + H +         SG G  +        +PP +                  R++Q
Sbjct: 170 LRRHIDHATAMFMGGYNQSGTGDSDFSDNDADYIPPDIVNERNQYTMQTRMREQRERQNQ 229

Query: 247 MRSDAMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQ--SVAPLTLQECDNEL 304
           M+      +       E IDS  PD+RS F  +QSL +FR  L   +  P  L++    L
Sbjct: 230 MQRLQRAAD-------ETIDSLDPDLRSLFFESQSLSQFREGLARFNFPPARLEQ----L 278

Query: 305 VPLFTEYRSRMVQNWA----------TNRVQSNQQESRRLNEENHERQRR--LWHNRRHF 352
           +  + ++R+R +Q+WA           NR     Q +R   ++NH R        N  + 
Sbjct: 279 LGQYRDFRARAMQSWAEGRRTRSMSYQNRNSLRPQRTRSGTQQNHSRGSNGDSRDNALYQ 338

Query: 353 RIHMGV--------GGGFGESLANYILMNANGMGSNDAAWLYN-----GYVGDMDEEEST 399
           ++  G+        G  F  +  +   + +N M        +      G+  D D+  +T
Sbjct: 339 QMLFGMPDDDENMDGNNFTGTTQSLQRIISNTMNRRFGNLPFGVGPEFGFYEDGDDAANT 398

Query: 400 QSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVR 459
           + I+ MIQEREER+  +RTKK  E T+ QQQ Y+ +A  LP+GYSASF+T P + + +  
Sbjct: 399 ELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLMSMTMEN 458

Query: 460 DGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQF 519
           +G+EETV+V DD  +  + +VPVC LCGVELGVGIPD+++G+++ D+GVSFE L   Y+F
Sbjct: 459 EGREETVMVTDDVAAKTYIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEALQSHYKF 518

Query: 520 HCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAH 579
           HCPYQTLARP+ +DRDLSRRT+V+ CGHT+CGRC  RI NAR  S   K KL   +G +H
Sbjct: 519 HCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKNSQGPSH 578

Query: 580 PDNYGPKICPAKGCKSPIRTRGKMREAFF 608
           PDNYGPK CPA+GC S +R +G MRE +F
Sbjct: 579 PDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  304 bits (779), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 214/639 (33%), Positives = 308/639 (48%), Gaps = 122/639 (19%)

Query: 22  EDPIIIESDQEEDQRIRDDARPIRLHPDGRI----HRPRDGL-----------NRFVNSE 66
           ++ I+I+SD ++     D +    L  DGR     H   +G             R+    
Sbjct: 23  DEAILIDSDLDDHLDFSDGSDSDILQLDGRTQDIAHNSSNGEVVESVDISNRNERYDEHT 82

Query: 67  GTNVATTRSQDNGGSDDEVAIVGEINNT----RGNEEGPIGSDAEYVDLDADNGPQVIEV 122
            T V  + S ++  ++D++ IV EIN +    R NE     S  EYVDLD +  P+ +E 
Sbjct: 83  ETAVQISNSGNDSANNDDITIVREINRSPRRERRNE-----SVTEYVDLDHE--PEDVEP 135

Query: 123 ------------XXXXXXXXXXXXXXGLVIVQERTTAPR---VTLNLPGGESLQIDASPT 167
                                      L+I+ E+   P    + L +PG + +++  + T
Sbjct: 136 IGTSNLDGRSSGSNVNDRDRNNSNIDDLIIISEQHPQPSANSIFLTIPGRQLMELQVAST 195

Query: 168 DRPYRRSFEWQQ-----------QDRTRRQAMERSARRASRLLFHTSXXXXXXSGNGTVE 216
           D P R SFE+Q            + R  RQ M+ S  R  R L                 
Sbjct: 196 DIPTRSSFEYQNDRRPVRLGNSGRPRINRQYMQNSFSRVRRQLL---------------- 239

Query: 217 NGRLPPSVXXXXXXXXXXXXXXNITRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAF 276
                                  I R R        Q NP +  +   I  +  ++RSAF
Sbjct: 240 ----------------------GILRVR--------QSNPEIDEIAREISLYHTNIRSAF 269

Query: 277 VHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWA-----TNRVQSNQQES 331
           +HA S  EF +I++    L + +   +L     + R+R  Q  +      + + SN  E+
Sbjct: 270 IHANSFNEFMAIIEVAPRLGITDDLVDLYLRLEDLRNRTHQANSLFVPDIDNISSNS-ET 328

Query: 332 RRLNEENHERQRRLWHNRRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVG 391
            R +E         W+   H   +  +   F   +   I  N  G    D          
Sbjct: 329 TRYDEG--------WNPVTHPVTNRFIEDSFHSPMIRRIFGNYGGRHHQD--------YD 372

Query: 392 DMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEP 451
           D DEE  TQSI++MIQEREE E D RTKKY E T+++Q  + +RA ELPDGYS+SF+TEP
Sbjct: 373 DDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATELPDGYSSSFNTEP 432

Query: 452 KIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFE 511
           K K+D+ ++G   +V V DD++++ W+E+P+C LCGV L  GIPDEF+G++  DR + FE
Sbjct: 433 KAKVDMTKNGVNGSVSVVDDTMAEDWEEIPICCLCGVTLSEGIPDEFQGMSNEDRFLPFE 492

Query: 512 CLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKL 571
            L  KY   CPYQ L RPSQ DRD S+R +VA CGHTYCGRC+ RI N++ KS++ K +L
Sbjct: 493 ELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQNSKEKSKLPKSQL 552

Query: 572 AQLKGSAHPDNYGPKICPAKGCKSPIR-TRG-KMREAFF 608
           A+LKG+ HPDNYGPK CP   C   +R +RG   REA+F
Sbjct: 553 AKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  263 bits (671), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 218/361 (60%), Gaps = 19/361 (5%)

Query: 251 AMQGNPVLMRLRERIDSFPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFTE 310
           A+  +P   R+R RI+S+PP+++S F +AQSL EF  I+Q+  P+T  EC ++L  LF++
Sbjct: 203 ALDEDPQRRRIRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAECRDDLTNLFSQ 262

Query: 311 YRSRMVQNWATNRVQSNQQESRRLNEENHERQRRLWH-NRRHFRIHMGVGGGFGESLANY 369
           Y+S    +   N  Q   ++S   +  N+ ++  + H N R+F           E+ A  
Sbjct: 263 YQSMQHDDRMRNVGQQGSRQSEPRHGTNYSQRSAVSHSNNRYFYPEFNQYES-DEARAQS 321

Query: 370 ILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQ 429
           +L   +            GY  D DEE +TQ+I+SMIQERE+ E D+R K + +K++   
Sbjct: 322 LLPRIHDF----LQMRLMGYPND-DEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLL 376

Query: 430 QSYVQRAMELPDGYSASFD--TEPKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCG 487
           +S ++ A  LP  YSASF   + P  K  I      ET          + +EV  C LCG
Sbjct: 377 KSILKEAKSLPSNYSASFHYPSSPS-KPQIPGGSTSETA---------ESEEVSCCVLCG 426

Query: 488 VELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGH 547
            ELGVGIPD F G +  DR + F  L+ KY F CPYQ+L RP+QLDRDLS+RTF++ CGH
Sbjct: 427 SELGVGIPDSFIGRSAEDRDLDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGH 486

Query: 548 TYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAF 607
            YCGRCFARIDNA+ KS+++K++LA LKG ++P+ YGP+IC A GC + IR + ++RE +
Sbjct: 487 VYCGRCFARIDNAKAKSKISKKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELY 546

Query: 608 F 608
           F
Sbjct: 547 F 547

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  223 bits (569), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 116/259 (44%), Positives = 159/259 (61%), Gaps = 34/259 (13%)

Query: 377 MGSNDAAWLYNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRA 436
           + SND  +   G       E+ TQ +++MIQEREEREHD RT+K+ +K +  QQ   ++A
Sbjct: 413 VNSNDFGYAQAG-------EQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKA 465

Query: 437 MELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDDS---VSDQWQ--------EVPVCTL 485
             +P+GYS+SF TE  +KL   +D     V++ ++    V D++         EVPVC L
Sbjct: 466 KTIPEGYSSSFSTEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCL 525

Query: 486 CGVELGVGIPDEFEGITKMDRGV-SFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAP 544
           CGVELG+GIP+ F GI+  D+ +  F+ +  KY F CPYQT+ RP++LDRDLSRRTF++ 
Sbjct: 526 CGVELGIGIPETFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISN 585

Query: 545 CGHTYCGRCFARIDNARGKS-----RMAKRKLAQLK----------GSAHPDNYGPKICP 589
           CGH +CGRC+ RI  A+ ++     R    KL +L           GS +PDNYGPKICP
Sbjct: 586 CGHAFCGRCYNRIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICP 645

Query: 590 AKGCKSPIRTRGKMREAFF 608
              CK  IR R KMREA+F
Sbjct: 646 GSDCKYQIRARTKMREAYF 664

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 15/102 (14%)

Query: 84  EVAIVGE-INNTRGNEEG----PIGSDAEYVDLDADNGPQVIEVXXXXXXXXXXXXXXGL 138
           E+ I+ E +N    N +      + ++ E VDLD +  P++  V               L
Sbjct: 65  EIGIISERVNFDTANNDNMDDLSVINEREVVDLDRE--PEITSVANNTNDD-------DL 115

Query: 139 VIVQERTTA-PRVTLNLPGGESLQIDASPTDRPYRRSFEWQQ 179
           +IV E+    P + LNLPGG + ++  +  D P+R SFE  Q
Sbjct: 116 MIVGEQVIENPHILLNLPGGRTFELSTTTNDLPFRSSFEMLQ 157

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  213 bits (541), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 166/267 (62%), Gaps = 23/267 (8%)

Query: 353 RIHMGVG---GGFGESLAN-YILMNANGMGSNDAAWLYNGYVG------DMDEEESTQSI 402
           RI   +G   G  G  L N YI  N   +  + A++++N   G      + DEE  TQSI
Sbjct: 252 RISAALGQLAGLSGSDLVNGYI--NFPVLPQSMASYMHNHVYGTPITGSEDDEEAQTQSI 309

Query: 403 VSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGK 462
           + +IQ+REE E D R K+Y  K++ Q++ + + A +LP GYSASF T   I+        
Sbjct: 310 IDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASFATPEVIR-------- 361

Query: 463 EETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCP 522
                 +D+S +D  +++ VC LCGVELG+GIP+EF GI+K D  +SF  L+ KY   CP
Sbjct: 362 --ENDDEDNSNNDDDEDMIVCNLCGVELGIGIPEEFTGISKEDFALSFAELMDKYGSRCP 419

Query: 523 YQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLK-GSAHPD 581
           YQ+L +PS+LDRDLS+RT+V+ CGH +CGRC+ R  NAR   +    K   +K G++HPD
Sbjct: 420 YQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTKAGKSLNVKLGASHPD 479

Query: 582 NYGPKICPAKGCKSPIRTRGKMREAFF 608
           N+ PK+CPA  CK  IR++GKMRE +F
Sbjct: 480 NFAPKVCPADNCKYQIRSKGKMREVYF 506

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 17/162 (10%)

Query: 21  DEDPIII-ESDQEEDQRIRDDARPIRLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNG 79
           +EDP+I+ +SD EE         P     +G    P   ++   NS      T+ + D G
Sbjct: 6   EEDPVIVLDSDNEE---------PANSEHEGVRPLPAIVVDEEDNSGAPVEVTSVNADEG 56

Query: 80  GSDDEVAIVGEINNTRGNEEGPIGSDAEYVDLD-----ADNGPQVIEVXXXXXXXXXXXX 134
           G DDE+ ++ + N      +  I +   Y++LD      D    +  +            
Sbjct: 57  GDDDELTLLRQSNIRVPRRQ--ISTPVAYINLDDEAAHHDASDDIEFLGGNLVPNAGDND 114

Query: 135 XXGLVIVQERTTAPRVTLNLPGGESLQIDASPTDRPYRRSFE 176
              + +++ER     V LNLPGG  + ++A+  + P R SFE
Sbjct: 115 EDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFE 156

>Kpol_1045.24 s1045 (56271..56831) [561 bp, 186 aa] {ON}
           (56273..56833) [561 nt, 187 aa]
          Length = 186

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 540 TFVAPCGHTYCGRCFARIDNARGKSRMAKRK 570
             +APCGH YC RC   + N+   SR+ K++
Sbjct: 130 AMIAPCGHIYCNRCLFPMVNS---SRVGKKQ 157

>Ecym_6331 Chr6 complement(634459..636111) [1653 bp, 550 aa] {ON}
           similar to Ashbya gossypii AFR104W
          Length = 550

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 30/92 (32%), Gaps = 25/92 (27%)

Query: 537 SRRTFVAPCGHTYCGRCFAR-------------------------IDNARGKSRMAKRKL 571
           + +TF   CGH YC  C+                           ID   G+    K  L
Sbjct: 186 TMKTFSLECGHEYCLTCYQHYISDKLNVGNIIKCMNCELALKNDDIDIIMGEGSSTKLML 245

Query: 572 AQLKGSAHPDNYGPKICPAKGCKSPIRTRGKM 603
           + +KG     +   K CP   CK  I  +  M
Sbjct: 246 SSIKGFIQKHSQYYKWCPFTDCKYVIHVKNTM 277

>Kwal_27.10723 s27 (468604..469293) [690 bp, 229 aa] {ON} YER116C
           (SLX8) -  [contig 33] FULL
          Length = 229

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 540 TFVAPCGHTYCGRC-FARIDNARGKSRMAKRKLAQ 573
             V PCGH +C  C F  ++++RG+SR     L +
Sbjct: 174 ALVTPCGHVFCTECLFQMVNSSRGQSRAGHCALCR 208

>Suva_11.249 Chr11 complement(455625..457280) [1656 bp, 551 aa] {ON}
           YKR017C (REAL)
          Length = 551

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 27/86 (31%), Gaps = 25/86 (29%)

Query: 540 TFVAPCGHTYCGRCF-------------------------ARIDNARGKSRMAKRKLAQL 574
           TF   CGH YC  C+                           ID   G +  +K   + +
Sbjct: 190 TFALECGHEYCINCYRHYIQDKLHEGNIITCMDCSLALKNVDIDKVMGHASSSKLMDSSI 249

Query: 575 KGSAHPDNYGPKICPAKGCKSPIRTR 600
           K      N   K CP   CKS I  R
Sbjct: 250 KSFVQKHNRNYKWCPFADCKSIIHLR 275

>KLTH0G15532g Chr7 (1358507..1359757) [1251 bp, 416 aa] {ON}
           conserved hypothetical protein
          Length = 416

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 358 VGG----GFGESLANYILMNANGMGSNDAAWLYNGYVGDMDEEESTQSIVSMIQERE 410
           VGG    GF   ++     NA G   ND  W   G+ GD  +EES++S+ S+   RE
Sbjct: 176 VGGFGKHGFAGEISGDEYHNAVG---NDTEWASRGHGGDDGDEESSESLFSIAHLRE 229

>YKR017C Chr11 complement(471694..473349) [1656 bp, 551 aa] {ON}
           HEL1Putative protein of unknown function; contains a
           RING finger motif
          Length = 551

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 26/86 (30%), Gaps = 25/86 (29%)

Query: 540 TFVAPCGHTYCGRCFAR-------------------------IDNARGKSRMAKRKLAQL 574
           TF   CGH YC  C+                           ID   G    +K   + +
Sbjct: 190 TFALECGHEYCINCYRHYIKDKLHEGNIITCMDCSLALKNEDIDKVMGHPSSSKLMDSSI 249

Query: 575 KGSAHPDNYGPKICPAKGCKSPIRTR 600
           K      N   K CP   CKS +  R
Sbjct: 250 KSFVQKHNRNYKWCPFADCKSIVHLR 275

>TBLA0B04595 Chr2 (1066340..1067950) [1611 bp, 536 aa] {ON}
          Length = 536

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 19/86 (22%)

Query: 386 YNGYVGDMDEEESTQSIVSMIQEREEREHDSRTKKYME-KTQDQQQSYVQRAME-----L 439
           Y  Y+ D +E+E  Q+I   IQ+  ER  D+   + +E + Q + +  +QR ME      
Sbjct: 171 YQQYLKDEEEKEKQQAIEKYIQDEVERRLDAEFNRRVETEVQLRVEVAIQRKMEEIMGMT 230

Query: 440 PD-------------GYSASFDTEPK 452
           PD              Y A F+TEPK
Sbjct: 231 PDRHYPLDEKKAYATDYKAPFETEPK 256

>Ecym_7137 Chr7 (277509..278300) [792 bp, 263 aa] {ON} similar to
           Ashbya gossypii AGL289C
          Length = 263

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 16/91 (17%)

Query: 492 VGIPDEFEG--ITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTY 549
           V IPDE E   I+   +G S    +    + CP         +  D      + PCGH Y
Sbjct: 166 VKIPDEQEQDLISGNQKGSSPVEHMKASDYRCP---------ICFDPPEAALMTPCGHVY 216

Query: 550 CGRC-FARIDNARGKSRMAK----RKLAQLK 575
           C  C F  ++++RG  R  +    RK  +LK
Sbjct: 217 CTVCLFQMVNSSRGYRRNGQCALCRKDVKLK 247

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,654,592
Number of extensions: 2658344
Number of successful extensions: 11006
Number of sequences better than 10.0: 57
Number of HSP's gapped: 11291
Number of HSP's successfully gapped: 63
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)