Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A02024g2.293ON48648624960.0
TDEL0G022302.293ON48848218430.0
Smik_9.892.293ON49148116720.0
Skud_9.832.293ON49148116600.0
YIL090W (ICE2)2.293ON49148116560.0
Suva_9.1092.293ON49148016550.0
NCAS0B062202.293ON48648016300.0
NDAI0B035202.293ON50148816160.0
CAGL0D04202g2.293ON49949615540.0
SAKL0E07524g2.293ON47948515090.0
KAFR0J013302.293ON49148615040.0
KNAG0A053902.293ON49748314970.0
Kpol_1003.422.293ON49048814540.0
KLTH0G10516g2.293ON47448213700.0
Kwal_27.115002.293ON47548613520.0
Ecym_33322.293ON51351412111e-162
TBLA0B069902.293ON53652811841e-158
ADL208W2.293ON50250811801e-158
TPHA0C034402.293ON57953911721e-155
KLLA0E08207g2.293ON48648711501e-153
TBLA0B059802.293ON49349111101e-147
Smik_14.1182.33ON20161731.3
TPHA0N008305.227ON55881713.6
ZYRO0A13750gsingletonON52365705.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A02024g
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   966   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   714   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   648   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   644   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   642   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   642   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   632   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   627   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   603   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   585   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   583   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   581   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   564   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   532   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   525   0.0  
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   471   e-162
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            460   e-158
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   459   e-158
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   456   e-155
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   447   e-153
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   432   e-147
Smik_14.118 Chr14 (224960..225565) [606 bp, 201 aa] {ON} YNL214W...    33   1.3  
TPHA0N00830 Chr14 (185748..187424) [1677 bp, 558 aa] {ON} Anc_5....    32   3.6  
ZYRO0A13750g Chr1 (1095532..1097103) [1572 bp, 523 aa] {ON} simi...    32   5.3  

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/486 (98%), Positives = 479/486 (98%)

Query: 1   MSFVVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGY 60
           MSFVVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGY
Sbjct: 1   MSFVVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGY 60

Query: 61  ASRFYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFS 120
           ASRFYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFS
Sbjct: 61  ASRFYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFS 120

Query: 121 AHSNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNI 180
           AHSNWIL       IVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNI
Sbjct: 121 AHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNI 180

Query: 181 WNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGS 240
           WNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGS
Sbjct: 181 WNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGS 240

Query: 241 VIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVL 300
           VIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVL
Sbjct: 241 VIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVL 300

Query: 301 DSAEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQ 360
           DSAEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQ
Sbjct: 301 DSAEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQ 360

Query: 361 VTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCI 420
           VTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCI
Sbjct: 361 VTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCI 420

Query: 421 LIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSE 480
           LIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSE
Sbjct: 421 LIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSE 480

Query: 481 LIGGKK 486
           LIGGKK
Sbjct: 481 LIGGKK 486

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/482 (72%), Positives = 406/482 (84%), Gaps = 2/482 (0%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           +Q  R+ LA FYLLS L+TIPISFKVGGLYCGLSFTVTLFNLY ++TTLS+  + Y ++ 
Sbjct: 9   LQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQSYGNKC 68

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+  T  IYY QH +IASLLYLFLSGFSNEELTK+LE GSQPEQSL+ VL++N FS HS+
Sbjct: 69  YIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVFSNHSS 128

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           W+L       +VQPWQ +L+HSTAFF+LSEGFFT+L IQA+GE++RWLL E+NSN W I 
Sbjct: 129 WMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTWIIA 188

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W LS+QTASLLGFTLS+VCG+GL+GIVSKNGSVIES
Sbjct: 189 SLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSVIES 248

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEILE+ K AWQKHQ+N S+TNNLLSYY DVVL +AE
Sbjct: 249 SLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLKNAE 308

Query: 305 MMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTLK 364
           M+WESIV +T   SD    T++  PL K    F P+  FFK F +SVPSSI G+FQVTLK
Sbjct: 309 MVWESIVLRT-KNSDATTFTAI-QPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTLK 366

Query: 365 MASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAM 424
           +AS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K  R+L KSRRIMNVLYWYSPCILIAM
Sbjct: 367 LASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIAM 426

Query: 425 YTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIGG 484
           YTHLILQYSGELN DLCLWGC+  WF   Q KI +++W FWNWCNIFWT+L+YGSELIGG
Sbjct: 427 YTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIGG 486

Query: 485 KK 486
           K+
Sbjct: 487 KR 488

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/481 (67%), Positives = 383/481 (79%), Gaps = 3/481 (0%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           +QS R+  ACFYLL  L++IPISFKVGGL CGLSFTVTLF LYF++TTL++  R Y  + 
Sbjct: 9   MQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRYGGKL 68

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+F T+ +YYSQH IIASLLYLFLSGFSN+EL  +L+      +S LE LK++  S   N
Sbjct: 69  YIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKNSLNSNQIN 128

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           ++L       +VQPWQ+IL+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 129 YVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS+ GSVIES
Sbjct: 189 SLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIES 248

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEIL++FK+ WQKHQRN  + +NLL Y+H+V+L +AE
Sbjct: 249 SLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAE 308

Query: 305 MMWESIVSKTVTTSDPFYHTSMFPPL--RKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362
           M+W S + +    +  F H  +   L   K + I KP   FFKNFT SVP SI    QVT
Sbjct: 309 MLWGSFIPRGRKKTGDF-HDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQVT 367

Query: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422
           +KMAS+SVSPAIVVNL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILI
Sbjct: 368 IKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILI 427

Query: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELI 482
           AMYTHLILQYSGEL +DLC+WGC+  WF  +Q +I+VDSWGFWNWCNIF TILVY +ELI
Sbjct: 428 AMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTILVYATELI 487

Query: 483 G 483
           G
Sbjct: 488 G 488

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 382/481 (79%), Gaps = 3/481 (0%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           +QS RV  ACFYLL  L++IPISFKVGGL CGLSFTVTLF LYF++TTL++  + +  + 
Sbjct: 9   MQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKRHGGKL 68

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+F T  +YYSQH +IASLLYLFLSGFSN+EL  +L++ S   +S L+ LK +  S   N
Sbjct: 69  YIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLNSNQIN 128

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           ++L       +VQPWQ++L+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 129 YVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS+ GSVIES
Sbjct: 189 SLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIES 248

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEIL++FK+ WQKHQRN  + +NLL Y+H+VVL +AE
Sbjct: 249 SLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLKNAE 308

Query: 305 MMWESIVSKTVTTSDPFYHTSMFPPL--RKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362
           M+W S + +    +  F H  +   L   K + I +P   FFKNFT SVP SI    QVT
Sbjct: 309 MLWGSFIPRGRKKTGDF-HDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQVT 367

Query: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422
           +KMAS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILI
Sbjct: 368 IKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCILI 427

Query: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELI 482
           AMYTHLILQYSGEL +DLC+WGC+  WF   Q +I+VDSWGFWNWCNIF TILVY +ELI
Sbjct: 428 AMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYATELI 487

Query: 483 G 483
           G
Sbjct: 488 G 488

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 382/481 (79%), Gaps = 3/481 (0%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           +QS R+  ACFYLL  L++IPISFKVGGL CGLSFTVTLF LYF++TTL++  R +  R 
Sbjct: 9   MQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRHGGRL 68

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+F T  +YYSQH IIASLLYLFLSGFSN+EL  +L++     +S LE LK++  S   N
Sbjct: 69  YIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSLNSNQIN 128

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           ++L       +VQPWQ++L+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 129 YVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLG  LS+VCGLGLYGIVS+ GSVIES
Sbjct: 189 SLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKGSVIES 248

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEIL +FK+ WQKHQRN  + +NLL Y+H+V+L +AE
Sbjct: 249 SLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVILKNAE 308

Query: 305 MMWESIVSKTVTTSDPFYHTSMFPPL--RKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362
           ++W S + +    +  F H  +   L   K + I KP   FFKNFT SVP SI    QVT
Sbjct: 309 VLWGSFIPRGRKKTGDF-HDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQVT 367

Query: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422
           +KMAS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILI
Sbjct: 368 IKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILI 427

Query: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELI 482
           AMYTHLILQYSGEL +DLC+WGC+  WF ++Q +I+VDSWGFWNWCNIF TILVY +ELI
Sbjct: 428 AMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTILVYATELI 487

Query: 483 G 483
           G
Sbjct: 488 G 488

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/480 (66%), Positives = 382/480 (79%), Gaps = 1/480 (0%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           +QS R+  ACFYLL  L++IPISFKVGGL CGLSFTVTLF LYF++TTL++  R    R 
Sbjct: 9   MQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRNGGRL 68

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+F T+ +YYSQH +IASLL+LFLSGFSN+EL  +L++ S   +S LE LK++  S   N
Sbjct: 69  YIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKNSLNSNQIN 128

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           ++L       +VQPWQ+IL+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 129 YVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS+ GSVIES
Sbjct: 189 SLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSVIES 248

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEIL++FK+ WQKHQRN  + +NLL Y+H+V+L +AE
Sbjct: 249 SLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAE 308

Query: 305 MMWES-IVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363
           ++W S I  +  TTSD            K + I KP   F KNFT SVP SI    QVT+
Sbjct: 309 VLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQVTI 368

Query: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423
           KMAS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILIA
Sbjct: 369 KMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIA 428

Query: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483
           MYTHLILQYSGEL +DLC+WGC+  WF  +Q +I+VDSWGFWNWCNIF TILVY +EL+G
Sbjct: 429 MYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTILVYATELVG 488

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/480 (66%), Positives = 383/480 (79%), Gaps = 8/480 (1%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           ++ +R+  A FYLL  LI+IPISFK+GGL+CGL+FTV+LF LYF+STTLS++ R Y SR 
Sbjct: 7   IRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRI 66

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSN-PFSAHS 123
           ++  T  +YY QH IIASLLYLFLSGFSNE+L+ +L  G++P  S+ ++ K N   S  +
Sbjct: 67  HILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVASSTQA 126

Query: 124 NWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183
           NW+L        VQPWQ+ILS+ST FF+LSEGFFTILAIQA+GE+++WL+YEINSN W I
Sbjct: 127 NWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSNTWVI 186

Query: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243
           +SLL SGGVITA+LYYLYRIYVTP+W+LS+QTASLLGFTLSLV GLG+YGIV+  GSVIE
Sbjct: 187 SSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKGSVIE 246

Query: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303
           SS+FFAYIVRCIYEISPKLATTAT+EILE+FKE WQ+HQ N +S NNLLSYYH+VVL + 
Sbjct: 247 SSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVVLKNI 306

Query: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363
           E +WES        +D  + TS F   R  T IF P+    K FTI+VPSSI  L  VT 
Sbjct: 307 ETIWESF-----KINDNSFITS-FSTERVIT-IFMPIWKLLKTFTITVPSSINELCFVTY 359

Query: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423
           KMA +S+SPA++VNL FRVLIFYSAT+IIPALQ + D +L KSRRIM VLYWYSPCILIA
Sbjct: 360 KMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIA 419

Query: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483
           MY HLILQYSGEL  +LCLWGCNS  F  +Q KI+VDSWGFWNWCNIF+TILVY SELIG
Sbjct: 420 MYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVYASELIG 479

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/488 (64%), Positives = 378/488 (77%), Gaps = 10/488 (2%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           ++ VR   A FYLL  LI+IPISFK+GGL CGL+FT TLF +YF+STTLSL  R Y S F
Sbjct: 7   MRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYGSNF 66

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
            +F T  +YYSQH IIASLLYLFLSGFS+E+LT  L   +Q    + +V++ N  S +SN
Sbjct: 67  SIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLSSTNSN 126

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           W L        VQPW+++LS+ST FF+LSEGFFTILAIQAVGE+++WL+ EINSN W I+
Sbjct: 127 WNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSNTWIIS 186

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL SGGVITA+LYYLYRIYVTP+W+LSIQTASLLGFTLSLV GLGLYGIV++ GSVIES
Sbjct: 187 SLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKGSVIES 246

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDEILEIFKE WQ+HQ N  +T+NLL YY++ VL   +
Sbjct: 247 SLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLRHID 306

Query: 305 MMWESIVSKTVTTSDP---------FYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSI 355
           M+WE +VSK +  +DP             + F        I KP+   FKNFT+SVPSSI
Sbjct: 307 MLWELLVSK-INQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSVPSSI 365

Query: 356 EGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYW 415
             L  VT +MA +SVSPA+V+NL FRVLIFYSAT+IIPALQ + D +L KSRRIM +LYW
Sbjct: 366 SELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMKILYW 425

Query: 416 YSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTIL 475
           YSPC+LIAMYTHLILQYSGEL +DLCLWGCN  W   NQ +++VDSWGFWNWCNIF+TI+
Sbjct: 426 YSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIFFTII 485

Query: 476 VYGSELIG 483
           +Y SEL G
Sbjct: 486 IYASELFG 493

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 382/496 (77%), Gaps = 24/496 (4%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           V +S+R+  A  YL+  L++IPISFK+GGL CGLSFTVTLFNLY +STTLS+  R   +R
Sbjct: 8   VQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLARRSCNR 67

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILES-GS----QPEQSLLEVLKSNP 118
            YVF+T+ +YYSQH +IA LL+LFLSGFSNEE  + L   GS     P+ S L++LK   
Sbjct: 68  GYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDLLKHRI 127

Query: 119 FSAHS-----NWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLL 173
             A +     NW L       IVQPWQW+LS+ST FF+L EGFFTILAIQA+GE+++WL 
Sbjct: 128 LMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGETNKWLS 187

Query: 174 YEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYG 233
           YE+NSN W ITSLL+SGGVIT +LYYLYRIYVTP+W+L+IQ+ASLLGF LS+V  LGLYG
Sbjct: 188 YEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFCLGLYG 247

Query: 234 IVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLS 293
           I+S+ GSVIESSLFFAYIVRCIYEISPKLAT AT+EIL++ K+ WQ HQRN  + +NLL+
Sbjct: 248 IISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNRDNLLA 307

Query: 294 YYHDVVLDSAEMMWESIV---SKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTIS 350
           YYH+VVL +AEM+WES +   S+++   +          +R + D+  PV  FFKNFT+S
Sbjct: 308 YYHNVVLKNAEMVWESFILPRSRSLNAME---------KIRFWLDV-TPVWKFFKNFTVS 357

Query: 351 VPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIM 410
           VPSSI  L  VT KMAS+S+SPA++VNL FR+LIFYSAT+IIPALQ    ++  +SRRI+
Sbjct: 358 VPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRIL 417

Query: 411 NVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWF-SLNQTKIVVDSWGFWNWCN 469
            +LYWYSPC+LIAMYTHLILQYSGEL R+LCLWGC S WF S +Q +IV DSW FWNWCN
Sbjct: 418 KLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCN 477

Query: 470 IFWTILVYGSELIGGK 485
           IFWT+LVY +ELIG +
Sbjct: 478 IFWTVLVYANELIGTQ 493

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/485 (62%), Positives = 371/485 (76%), Gaps = 16/485 (3%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           ++QS+R  L  FYLL +LITIPISF+VGGLYCGLSFTVTLFNLYF++TTL +  + Y +R
Sbjct: 6   LIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKKY-NR 64

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQ-PEQSLLEVLKSNPFSAH 122
            Y   T+ +YY QH II SLL+LFLSGF+N+EL + ++     P +SL+  L++   S  
Sbjct: 65  LYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNK--SGK 122

Query: 123 SNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWN 182
            +WI         V+PWQ++L HST +F+L EGFFT+L IQA+GE+++WL Y  NSN W 
Sbjct: 123 HSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNTWI 182

Query: 183 ITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVI 242
           I SLLISGGVIT +LYYLYRIYVTPVWELSIQTASLLGFTLS+VCGLGLYGIVS  GSVI
Sbjct: 183 IVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGSVI 242

Query: 243 ESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDS 302
           ESSLFFAYIVRCIYEISP+LAT+A DEI +I K+ WQKHQ N   T+NLLSYY +VVL +
Sbjct: 243 ESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNL-PTDNLLSYYRNVVLKN 301

Query: 303 AEMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362
            EM+W++IV KT TTS     T+    LR      +P+  F KNFTISVPSSI  +F+VT
Sbjct: 302 GEMIWDAIVQKTGTTSP---STTQMVWLR-----LQPLWKFTKNFTISVPSSIREIFRVT 353

Query: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422
           LKMA++SV+P +V+NL FR+L+FYSAT+IIPALQ         SRR+M ++YWYSPCI+I
Sbjct: 354 LKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVI 413

Query: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQ--TKIVVDSWGFWNWCNIFWTILVYGSE 480
           AMYTHLILQYSGELN DLCLWGC   W   N   +K+VVD+WGFWNWCN+F T+ +YG E
Sbjct: 414 AMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLE 472

Query: 481 LIGGK 485
           LIGGK
Sbjct: 473 LIGGK 477

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 371/486 (76%), Gaps = 13/486 (2%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           +++ +R+    FYLL  LI+IP+SFK+GG++CGLSFTVTLF  YF+STTLS+  R   SR
Sbjct: 8   IIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILARQSGSR 67

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNP--FSA 121
           FY+  T+ IYY QH IIASLLY FLSGFSN+EL ++L+ G++     +EVL +N     +
Sbjct: 68  FYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEK----IEVLVANQDLMVS 123

Query: 122 HSNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIW 181
            SNW+L       +V+PW+++LS+ST FF+L+EGFFTILAIQA+GE++RWL  E NSN W
Sbjct: 124 ESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNSW 183

Query: 182 NITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSV 241
            I+SLL S GV+TA+LYYLYRIYVTP+WELS QTA+LLG  LSL  GLG++GI+S+ GSV
Sbjct: 184 IISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGSV 243

Query: 242 IESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLD 301
           +ESSLFFAYIVRCIYEISPKLATTATDEILE+FKE WQ+HQ     T+N+L+YY  V+L 
Sbjct: 244 VESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVILK 303

Query: 302 SAEMMWESIVSKTVTTSDPFYHT-SMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQ 360
           + EM+WE+ +SKT   S+   HT + F     F   F P+  FFKNFTISVP SI  L  
Sbjct: 304 NTEMIWEAFLSKTKQHSN---HTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360

Query: 361 VTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCI 420
           + L+MAS+S+SPA+VVNL FRVLIFYSAT+IIP+LQ K  R   KSRRIM VLYWYSPCI
Sbjct: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420

Query: 421 LIAMYTHLILQYSGELNRDLCLWGCNSMWFSL---NQTKIVVDSWGFWNWCNIFWTILVY 477
           LIAMYTHLILQYSGEL R+L LWG +S    L    +  IVVDSW FWNWCNIFWTIL+Y
Sbjct: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480

Query: 478 GSELIG 483
           G EL G
Sbjct: 481 GGELFG 486

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/483 (59%), Positives = 367/483 (75%), Gaps = 5/483 (1%)

Query: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           ++  R+     YLL  LI+IPISFKVGGLYCGL+FT TLF LYF+STTLS+  R   +R 
Sbjct: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69

Query: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124
           Y+  ++ +YY QH IIASLL+LFLSGFSN EL KI+E+ + P +SL  +L  +  S+ +N
Sbjct: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
           WI        +V PW+++LSHST FF+LSEGFFTILAIQA+GE+++WL YE NSN W I+
Sbjct: 130 WIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SLL S  VI+AALYYLYRIYVTP+WEL++QTASLLGF LSLV GLG+YGIVS +GSVIES
Sbjct: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIES 249

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIVRCIYEISPKLATTATDE+LE+FK+ WQK Q N    NNL+ YY++V+L + E
Sbjct: 250 SLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309

Query: 305 MMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTLK 364
           M W++ + +T T+    Y+ S+   L       KP+  FFKNFT+SVP SI  +  +T K
Sbjct: 310 MAWDNFILRTGTSGTFNYNPSLL--LNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWK 367

Query: 365 MASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAM 424
           M+ +SVSPA+V+NL FR+LIFYSAT+I+P+LQ K  R+  +SR++M ++YWYSPCILIAM
Sbjct: 368 MSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAM 427

Query: 425 YTHLILQYSGELNRDLCLWGCNSMWFSLNQTK---IVVDSWGFWNWCNIFWTILVYGSEL 481
           Y HLILQYS EL  +LCLWGCN++    N  +   +VVD+W FWNWCN+F TILVY +EL
Sbjct: 428 YAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANEL 487

Query: 482 IGG 484
           IG 
Sbjct: 488 IGD 490

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/488 (57%), Positives = 359/488 (73%), Gaps = 10/488 (2%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           +++SV+V+L CFYLL+I+ TIPISFK+GGLYCGL+FTVTLF LYF STTL++  R + S+
Sbjct: 8   LIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWGSK 67

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123
             +  T++ +Y Q+ II SLL+LFL+GF+NE+L K + SG QP+++ L++L+ +   +  
Sbjct: 68  PAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVSVK 127

Query: 124 NWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183
           NW+L        V+PWQ ILS+ST  F+L EGFFTIL IQ +GE + WL +E NSNIW I
Sbjct: 128 NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWII 187

Query: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243
           +SLL SGG+IT +LYYLYRIY TP+W LS+  A+LLGFTLSLV  LG+YGIVS NGSVIE
Sbjct: 188 SSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIE 247

Query: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303
           SSLFFAYIVRCIYEI+P+LATTAT+E LE  KE WQ H  N +  +  +SY++D     A
Sbjct: 248 SSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHMQA 307

Query: 304 EMMWESIVSKTVTTSDPFY-----HTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGL 358
              W    S+T     P+Y     +   +P L      F P+    K  T SVP+SI  L
Sbjct: 308 HKFWTLFTSRT-----PYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSISEL 362

Query: 359 FQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSP 418
           F +T++MA DSVSPAI++NL FR++IFYSAT+IIPA+Q +   +  K R IM  LYWYSP
Sbjct: 363 FHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSP 422

Query: 419 CILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYG 478
           CILIAMYTHLILQYSGEL +DLCLWGC+S WF  +Q +I VD+W FWNWCNIFWTI++YG
Sbjct: 423 CILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTIIIYG 482

Query: 479 SELIGGKK 486
           SELIGGKK
Sbjct: 483 SELIGGKK 490

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/482 (56%), Positives = 360/482 (74%), Gaps = 14/482 (2%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           V+QS RV L  FYLL ILITIPISF+VGGLYCGLSFTVTLFNLY ++TTL +  R   +R
Sbjct: 6   VIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR---AR 62

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123
                 +  YY+QH  I SLL+LFLSGFSN+EL + +++ ++P++SL+++L+S   +   
Sbjct: 63  GLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRST--TQSQ 120

Query: 124 NWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183
            W+        +V+PWQ++L  ST +F+L EGFFT+L IQAVGE++RWL     SN+W I
Sbjct: 121 TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180

Query: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243
           + L+ SGGVITAALYYLYRIYVTP+WELS+QTASLLGFT S+V GLG+YGIVS  GS IE
Sbjct: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240

Query: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303
           SSLFFAYIVRC+YEISP+LAT+A DEI  + KE W    R+  S++ LL+YY D++L + 
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300

Query: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTL 363
           EM+W++I+++T          +   P+    +  +P+  F K+FT SVPSSI+ +F +TL
Sbjct: 301 EMVWDAILARTNVNVG-----ASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTL 355

Query: 364 KMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIA 423
           +MA ++++PA+V+NL FR+LIFYSAT+IIPALQ K  R   +SRR M +LYWYSPCI+IA
Sbjct: 356 EMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHKR---RSRRFMRMLYWYSPCIVIA 412

Query: 424 MYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELIG 483
           MYTHLILQYSG+++ DLCLWGC   W   +  K+VVDSWGFWNWCNIF T+ +Y SEL+G
Sbjct: 413 MYTHLILQYSGQISNDLCLWGCFP-WSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLG 471

Query: 484 GK 485
            K
Sbjct: 472 SK 473

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/486 (56%), Positives = 361/486 (74%), Gaps = 22/486 (4%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           ++QS+RV L  FYLL ILITIPI+F+VGGLYCGLSFTVTLFNLY ++TTL +  R   +R
Sbjct: 6   ILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR---AR 62

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123
            +    +  YY+QH  I SLL+LFLSGFSN+EL   +++ ++P++SL+++L+S   S HS
Sbjct: 63  GFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRS---STHS 119

Query: 124 N-WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWN 182
             WI        +V+PWQ++L  ST +F+L EGFFT+L IQAVGE++RWL     SN+W 
Sbjct: 120 QPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWV 179

Query: 183 ITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVI 242
           I+ L+ SGGVITAALYYLYRIYVTP+WELS+QTASLLGFT S+V GLG++GIVS  GS I
Sbjct: 180 ISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTI 239

Query: 243 ESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDS 302
           ESSLFFAYIVRC+YEISP+LAT+A DEI  + K+ W    R+  S++  L+YY D++L +
Sbjct: 240 ESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKN 299

Query: 303 AEMMWESIVSKT---VTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLF 359
            EM+W++++++T   V+ + P    S            +P+  F K+FT SVPSSI+ +F
Sbjct: 300 GEMIWDAVLARTNVNVSGAGPVAWISW--------HRVQPLWKFVKHFTSSVPSSIQEIF 351

Query: 360 QVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPC 419
            +TL MA ++++PA+V+NL FR+LIFYSAT+IIPALQ K  R   +SRR M +LYWYSPC
Sbjct: 352 LLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHKR---RSRRFMRMLYWYSPC 408

Query: 420 ILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGS 479
           I+IAMYTHLI+QYSG+++ DLCLWGC   W     +K+VVDSWGFWNWCNIF T+ +Y S
Sbjct: 409 IVIAMYTHLIMQYSGQISNDLCLWGCFP-WSPPEGSKVVVDSWGFWNWCNIFCTMAIYAS 467

Query: 480 ELIGGK 485
           EL G K
Sbjct: 468 ELFGSK 473

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  471 bits (1211), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 257/514 (50%), Positives = 349/514 (67%), Gaps = 38/514 (7%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           +++S+R  LA FYL  +LITIPISF+VGGLYCGLSFTVTLF LYF +TTL +     + +
Sbjct: 6   LLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTNGSGK 65

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSN------ 117
           F + ++  IYY QH +I S+L+LFLS F++++L ++++S +    S   + + N      
Sbjct: 66  FKLLASL-IYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVNESLL 124

Query: 118 -----PFSAHSNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWL 172
                P     +          IV+PWQ++L H+T +F+L+EGFFT+LAIQA+GE+ RWL
Sbjct: 125 QLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGRWL 184

Query: 173 LYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLY 232
            Y+ NSN W I SLL+SG VIT +++YLYRIYVTP+W LS+QTA+LLGFTLSLV GLGLY
Sbjct: 185 RYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLGLY 244

Query: 233 GIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLL 292
           GI+S  GS IESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  Q   S  NNLL
Sbjct: 245 GIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSK-NNLL 303

Query: 293 SYYHDVVLDSAEMMWESIVSKTV--TTSDPFYHTSMFPPLRKFTDIF------------- 337
           +YY+  V  +AE  W+S++ KT   T +      ++F     FT                
Sbjct: 304 TYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQTQWW 362

Query: 338 ---KPVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPA 394
              + +  F KNF++ +P SI  +  VTLKMA +S++PA++ NL FRVL+FYSAT+IIPA
Sbjct: 363 LKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRIIPA 422

Query: 395 LQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLN- 453
           LQ        +SR++M ++YWYSPCI+IAMYTHLIL+YSGELN DLC+WGC   W + + 
Sbjct: 423 LQKATGA--TQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-WLNFSA 479

Query: 454 --QTKIVVDSWGFWNWCNIFWTILVYGSELIGGK 485
             ++K VVD+W FWNWCN+F+T+L+Y  ELIG +
Sbjct: 480 KTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  460 bits (1184), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 351/528 (66%), Gaps = 48/528 (9%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           V QS+R+L  CFYL+S+LITIP +FK+GGLYCGLSFT+TLF+LYF+STT+ L  +   + 
Sbjct: 8   VKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNN 67

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPE-QSLLEVLK---SNPF 119
           FY+  +  +YY QH +IASLLY+F++ FS+  L +IL +    +  SLL  +K   S   
Sbjct: 68  FYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSKSV 127

Query: 120 SAHSNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSN 179
           S + +++L        VQPW ++LSHST FF+L EGFFTIL IQA+GE++ WLL +    
Sbjct: 128 SQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQKK 187

Query: 180 IWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNG 239
           I+ + + LIS GVI  A+++LY+IY   VWELSIQTASLLG T+SLV  +G++GI S NG
Sbjct: 188 IFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNG 247

Query: 240 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVV 299
           S+IESSLF  YI+RC YEISP+L+T+AT EIL+  KEAWQ HQ + + T ++L YY++V+
Sbjct: 248 SLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVL 307

Query: 300 LD--SAEMMWESIVSKTVTTS-------------DPFYHTSMFPP-----LRKFTDIFK- 338
           L   ++  ++ S  SK+  TS             + +  T +  P     L  F  I++ 
Sbjct: 308 LKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQN 367

Query: 339 ------PVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKII 392
                 P+    K+F +++P+S+  L QVT K+A DSVSP+IV+NL FRVLIFYSAT+II
Sbjct: 368 WLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRII 427

Query: 393 PALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSL 452
           PA+Q K   +  +SR  +   Y +SPCI+IAMYT+LILQYSGEL  DLC+WGC+ +  S+
Sbjct: 428 PAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSI 487

Query: 453 NQ-----------------TKIVVDSWGFWNWCNIFWTILVYGSELIG 483
           +Q                  + +V+SWGFWNWCNIF TI +YG EL+G
Sbjct: 488 SQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 347/508 (68%), Gaps = 37/508 (7%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           +++S+R  LA FYL  +LIT+PISF++GGLYCGLSFTVTLF LYF++TTL +        
Sbjct: 6   LLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRGDE 65

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPE-------------QSL 110
           +   ++ T+YY QH ++ S+L+LFLSGF+N++L K L  GS P+             +SL
Sbjct: 66  WKHIAS-TLYYLQHFLMPSILFLFLSGFNNDQLQKKL-VGSDPKGARGGFIFDGNMNESL 123

Query: 111 LEVL-KSNPFSAHSNWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESH 169
           L++L +S    A   ++        +V+PWQ++L H+T  F+L+EGFFT+LAIQ +GE+ 
Sbjct: 124 LQLLGRSRDDRATMAYL---HYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 170 RWLLYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGL 229
           RWL Y+ NS  W I+SL++SG VIT ++YYLYRIYVTP+W LS+ TA+LLGFTLSLV GL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 230 GLYGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTN 289
           GLYGI+S  GS IESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  Q      N
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK-N 299

Query: 290 NLLSYYHDVVLDSAEMMWESIVSKTV---------TTSDPFYHTSMFPPLRKFTDIFKPV 340
           +LL+YY + +L+ AE +W+ ++ K             S      ++    +++ +  + +
Sbjct: 300 SLLAYYKNFILN-AENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358

Query: 341 GIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQ-GKG 399
             F KNF+  +P SI  +F VTL +A +S++ A+V NL FRV++FYSAT+IIPALQ   G
Sbjct: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418

Query: 400 DRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWF--SLNQTKI 457
             Q   SR++M ++YWYSPCI+IAMYTH+IL+YSGELN +LC+WGC   W     N+ + 
Sbjct: 419 GTQ---SRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEANRDRW 474

Query: 458 VVDSWGFWNWCNIFWTILVYGSELIGGK 485
           VVD+WGFWNWCN+F+T+L+Y  ELIG +
Sbjct: 475 VVDAWGFWNWCNLFFTLLIYAVELIGSR 502

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  456 bits (1172), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 249/539 (46%), Positives = 344/539 (63%), Gaps = 72/539 (13%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           V+ S   +L  FYLL+I++TIPISFK+GG+YCGLSFT TLF LYF+ST++++  +     
Sbjct: 55  VINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHN 114

Query: 64  FYV-FSTATIYYSQHCIIASLLYLFLSGFSNEELTKIL----------ESGSQPEQSLLE 112
             +    ++++Y Q+ II+SLL ++L GF+N++L   L          ++G+  +  +L 
Sbjct: 115 TTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILF 174

Query: 113 VLKS---------------------------------NPFSAHSNWILXXXXXXXIVQPW 139
           ++K                                  +P   +S WIL        ++PW
Sbjct: 175 IIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNS-WILFFYYYYIFIKPW 233

Query: 140 QWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNITSLLISGGVITAALYY 199
           +++L +ST FF+L EGFFTIL IQ +GE++ WL  + +S+ W I SLL SGGVITA LYY
Sbjct: 234 KFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYY 293

Query: 200 LYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIESSLFFAYIVRCIYEIS 259
           L RIYVTP W+L++ TAS+LGFTLS+V GLG++GIVSKNGS IESSLFFAYIVRCIYE+S
Sbjct: 294 LNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMS 353

Query: 260 PKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAEMMWESIVSKTVTTSD 319
           P+LA +ATDE LE F E WQ +Q   +  +N+L+Y    ++D+             + S 
Sbjct: 354 PELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFS-----------SFSS 402

Query: 320 PFYHTSMFPPLRKF----TDIFKPVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIV 375
             +H  +FP   +       I K   +F KNFTI+VPSSI  L Q+T +MA DS+SPAI+
Sbjct: 403 IEHH--LFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAII 460

Query: 376 VNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGE 435
           +NL FR++IFYSAT+IIPA+Q +     +     M+ +YW+SPC+LIAMYTHLILQ+SGE
Sbjct: 461 INLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGE 520

Query: 436 LNRDLCLWGCNSMWFS---------LNQTKIVVDSWGFWNWCNIFWTILVYGSELIGGK 485
           L +++CLW C + W S         L    I+VDSW FWNWCNIFWTI++Y SELIGG+
Sbjct: 521 LKKNICLWNCEN-WLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  447 bits (1150), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 251/487 (51%), Positives = 317/487 (65%), Gaps = 51/487 (10%)

Query: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63
           V+Q++R+ L   YL  +LITIPISF+VGGL CGLSFTVTLF LYF+STT  L +    S 
Sbjct: 47  VLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSA 106

Query: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123
                +  IYY QH +I S+L++FLS F N      ++S         + + S  F    
Sbjct: 107 L----STLIYYLQHLLIPSILFMFLSYFEN------IDS---------DTVDSEYFKVFW 147

Query: 124 NWILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183
           N          +V+PWQ  L HST  F+L EG FTILAIQA+GE+ RWL     SN W I
Sbjct: 148 N---------VMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVI 198

Query: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243
            SLLISGG+IT +L+Y YRIYVTP+WELS  +ASLLGFT S+VCG+GLYGI + +GSV+E
Sbjct: 199 LSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257

Query: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303
           SSLFFAY+VR +YEISPK+A  A DEI +I KE W+ HQ N    +NLL    +++  + 
Sbjct: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313

Query: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTD----IFKPVGIFFKNFTISVPSSIEGLF 359
             +W  IV  T     P  H  +     K  D    I  P+    KNFT SVP SI+ +F
Sbjct: 314 RAIWSQIVEHT-----PRNHKYI-----KMMDQCKWILNPLWNSVKNFTKSVPISIQEIF 363

Query: 360 QVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPC 419
            VT KMA +S+ PA+V+NL FR+LIFYSAT+IIP LQ +  ++    RRIMN +YWYSPC
Sbjct: 364 VVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPC 422

Query: 420 ILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGS 479
           I+IAMYTHLIL+YSG+L  DLC+WGC        + KIVVDSW FWNWCNI+ T+L+Y  
Sbjct: 423 IIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTMLIYAL 479

Query: 480 ELIGGKK 486
           EL+G  K
Sbjct: 480 ELMGSNK 486

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  432 bits (1110), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 235/491 (47%), Positives = 337/491 (68%), Gaps = 17/491 (3%)

Query: 6   QSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRFY 65
           +S R   A  YLLS+L+T+PI+F++GGL CGL+FT+TLF+ YF++TTL+   R    + +
Sbjct: 10  ESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLRWQRF 69

Query: 66  VFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNP-FSAHSN 124
           +  T  +YY Q+  I  +L++FLS FS+ EL+  +   +   +++  +LK+N  + + + 
Sbjct: 70  IAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDTYPSKTI 129

Query: 125 WILXXXXXXXIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184
             +        +  W++ LS+ST  F+L EGFFTILAIQ +GE++ WL    NS+IW I 
Sbjct: 130 SFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNSSIWIIL 189

Query: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244
           SL++S  ++T ++YY+Y+IYVTP+W LS Q ASLL FT SLV G+ +YGIVS  GSV+ES
Sbjct: 190 SLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHRGSVVES 249

Query: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304
           SLFFAYIV CIYEISP +ATTA D+I +  KE+WQ HQRN+  ++NLL YY++ ++ + +
Sbjct: 250 SLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNSLIKNVD 309

Query: 305 MMWESIVSKTVTTSDPF---YHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQV 361
              +  + K +TT D F   +++ +F  ++     FK +    K FT+ +PSSI  L+ +
Sbjct: 310 EFIKLKIIK-LTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPSSIYELYSI 368

Query: 362 TLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDR------QLNKSRRIMNVLYW 415
           TLKMAS+S+SP I+VNL +RVLIFY+AT+IIPAL+ + +       +   + + M VLYW
Sbjct: 369 TLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYW 428

Query: 416 YSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTIL 475
           YSPCILIAMYT+LILQYSGEL  +        +W + N  ++VVDSW FWNWCNIFWTI 
Sbjct: 429 YSPCILIAMYTNLILQYSGELKSEF------KLWNNSNNNEVVVDSWRFWNWCNIFWTIT 482

Query: 476 VYGSELIGGKK 486
           +YGSELIGG+K
Sbjct: 483 LYGSELIGGRK 493

>Smik_14.118 Chr14 (224960..225565) [606 bp, 201 aa] {ON} YNL214W
           (REAL)
          Length = 201

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 177 NSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVS 236
           N  +  I S+L +GG I A LY+   ++V P+    IQ   L     SL   L L G++S
Sbjct: 26  NPTVKAIKSILYNGGSIYAFLYFFVAMFVEPM----IQKQYLQRHDFSLFILLRLRGMIS 81

Query: 237 K 237
           K
Sbjct: 82  K 82

>TPHA0N00830 Chr14 (185748..187424) [1677 bp, 558 aa] {ON} Anc_5.227
           YLR004C
          Length = 558

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 8   VRVLLACFYLLSILITIPISFKVG---GLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64
           V  ++ C  +LS+    P+S KVG   GLY   S + T+ N+Y  +T       GY  R 
Sbjct: 416 VPAIVGCIVMLSL----PLSNKVGNLLGLYLVYSGSCTITNIYIWNT---WNTSGYCKRI 468

Query: 65  YVFSTATIYYSQHCIIASLLY 85
           +  +   I Y+  CI+A  ++
Sbjct: 469 FRNAATLIVYNVACIVAPQMF 489

>ZYRO0A13750g Chr1 (1095532..1097103) [1572 bp, 523 aa] {ON} similar
           to uniprot|Q07904 Saccharomyces cerevisiae YLR004C
           Hypothetical ORF
          Length = 523

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 20  ILITIPISFKVGGL---YCGLSFTVTLFNLYFMSTTLSLFVRGYASRFYVFSTATIYYSQ 76
           ++I++P+S K+G L   Y   S +  + N+Y  +   SL   GY  R +  +   I YS 
Sbjct: 389 VMISLPLSHKIGNLFSLYLLYSGSCVITNIYLWN---SLNTSGYCKRIFRNAATMIVYSL 445

Query: 77  HCIIA 81
            CI+A
Sbjct: 446 ACILA 450

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,632,725
Number of extensions: 2012322
Number of successful extensions: 7730
Number of sequences better than 10.0: 46
Number of HSP's gapped: 7885
Number of HSP's successfully gapped: 47
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)