Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A04972g3.187ON122321583e-14
KAFR0C008803.187ON12122860.001
CAGL0I04510g3.187ON11626820.004
Skud_4.2413.187ON10624750.031
YDL012C3.187ON10724750.037
Suva_4.2373.187ON10324710.14
SAKL0C08008g3.187ON14530700.26
TDEL0D043403.187ON12032650.92
Ecym_52633.187ON12425596.5
KLTH0E15840g3.187ON11325588.3
NOTE: 14 genes in the same pillar as ZYRO0A04972g were not hit in these BLAST results
LIST: Kpol_1036.51 CAGL0K01903g Smik_4.222 NCAS0I01900 TBLA0B01680 TBLA0F00730 YBR016W KNAG0K01285 Kwal_YGOB_Anc_3.187 AER212W Smik_2.135 Suva_2.144 Klac_YGOB_Anc_3.187 Skud_2.128

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A04972g
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    65   3e-14
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    38   0.001
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    36   0.004
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    33   0.031
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    33   0.037
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    32   0.14 
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    32   0.26 
TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa...    30   0.92 
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    27   6.5  
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    27   8.3  

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122
          aa] {ON} weakly similar to uniprot|P38216 Saccharomyces
          cerevisiae YBR016W
          Length = 122

 Score = 65.5 bits (158), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%)

Query: 1  MSAQEYYGDSKASYSRPQGPPPSSDYYGGASR 32
          MSAQEYYGDSKASYSRPQGPPPSSDYYGGASR
Sbjct: 1  MSAQEYYGDSKASYSRPQGPPPSSDYYGGASR 32

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
          {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 1  MSAQEYYGDSKASYSRPQGPPP 22
          MSA+EYYGD+K  Y+RP  PPP
Sbjct: 1  MSAREYYGDTKTQYNRPSAPPP 22

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
          bp, 116 aa] {ON} similar to uniprot|P38216
          Saccharomyces cerevisiae YBR016w and similar to
          uniprot|Q12489 Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 19/26 (73%), Gaps = 3/26 (11%)

Query: 1  MSAQEYY---GDSKASYSRPQGPPPS 23
          MSAQEYY   GDSK  YSRP  PPPS
Sbjct: 1  MSAQEYYNGAGDSKQQYSRPTAPPPS 26

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321
          bp, 106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 33.5 bits (75), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 2/24 (8%)

Query: 1  MSAQEYYGD--SKASYSRPQGPPP 22
          MSAQ+YYG+  SK SYSRP  PPP
Sbjct: 1  MSAQDYYGNSTSKQSYSRPTAPPP 24

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp,
          107 aa] {ON} Tail-anchored plasma membrane protein
          containing a conserved CYSTM module, possibly involved
          in response to stress; may contribute to non-homologous
          end-joining (NHEJ) based on ydl012c htz1 double null
          phenotype
          Length = 107

 Score = 33.5 bits (75), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 2/24 (8%)

Query: 1  MSAQEYYGDS--KASYSRPQGPPP 22
          MSAQ+YYG+S  K SYSRP  PPP
Sbjct: 1  MSAQDYYGNSASKQSYSRPSAPPP 24

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312
          bp, 103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 32.0 bits (71), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 2/24 (8%)

Query: 1  MSAQEYYGDS--KASYSRPQGPPP 22
          MSAQ+YYG+S  K SYS P  PPP
Sbjct: 1  MSAQDYYGNSAYKQSYSHPTAPPP 24

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
          bp, 145 aa] {ON} similar to uniprot|Q12489
          Saccharomyces cerevisiae YDL012C Plasma membrane
          protein of unknown function
          Length = 145

 Score = 31.6 bits (70), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 4/30 (13%)

Query: 1  MSAQEYY----GDSKASYSRPQGPPPSSDY 26
          MSA +YY     DSK +Y RP G PPS D+
Sbjct: 29 MSAADYYSGAAADSKQTYQRPTGAPPSGDF 58

>TDEL0D04340 Chr4 (792565..792609,792675..792992) [363 bp, 120 aa]
          {ON} Anc_3.187 YDL012C
          Length = 120

 Score = 29.6 bits (65), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 1  MSAQEYYG--DSKASYSRPQGPPPSSDYYGGA 30
          MSA+EYY   ++K +Y+RP  PPP      GA
Sbjct: 1  MSAKEYYSQSETKETYNRPNIPPPGHGKTAGA 32

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
          124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 27.3 bits (59), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 2/25 (8%)

Query: 1  MSAQEYYG--DSKASYSRPQGPPPS 23
          MSA +YYG  D+K S++RP  PPP+
Sbjct: 1  MSAADYYGTGDNKQSFNRPSAPPPN 25

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp,
          113 aa] {ON} similar to uniprot|Q12489 Saccharomyces
          cerevisiae YDL012C Plasma membrane protein of unknown
          function
          Length = 113

 Score = 26.9 bits (58), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 3/25 (12%)

Query: 1  MSAQEYY---GDSKASYSRPQGPPP 22
          MSA EYY    +SK  Y+ P GPPP
Sbjct: 1  MSAAEYYKGTSESKQQYTSPAGPPP 25

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.130    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,023,718
Number of extensions: 78572
Number of successful extensions: 233
Number of sequences better than 10.0: 18
Number of HSP's gapped: 230
Number of HSP's successfully gapped: 19
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)