Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A02002g2.292ON70970931690.0
TDEL0G022202.292ON71071921760.0
SAKL0E07546g2.292ON71870320810.0
Suva_9.1082.292ON72255720710.0
Skud_9.822.292ON72270820650.0
Smik_9.882.292ON72455720570.0
YIL091C (UTP25)2.292ON72155720560.0
KAFR0J013402.292ON72856020550.0
CAGL0D04180g2.292ON70056420150.0
KLTH0G10494g2.292ON74755820160.0
TBLA0B059702.292ON71955820090.0
Kwal_27.115032.292ON72755920090.0
KNAG0A054002.292ON72156520060.0
KLLA0E08229g2.292ON70470920010.0
NDAI0B035302.292ON73956020010.0
NCAS0B062302.292ON72356019880.0
Kpol_1039.462.292ON70455819760.0
Ecym_33312.292ON70870619670.0
TPHA0D015202.292ON71656019620.0
ADL209C2.292ON70455818830.0
Ecym_13958.469ON565207850.13
KLLA0F17435g2.409ON1271146771.2
Skud_4.5058.469ON604194743.0
NDAI0F026702.176ON129474734.7
Smik_4.4908.469ON587180725.2
NCAS0G025602.164ON556115716.4
TDEL0F011902.164ON549109707.3
ZYRO0C01034g8.768ON50083699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A02002g
         (709 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...  1225   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   842   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   806   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   802   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   800   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   796   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   796   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   796   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   780   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   781   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   778   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   778   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   777   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   775   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   775   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   770   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   765   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   762   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   760   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   729   0.0  
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    37   0.13 
KLLA0F17435g Chr6 complement(1596081..1599896) [3816 bp, 1271 aa...    34   1.2  
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    33   3.0  
NDAI0F02670 Chr6 complement(652448..656332) [3885 bp, 1294 aa] {...    33   4.7  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    32   5.2  
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...    32   6.4  
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...    32   7.3  
ZYRO0C01034g Chr3 complement(71256..72758) [1503 bp, 500 aa] {ON...    31   9.6  

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/709 (86%), Positives = 614/709 (86%)

Query: 1   MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVAXXXXXXXXXXXXXXAT 60
           MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVA              AT
Sbjct: 1   MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDAT 60

Query: 61  NEVQEQEDSKEKAYGALLTILKSEHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEA 120
           NEVQEQEDSKEKAYGALLTILKSEHP                               VEA
Sbjct: 61  NEVQEQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEKGEVEA 120

Query: 121 NLVDTPGXXXXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSESIDSLDEAWKQKKIVNKSG 180
           NLVDTPG                           HFNMQSESIDSLDEAWKQKKIVNKSG
Sbjct: 121 NLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSESIDSLDEAWKQKKIVNKSG 180

Query: 181 KIRVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQR 240
           KIRVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQR
Sbjct: 181 KIRVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQR 240

Query: 241 KIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEF 300
           KIVDPIF                       VLHVLNHIYKTRDRILKDNQRLATNPDGEF
Sbjct: 241 KIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEF 300

Query: 301 LDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSF 360
           LDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSF
Sbjct: 301 LDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSF 360

Query: 361 RHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLS 420
           RHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLS
Sbjct: 361 RHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLS 420

Query: 421 SIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLI 480
           SIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLI
Sbjct: 421 SIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLI 480

Query: 481 FTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVD 540
           FTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVD
Sbjct: 481 FTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVD 540

Query: 541 EPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSD 600
           EPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSD
Sbjct: 541 EPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSD 600

Query: 601 VRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGK 660
           VRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGK
Sbjct: 601 VRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGK 660

Query: 661 SAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
           SAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK
Sbjct: 661 SAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/719 (58%), Positives = 519/719 (72%), Gaps = 19/719 (2%)

Query: 1   MVKRTGNGTDAI-DGSRKRGRKDLRSIRRARNDK---EPVEEPEIPVAXXXXXXXXXXXX 56
           MVK   NG +A  +G+ KRGRK+LRSIRR + +K   EP    E                
Sbjct: 1   MVKDKSNGDEARRNGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHN 60

Query: 57  XXATNEVQEQEDSKEKAYGALLTILKSEHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 116
               N  +++E+ + K YGALLTIL SEHP                              
Sbjct: 61  EEIANVEEDEENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVE 120

Query: 117 XVEANLV---DTPGXXXXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSESI-DSLDEAWKQ 172
            +E NL    + P                            HFN   E++ D LD A+K+
Sbjct: 121 QLEDNLARVDENPSEDDLSEDADEESDDEQDTFDS------HFNQVPENVVDKLDAAFKE 174

Query: 173 KKIVNKSGKIRVDDDESLIYTKTL--AGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLES 230
           +++  KS K+ + ++ES++Y+K L    + ++ E+PS    L SY  K++LKIQN+L   
Sbjct: 175 RQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL--- 231

Query: 231 QDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQ 290
           + + LT  QR +VDP+                         LHVLNH+YKTRD+ILK+NQ
Sbjct: 232 EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQ 291

Query: 291 RLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDV 350
           R++ NPD ++LDQGFTRPKVLIV PTRDTAYQ++ K+I+KSG+DQ+DKK K RDQFFE+ 
Sbjct: 292 RISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEES 351

Query: 351 LPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTD 410
           LPPSSKPKSF+H FKGNTNDFFVLGVKFTRKAI+LYSNFYQSD+I+CSPLG+QLILENTD
Sbjct: 352 LPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTD 411

Query: 411 RKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINE 470
           +KKRQDDFLSSIE+ I DQL+SIE+QNVSH+ TIF H+N IP+EQHDTDFGRVR+WYINE
Sbjct: 412 KKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINE 471

Query: 471 QAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQR 530
           QAKL RQT+IFT+YV+PTAN L+N KC+N+ GRWKNHH I   QSS+ KLG +VRQIFQR
Sbjct: 472 QAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQR 531

Query: 531 VDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTI 590
           +DLG AS+++E D+RF+FFTSVI+PSI KSTGYEDGIL+YIPDYADFIRVRNY+K+KTTI
Sbjct: 532 IDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTI 591

Query: 591 LFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEF 650
           +FGDINEYS+ +QL S R+LFQQGR KVLLYTERLHHFRRYEIKGVKSV+FYQPP+NPEF
Sbjct: 592 IFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEF 651

Query: 651 YNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
           Y+EVVR+I KSA LG TDLNISTVR +YSKLDG++LERIV +KRAA+LTHGQNE+YEFK
Sbjct: 652 YSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/703 (58%), Positives = 501/703 (71%), Gaps = 12/703 (1%)

Query: 15  SRKRGRKDLRSIRRA--RNDKEPVEEPEI-PVAXXXXXXXXXXXXXXATNEVQEQEDSKE 71
           ++K GRK+LR+I RA  R+  E  ++ E  P                   E ++ E  K+
Sbjct: 20  AKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNKPRSDEEEEEDIETKKQ 79

Query: 72  KAYGALLTILKSEHPXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXVEANLVDTPGXX 129
           K Y ALLT+L+SEHP                                 +E  LV+T    
Sbjct: 80  KVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVET---N 136

Query: 130 XXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSE-SIDSLDEAWKQKKIVNKSGKIRVDDDE 188
                                    HFN  SE     L  A++ KKI  KS K+ V++DE
Sbjct: 137 DDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDE 196

Query: 189 SLIYTK-TLAGK-GQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPI 246
             IY++ T+ G+ G     PS K  L SY +K+KLKIQNNLL+ + + L PLQ+ +VDP+
Sbjct: 197 FFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPM 256

Query: 247 FXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFT 306
           F                        LHVLNH+YKTRDRIL+++Q+L  N D E LDQGFT
Sbjct: 257 FQYQDLLYEYRSYEQEEEYRDLY-ALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFT 315

Query: 307 RPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKG 366
           RPKVLIV PTRD AYQIV+K+IEKSGLDQVDK+ K +DQFF+  LPPSSKPKSF+H FKG
Sbjct: 316 RPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFKG 375

Query: 367 NTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMI 426
           NTNDFFVLG KFTRK ++LYSNFYQSD+I CSPLG+QLILENTD+KKRQDDFLSSIELM+
Sbjct: 376 NTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMV 435

Query: 427 IDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVT 486
           IDQL+SIE+QN+SH+ TIF H+NKIP++QHD DF R+RMWYINEQA L RQT++FT+Y +
Sbjct: 436 IDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYAS 495

Query: 487 PTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRF 546
           P AN L+NGKCRN  GRWKNH+ +  E+SS+++LG +VRQIFQR DL G S +DEPDYRF
Sbjct: 496 PFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRF 555

Query: 547 RFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTS 606
           +FFTSVI+ SI KSTGYEDGILLYIPDY D++RVRN+L++KTT+LFGDINEYS+ +QLTS
Sbjct: 556 KFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTS 615

Query: 607 TRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGD 666
            R+LFQQG++KVLLYTERLHHFRRYEIKGVKSVIFY+PP+NPEFY EVVRYIGKSAFLG 
Sbjct: 616 NRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGS 675

Query: 667 TDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
            DLNISTVRCVY KLDGL+LER+V +KRAAVLTHGQNEIYEFK
Sbjct: 676 ADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/557 (67%), Positives = 452/557 (81%), Gaps = 2/557 (0%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLA-GKGQEFELPSHKGHL 212
           HFN  SE  +D +  A+K   I  KS K  + DDES IY+K +  G     E P     +
Sbjct: 166 HFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETPVERPYKSSSI 225

Query: 213 SSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVL 272
            SY LK++LKIQN LL+ + D LT LQ+K+VDP+F                        L
Sbjct: 226 YSYFLKQRLKIQNGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTL 285

Query: 273 HVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSG 332
           H LNHIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIV PTRD AY +V K+I+KSG
Sbjct: 286 HALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSG 345

Query: 333 LDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQS 392
           +DQVDKK K  DQF +D LPPSSKPKSF+H F+GNT+DFFV+G+KFTRKAI+LYSNFYQS
Sbjct: 346 IDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQS 405

Query: 393 DLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIP 452
           D+IVCSPLG+Q+ILENTD+KKRQDDFLSSIELM+IDQL+SIE+QN+SH+FTIF H+NKIP
Sbjct: 406 DIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIP 465

Query: 453 KEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITG 512
            +QH+ DF R+RMWYINEQAKLLRQT++FT+Y++P AN L+NG+CRN+ GRWKNH  I  
Sbjct: 466 DQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIES 525

Query: 513 EQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIP 572
           E SS+ +LG ++RQIFQR D+ G S+++EPDYRF+FFTSVI+PSI KSTGYEDGIL+YIP
Sbjct: 526 ETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIP 585

Query: 573 DYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYE 632
           DY DFIR+RNY+K+KTTILFGDINEYS  +QL + RSLFQQGR+KVLLYTERLHH+RRYE
Sbjct: 586 DYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYE 645

Query: 633 IKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSS 692
           IKGVK+VIFY+PP+NPEFYNE VRYIGK+AFLG+TDLNISTVRCVYSKLDGL+LERIV +
Sbjct: 646 IKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGT 705

Query: 693 KRAAVLTHGQNEIYEFK 709
           KRA VL+H Q E+YEFK
Sbjct: 706 KRAGVLSHAQKEVYEFK 722

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 14 GSRKRGRKDLRSIRRARNDK-EPVEEPEIP-VAXXXXXXXXXXXXXXATNE----VQEQE 67
          G RKRGR+++R I+R    + E V+  E+  VA              A +E    + ++E
Sbjct: 15 GHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDEE 74

Query: 68 DSKEKAYGALLTILKSEHP 86
          + +EK Y ALLTILKSEHP
Sbjct: 75 EKQEKVYDALLTILKSEHP 93

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/708 (56%), Positives = 494/708 (69%), Gaps = 12/708 (1%)

Query: 14  GSRKRGRKDLRSIRRARNDK-EPVEEPEIP-VAXXXXXXXXXXXXXXATNE----VQEQE 67
           G RKRGR++LR I+R+   + E V+  +I  VA                +E    V +++
Sbjct: 15  GHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVGDED 74

Query: 68  DSKEKAYGALLTILKSEHPXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXVEANLV 123
           + K+K Y ALLTILKSEHP                                   +E  L+
Sbjct: 75  EKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENGLL 134

Query: 124 DTPGXXXXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSE-SIDSLDEAWKQKKIVNKSGKI 182
                                          HFN   E  +D L  A+K K I  KS K 
Sbjct: 135 GDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKA 194

Query: 183 RVDDDESLIYTK-TLAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRK 241
            ++ DES IY +  + G+    E P     + SY LK++LKIQN L + + D L  LQRK
Sbjct: 195 PLNGDESYIYAQPVVVGEESSVESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLNALQRK 254

Query: 242 IVDPIFXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEFL 301
           +VDP+F                        LHVLNHIYKTRDRILK+NQRL  NPD E L
Sbjct: 255 LVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHL 314

Query: 302 DQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFR 361
           DQGFTRPKVLIV PTRD AY++V K+I KSG+DQVDKK K  DQF +D LPP SKP+SF+
Sbjct: 315 DQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQ 374

Query: 362 HTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSS 421
           H FKGNTNDFFV+G+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+ILENTD+KKRQDDFLSS
Sbjct: 375 HIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSS 434

Query: 422 IELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIF 481
           IE+M+IDQL+SIE+QN+SH+ TIF H+NKIP +QH+ DF R+RMWYINEQAK  RQT++F
Sbjct: 435 IEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVF 494

Query: 482 TRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDE 541
           T+Y++PT N L+NG+CRN+ GRWKNH  I  E SS+ +LG ++RQIFQR D  G S+V+E
Sbjct: 495 TKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEE 554

Query: 542 PDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDV 601
           PDYRF+FFTSV++PSI KSTGYEDGIL+YIPDY DFIR+RNY+K+KTTILFGDINEYS  
Sbjct: 555 PDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQ 614

Query: 602 RQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKS 661
           RQL + RSLFQQGR+KV+LYTERLHH+RRY+IKGVKSVIFY+PP+NPEFY+E VR+IGK+
Sbjct: 615 RQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKN 674

Query: 662 AFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
           AF G+TDLNISTVRC+YSKLDG++LERIV +KRAAVL+H Q E+YEFK
Sbjct: 675 AFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/557 (66%), Positives = 452/557 (81%), Gaps = 2/557 (0%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKT-LAGKGQEFELPSHKGHL 212
           HFN  SE  +D L  A+K K I  KS K  + DDES IY K  + G+    E P     +
Sbjct: 168 HFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSI 227

Query: 213 SSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVL 272
            SY LK++LK+QN LL+ + D LT +Q+K++DP+F                        L
Sbjct: 228 YSYFLKQRLKVQNGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYAL 287

Query: 273 HVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSG 332
           HVLNHIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIV PTR+ AY++V K+I KSG
Sbjct: 288 HVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSG 347

Query: 333 LDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQS 392
           +DQVDKK K  DQF +D LPP SKPKSF+H FKGNT+DFFV+G+KFTRKAI+LYSNFYQS
Sbjct: 348 IDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQS 407

Query: 393 DLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIP 452
           D+I+CSPLG+Q+ILENTD+KKRQDDFLSSIELM+IDQL+SIE+QN+SH+FTIF H+NKIP
Sbjct: 408 DIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIP 467

Query: 453 KEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITG 512
            +QH+ DF R+RMWYINEQAKL RQT++FT+Y++P AN L+NG+C N+ GRWKNH  I  
Sbjct: 468 DQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGS 527

Query: 513 EQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIP 572
           E SS+ +LG +VRQIFQR D+ G S+++EPDYRF+FFTSVI+PSI KS GYEDGIL+YIP
Sbjct: 528 ESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIP 587

Query: 573 DYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYE 632
           DY DFIR+RNY+K+KTTILFGDINEYS+ RQL + RSLFQQGR+KV+LYTERLHH+RRYE
Sbjct: 588 DYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYE 647

Query: 633 IKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSS 692
           IKGVKSV+FY+PP+NPEFYNE VR+IGK+AFLG+TDLNISTVRC+YSKLDGL+LERIV +
Sbjct: 648 IKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGT 707

Query: 693 KRAAVLTHGQNEIYEFK 709
           KRAAVL+H Q E+YEFK
Sbjct: 708 KRAAVLSHAQKEVYEFK 724

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 9  TDAIDGSRKRGRKDLRSIRRA---RNDKEPVEEPEIPVAXXXXXXXXXXXXXXATNE--- 62
           D   G RKRGR++LR I+R+   R   E V E +                   + E   
Sbjct: 10 NDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNL 69

Query: 63 -VQEQEDSKEKAYGALLTILKSEHP 86
           V+++E  KEK Y ALLTILKSEHP
Sbjct: 70 DVEDEEGKKEKVYDALLTILKSEHP 94

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/557 (67%), Positives = 450/557 (80%), Gaps = 2/557 (0%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLA-GKGQEFELPSHKGHL 212
           HFN   E  +D L  A+K K +  KS K  + D ES IY K +  G+    E P     +
Sbjct: 165 HFNQVPEKFVDKLSNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSI 224

Query: 213 SSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVL 272
            SY LK++LK+QN LL+ + D LT LQ+K+VDP+F                        L
Sbjct: 225 YSYFLKQRLKVQNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYAL 284

Query: 273 HVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSG 332
           HVLNHIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIV PTR+ AY++V K+I KSG
Sbjct: 285 HVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSG 344

Query: 333 LDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQS 392
           +DQVDKK K  DQF +D LPP SKPKSF+H F+GNTNDFFV+G+KFTRKAI+LYSNFYQS
Sbjct: 345 IDQVDKKGKFYDQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQS 404

Query: 393 DLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIP 452
           D+IVCSPLG+Q+ILENTD+KKRQDDFLSSIELM+IDQL+SIE+QN+SH+FTIF H+NKIP
Sbjct: 405 DIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIP 464

Query: 453 KEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITG 512
            +QH+ DF R+RMWYINEQAKL RQT++FT+Y++P AN L+NG+CRN+ GRWKNH  I  
Sbjct: 465 DQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGS 524

Query: 513 EQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIP 572
           E SS+ + G ++RQIFQR D+ G S+++EPDYRF+FFTSVI+P I KSTGYEDGIL+YIP
Sbjct: 525 ENSSIGQSGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIP 584

Query: 573 DYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYE 632
           DY DFIR+RNY+K+KTTILFGDINEYS  RQL + RSLFQQGR+KV+LYTERLHH+RRYE
Sbjct: 585 DYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYE 644

Query: 633 IKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSS 692
           IKGVKSV+FY+PP+NPEFYNEVVR+IGK+AFLG+TDLNISTVRC+YSKLDGL+LERIV +
Sbjct: 645 IKGVKSVVFYKPPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGT 704

Query: 693 KRAAVLTHGQNEIYEFK 709
           KRAAVL+H Q EIYEFK
Sbjct: 705 KRAAVLSHAQKEIYEFK 721

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 9  TDAIDGSRKRGRKDLRSIRR--ARND---KEPVEEPEIPVAXXXXXXXXXXXXXXATNEV 63
           D   G RKRGR++LR I+R  AR +    E +E+    +                  ++
Sbjct: 10 NDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDI 69

Query: 64 QEQEDSKEKAYGALLTILKSEHP 86
          +++E  KEK Y ALLTILKSEHP
Sbjct: 70 EDEEGKKEKVYDALLTILKSEHP 92

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/560 (68%), Positives = 451/560 (80%), Gaps = 6/560 (1%)

Query: 155 HFNMQSESI-DSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQEFELPS----HK 209
           HFN   E   D LD ++K   I  KS K+ + +DE  I++K +  K  E E P     +K
Sbjct: 170 HFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVI-KSDEIESPVELSVNK 228

Query: 210 GHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXX 269
             + SY LK++LK+QNNL++ + D LTPLQ+++VDP+F                      
Sbjct: 229 SSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDL 288

Query: 270 XVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIE 329
             LHVLNH+YKTRD+ILK+NQRL  N D E LDQGFTRPKVLIV PTRDTAYQ++ K+I 
Sbjct: 289 YSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIA 348

Query: 330 KSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNF 389
           KSG+DQVDKK K +DQFFED LPPSSKPKSF+  FKGNTNDFFVLGVKFTRKAI+LYSNF
Sbjct: 349 KSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNF 408

Query: 390 YQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMN 449
           YQSD+I+CSPLG+Q+ILENTD+KKRQDDFLSSIELMIIDQL+SIE+QN+SHLFTI  H+N
Sbjct: 409 YQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHIN 468

Query: 450 KIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQ 509
           KIP+EQHD DF RVRMWYIN+QAKL RQT++FT+Y++P AN LLNGKC+N  GRWKNH  
Sbjct: 469 KIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKV 528

Query: 510 ITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILL 569
           I+   SS+SK+G ++RQIFQR +    SVVDEPDYRF+FFTSV VP+I K+TGYEDG L+
Sbjct: 529 ISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLI 588

Query: 570 YIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFR 629
           YIP+Y D+IRVRNYLKDKTTILFGDINEYSD +QL S RSLFQQGR+KVLLYTERLHH+R
Sbjct: 589 YIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYR 648

Query: 630 RYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERI 689
           RYEIKGVK+V+FYQPP NPEFY EVVRYIGK+AFLG+TDLNISTVRC+YSKLD L+LE I
Sbjct: 649 RYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENI 708

Query: 690 VSSKRAAVLTHGQNEIYEFK 709
           V SKRA VL H QNE+YEFK
Sbjct: 709 VGSKRAGVLCHAQNEVYEFK 728

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (54%), Gaps = 14/97 (14%)

Query: 2  VKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPE----IPVAXXXXXXXXXXXXX 57
          +KR+G G D  DG RKRGRK+LR+IRRA   ++P +  E    I V+             
Sbjct: 1  MKRSGTGADGYDGVRKRGRKELRNIRRA-GGRKPRDAQENGNGISVSENTGEVEEEPSSA 59

Query: 58 XATNEV---------QEQEDSKEKAYGALLTILKSEH 85
             ++V          ++E+ K++ YGALLTILKSEH
Sbjct: 60 ANGDDVGDEVGDEASDDEEEMKKQVYGALLTILKSEH 96

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/564 (65%), Positives = 454/564 (80%), Gaps = 9/564 (1%)

Query: 155 HFNMQSESI--DSLDEAWKQKKIVNKSGKIRV---DDDE----SLIYTKTLAGKGQEFEL 205
           HFN +  +   ++L  A K  K+  KS K++V   D+D+    ++     + G+  + E 
Sbjct: 137 HFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIED 196

Query: 206 PSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXX 265
           P  K  LSSY LK++L+IQNNLL+++ + LT LQRKIVDP+                   
Sbjct: 197 PKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDE 256

Query: 266 XXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVS 325
                 LHVLNH+YKTRD+I+K+NQ+L  NPD EFLDQGFTRPKVLI+APTRD+AYQIV+
Sbjct: 257 YRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVT 316

Query: 326 KVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRL 385
           K+IEKSGLDQVDKK K RDQF++   PPSSKPKSF+H FKGNTND+FVLGVKFTRKAI+L
Sbjct: 317 KLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKL 376

Query: 386 YSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIF 445
           YSNFYQSD+IVCSPLGLQ+I+ENTD+KKRQDDFLSS+E+ IIDQ +SIE+QN +HLFTIF
Sbjct: 377 YSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIF 436

Query: 446 AHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWK 505
            H+NKIP+EQHD DF R+RMWYIN+QAK  RQT+IFT+Y++P AN LLN KCRN+ GRWK
Sbjct: 437 DHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWK 496

Query: 506 NHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYED 565
           NH  ++ E SSV  +G +VRQIFQR ++ G SV DEPDYRF+FFTSV++ +ITKSTGY+D
Sbjct: 497 NHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDD 556

Query: 566 GILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERL 625
           G L+YIP+Y+D++RVRNY+K+KT+ILFGDINEYS+ R LTS R+LF QGR+KVLLYTERL
Sbjct: 557 GTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERL 616

Query: 626 HHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLA 685
           HHFRRYE+KGVK+V+FY+PPS+PEFY EVVRYIGK+ FLGD DLNISTVRC YSKLDGLA
Sbjct: 617 HHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLA 676

Query: 686 LERIVSSKRAAVLTHGQNEIYEFK 709
           LE+IV +KR  VLTHGQNE YEFK
Sbjct: 677 LEKIVGTKRTGVLTHGQNETYEFK 700

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 17 KRGRKDLRSIRRARNDK-EPVEEPEIPVAXXXXXXXXXXXXXXATNEVQEQEDSKEKAYG 75
          KRGRK+LRSIRRA+  K EP  E +  V                  +  E+ED KE+ Y 
Sbjct: 3  KRGRKELRSIRRAKRTKIEP--EADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQVYN 60

Query: 76 ALLTILKSEH 85
          ALLTILKSEH
Sbjct: 61 ALLTILKSEH 70

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/558 (67%), Positives = 450/558 (80%), Gaps = 5/558 (0%)

Query: 155 HFNMQSE-SIDSLDEAWKQKKIVNKSGKIRVDDDESLIYTK-TLAGK-GQEFELPSHKGH 211
           HFN  SE   ++LD A+K K++  +S K+ VD ++  IY++ TL  +       P     
Sbjct: 192 HFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAPDGSQS 251

Query: 212 LSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXV 271
           L+SY +K++LKIQN+LL+SQD  LTPLQ++IVDP+F                        
Sbjct: 252 LNSYFIKQRLKIQNDLLDSQDK-LTPLQKQIVDPMFQYQDLLYEYEDYDKETEYRDLY-A 309

Query: 272 LHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKS 331
           LHVLNHIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIVAPTRD AY I+SK+I+KS
Sbjct: 310 LHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKS 369

Query: 332 GLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQ 391
           GLDQVDKK+K +DQFF++ LPPS KPKSF+  FKGNTNDFFVLG KFTRK I+LYSNFYQ
Sbjct: 370 GLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQ 429

Query: 392 SDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKI 451
           SD+I+CSPLG+QLILENTD+KKRQDDFLSSIEL+++DQL+SIEFQN+ HL +IF H+NKI
Sbjct: 430 SDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKI 489

Query: 452 PKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQIT 511
           P++QHD DF R++MWYIN+QAKL RQTLIFT++ +P AN L+NGKCRN  GRWKNH  I 
Sbjct: 490 PQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIF 549

Query: 512 GEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI 571
            E SS+ +LG R R IFQR DL G SV +EPD RF+ F SVIVP+I KSTGYEDGILLYI
Sbjct: 550 PENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYI 609

Query: 572 PDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRY 631
           PDY DF+RVRNYL++KTTILFGDINEYS+ RQLTS R++FQQGR+KVLLYTERLHHFRRY
Sbjct: 610 PDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRY 669

Query: 632 EIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVS 691
           EIKGVK+VIFY+PP+NPEF+ EV RY+GKSAFLG  DLNIS VRC++SKLDGL+LERIV 
Sbjct: 670 EIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVG 729

Query: 692 SKRAAVLTHGQNEIYEFK 709
           ++RAAVLTHG NE YEFK
Sbjct: 730 TERAAVLTHGPNETYEFK 747

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 15 SRKRGRKDLRSIRRARNDKEPV-EEPEIPVAXXXXXXXXXXXXXXATNEVQEQEDSKEKA 73
          S K GRK LR+IR+A   +  + EE                      NE  + + +  +A
Sbjct: 19 SSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELNEPAQDQRAGGEA 78

Query: 74 YGALLTILKSEH 85
          Y ALLT+LK+EH
Sbjct: 79 YAALLTLLKAEH 90

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/558 (65%), Positives = 454/558 (81%), Gaps = 3/558 (0%)

Query: 155 HFNMQSESI-DSLDEAWKQKKIVNKSGKIRVDDDESLIYT--KTLAGKGQEFELPSHKGH 211
           HFN  +E   +   +A+K K+I  +S K ++++ ES IY+  + L  +  + + P  K  
Sbjct: 162 HFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSS 221

Query: 212 LSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXV 271
           + SY LK++LKI N+LL+   + LT +Q+++VDP+F                        
Sbjct: 222 IHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYC 281

Query: 272 LHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKS 331
           LHVLNHIYKTRDRILK+N ++  NPD EFLDQGFTRPKVLIVAPTRD  Y IV+++I+KS
Sbjct: 282 LHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKS 341

Query: 332 GLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQ 391
           G+DQ+DKKSK RDQF+E+ L P+SKPKSF+  FKGN+ND+FVLG+KFTRKAI+LYSNFYQ
Sbjct: 342 GIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQ 401

Query: 392 SDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKI 451
           SD+IVCSPLGL +ILENTD+KKRQDDFLSSIELMIIDQL+S+EFQN+SH+ +IF H+NKI
Sbjct: 402 SDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKI 461

Query: 452 PKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQIT 511
           PKEQHDTDF R++MWYIN+QAKL RQT+IFT+Y++P+ANF LNGKC+N  GRWKNH  IT
Sbjct: 462 PKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMIT 521

Query: 512 GEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI 571
             +SS+ +LG RV+Q+F R D+ G S+VDEPDYRF++FTSVIV SITKST YEDG+L+YI
Sbjct: 522 PNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYI 581

Query: 572 PDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRY 631
            DY D++RVRNYLK+KTTILFGDINEYSD +Q+ S R+LFQQ R+KVLLYTERLHHFRRY
Sbjct: 582 TDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRY 641

Query: 632 EIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVS 691
           EIKGVK+++FY+ P+NPEFYNEVVRYIGK+AF G+TD+NIS VR +YSKLDGLALERI+ 
Sbjct: 642 EIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMG 701

Query: 692 SKRAAVLTHGQNEIYEFK 709
           +KRAAVLTHGQNE YEFK
Sbjct: 702 TKRAAVLTHGQNETYEFK 719

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 13 DGSRKRGRKDLRSIRRARNDKE-PVEEPEI---PVAXXXXXXXXXXXXXXATNEVQEQED 68
          +G  KRGR   RSI+++   K    E+  I    +                  EV E  +
Sbjct: 12 EGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLE 71

Query: 69 SKEKAYGALLTILKSEH 85
           K++ Y AL+TILKSEH
Sbjct: 72 KKKQVYDALVTILKSEH 88

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/559 (67%), Positives = 449/559 (80%), Gaps = 7/559 (1%)

Query: 155 HFNMQSE-SIDSLDEAWKQKKIVNKSGKIRVDDDESLIYTK---TLAGKGQEFELPSHKG 210
           HFN   E   D+LD+A+K K++  +S KI++  +E  IY++    L  +    ++P    
Sbjct: 172 HFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESR-TPIQVPQGTQ 230

Query: 211 HLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXX 270
            LS Y +K++LKIQN+LL+S+++ LTPLQ+KIVDPIF                       
Sbjct: 231 SLSPYFIKQRLKIQNDLLDSKNN-LTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLY- 288

Query: 271 VLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEK 330
            LH L+HIYKTRDRILK+NQRL  NPD E LDQGFTRPKVLIV PTRD AY ++SK+IEK
Sbjct: 289 ALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEK 348

Query: 331 SGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFY 390
           SGLDQVDKKSK RDQF++D LPP  KPKSF+  FKGNTNDFFVLG KFTRK I+LYSNFY
Sbjct: 349 SGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFY 408

Query: 391 QSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNK 450
           QSD+IVCSPLG+QLILENTD+KKRQDDFLSSIEL++IDQL+SIEFQNV HL +IF H+NK
Sbjct: 409 QSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINK 468

Query: 451 IPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQI 510
           IP++QHD DF R++MWYIN+QAKL RQTLIFTR+ TP AN L+NGKCRN  GRWKNH  +
Sbjct: 469 IPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIV 528

Query: 511 TGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLY 570
             E+SS+S+LG R R +FQR D+ G +  DEPD+RF+ F SVIVP+I +STGYEDGILLY
Sbjct: 529 GAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLY 588

Query: 571 IPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRR 630
           IPDY DFIRVRNYL++KTTILFGDI+EYS+ RQLT+ R+LFQQGR+KVLLYTERLHHFRR
Sbjct: 589 IPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRR 648

Query: 631 YEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIV 690
           YEIKGVK+VIFY+PP+NPEF+ E VRY+ KSAFLG  DLNIS VRC+YSKLDGLALERIV
Sbjct: 649 YEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIV 708

Query: 691 SSKRAAVLTHGQNEIYEFK 709
            ++RAA+LTHG NE YEFK
Sbjct: 709 GTERAAILTHGPNETYEFK 727

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 45/91 (49%), Gaps = 15/91 (16%)

Query: 3  KRTGNGTDAIDGSR--KRGRKDLRSIRRA------RNDKEPVEEPEIPVAXXXXXXXXXX 54
          KR     D  DG +  K GRK LRSIR+A      + + EPVE PE  +           
Sbjct: 5  KRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEI-------NEVE 57

Query: 55 XXXXATNEVQEQEDSKEKAYGALLTILKSEH 85
                 EV  +++S  +AY ALLT+LK+EH
Sbjct: 58 DVHEERTEVSRKQESNGEAYAALLTLLKAEH 88

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/565 (65%), Positives = 450/565 (79%), Gaps = 10/565 (1%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKS-----GKIRVDDDESLIYTKTLAGKGQEFEL--- 205
           HFN   E+ I++LD A+K K++  +S      K+    DE LIY++     G++      
Sbjct: 157 HFNQFPETEINTLDAAFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLI 216

Query: 206 -PSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXX 264
             + K  + SY LK++LKIQN+LLE++ D L  +Q+++VDP+F                 
Sbjct: 217 ESNTKCSIGSYFLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSED 276

Query: 265 XXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIV 324
                  LH LNH+YKTRDRILK+NQRL  N D E LDQGFTRPKVLI+APTRDTAY IV
Sbjct: 277 EYRQLYALHALNHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIV 336

Query: 325 SKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIR 384
           + +I KSG+DQVDK+ K +DQF+ED LPPSSKPKSF+  FKGNTNDFFVLG+KFTRKAI+
Sbjct: 337 TTIINKSGIDQVDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIK 396

Query: 385 LYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTI 444
           LYSNFYQSD+IVCSPLGLQ+I+ENTD+KKRQDDFLSSIE+ IIDQL+SIE+QN+SHL+TI
Sbjct: 397 LYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTI 456

Query: 445 FAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRW 504
           F H+N IP EQHD DF R+RMWYIN+QA+  RQT++FT+Y++PTAN ++NGKCRN  GRW
Sbjct: 457 FEHLNNIPDEQHDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRW 516

Query: 505 KNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYE 564
           KNH  ++ E S + KL  RVRQIFQR ++ G S+VDEPDYRF+FFTSVI+P I KSTGYE
Sbjct: 517 KNHRIVSNEASHIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYE 576

Query: 565 DGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTER 624
           DGIL+YIP+Y D++RVRNYLK+KT ILFGDINEYS  +QLT+ RSLFQQGR+KVLLYTER
Sbjct: 577 DGILIYIPEYTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTER 636

Query: 625 LHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGL 684
           LHH+RRYEIKGVKSVIFY+PPS+PEFY EVVR IG++AFLG+TDLNISTVRC+YSKLD L
Sbjct: 637 LHHYRRYEIKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDAL 696

Query: 685 ALERIVSSKRAAVLTHGQNEIYEFK 709
           ALE +V ++RA VL HGQNEIYEFK
Sbjct: 697 ALENVVGTQRAGVLCHGQNEIYEFK 721

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 15 SRKRGRKDLRSIRRARN---------DKEPVEEPEIPVAXXXXXXXXXXXXXXATNEVQE 65
          S KRGRK+LR ++R            +  PVE+  +  A               ++   +
Sbjct: 5  SGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSD--SD 62

Query: 66 QEDSKEKAYGALLTILKSEHP 86
           E  K K YGALLTILKSEHP
Sbjct: 63 AEARKGKVYGALLTILKSEHP 83

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/709 (56%), Positives = 486/709 (68%), Gaps = 19/709 (2%)

Query: 12  IDGSRKRGRKDLRSIRRA-----RNDKEPVEEPEIPVAXXXXXXXXXXXXXXATNEVQEQ 66
           I    K GRK LR I RA     R D E       P                   E ++ 
Sbjct: 4   IRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTP----DNESDSDNAEPSVAAEREDV 59

Query: 67  EDSKEKAYGALLTILKSEHPXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXVEANL 122
           E  + +AY ALLT+LKSEHP                                   +E  L
Sbjct: 60  EQHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENAL 119

Query: 123 VDTPGXXXXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSES-IDSLDEAWKQKKIVNKSGK 181
            D  G                           HF+  SES + + D+ +K K +  KS K
Sbjct: 120 DDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSK 179

Query: 182 IRVDDDESLIYTKTLAGKGQEFELP-SHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQR 240
             V ++ESLIY+K       E  LP   K  LSSY +K+KLK+ N+  ++    LT +Q+
Sbjct: 180 TDVSEEESLIYSKPCLD--DEEVLPVKGKQTLSSYFIKQKLKLANDF-QNNGLPLTEIQK 236

Query: 241 KIVDPIFXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEF 300
           ++VDP+F                        LH LNH+YKTRDRILK+NQ+L  N D E 
Sbjct: 237 ELVDPMFQYKDMLYEYDDYADEDQYRDLYS-LHALNHVYKTRDRILKNNQKLQENNDEEL 295

Query: 301 LDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSF 360
           LDQGFTRPKVLIV PTRD A++IV K++EKSGLDQ DKKSK  DQFFED LPP+SKPKSF
Sbjct: 296 LDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSF 355

Query: 361 RHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLS 420
           +H F+GNTNDFFVLG+KFTRK++++YSNFYQSD+I+CSPLG+QLILENTD+KKRQDDFLS
Sbjct: 356 QHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLS 415

Query: 421 SIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLI 480
           SIE+MIIDQL+SIE+QN  H+ TIF H+NKIP++Q + DF R+RMWYINEQAK  RQT++
Sbjct: 416 SIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIV 475

Query: 481 FTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVD 540
           FT+Y++P AN +LNGKCRN+ GRWKNH +I  EQSS+ +LG +VRQIFQR DL G + +D
Sbjct: 476 FTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALD 535

Query: 541 EPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSD 600
           EPDYRF+FFTSVIVPSI KSTGYEDGILLYIPDY DFIRVRNYLK+KTTI+FG+INEYS+
Sbjct: 536 EPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSN 595

Query: 601 VRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGK 660
            +QLTS R+ FQ G++KVLLYTERLHHFRRYEIK VKSVIFY+PP NPEFY+EVVR IGK
Sbjct: 596 QKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGK 655

Query: 661 SAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
           + FLG+ D+NISTVRC+YSK+DGL+LER+V SKRAAVL HGQNE+YEFK
Sbjct: 656 NVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/560 (65%), Positives = 451/560 (80%), Gaps = 5/560 (0%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTK-TLAGKGQEFELPSHKGH- 211
           HFN  +E  +D L  A++ ++I  K+ KI +DD  S+I +K T+ G+  E    S   H 
Sbjct: 180 HFNKPTEQFVDKLHAAFESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHG 239

Query: 212 --LSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXX 269
             + SY +K++LKIQNNLL  + D LTPLQ++++DP+F                      
Sbjct: 240 QSIFSYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDL 299

Query: 270 XVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIE 329
             LH LNH+YKTRDRILK+NQRL  N D E+LDQGFTRPKVLIV PTRDTAY++  K+I+
Sbjct: 300 YALHALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIK 359

Query: 330 KSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNF 389
           KSGLDQVDKK K  DQF +D LPPSSKPKSF+  FKGNTNDFFVLG+KFTRKAI+LYSNF
Sbjct: 360 KSGLDQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNF 419

Query: 390 YQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMN 449
           YQSD+IVCSPLG+Q+I+ENTD+KKRQDDFLSSIEL+I+DQL+S+E+QN++H+FTIF H+N
Sbjct: 420 YQSDIIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLN 479

Query: 450 KIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQ 509
           KIP EQHD DF R+RMWYIN+QAKL RQT++FT+YV+P AN ++N +CRN  GRWKNH  
Sbjct: 480 KIPTEQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKI 539

Query: 510 ITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILL 569
           +  E SS+ KLG +++QIFQR D+ G S+VDEPDYRF+ FTSVI+PSI KST Y+DGIL+
Sbjct: 540 VAPEVSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILI 599

Query: 570 YIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFR 629
           YIPDY D++R+RNYLK+KT ILFGDINEYS+ R+L S RSL QQGR+KVLLYTERLHH+R
Sbjct: 600 YIPDYTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYR 659

Query: 630 RYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERI 689
           RYEIKGVKSV+FY+PP+NPEFYNEVVR+IGK+AFLG+TDLNISTVR VY KLDGL+LERI
Sbjct: 660 RYEIKGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERI 719

Query: 690 VSSKRAAVLTHGQNEIYEFK 709
           V +KRA +L H QNE+YEFK
Sbjct: 720 VGTKRAGILCHAQNEVYEFK 739

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 3   KRTGNGTDAIDGSRKRGRKDLRSIRRA-----RNDKEPVEEPEIPVAXXXXXXXXXXXXX 57
           K++    ++ D  RKRGR++LR+IRR+     R D    E  +                 
Sbjct: 12  KKSYKSNNSNDHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEE 71

Query: 58  XATNEVQ--EQEDSKEKAYGALLTILKSEHP 86
              +E +  ++++ K K YGALLTIL++EHP
Sbjct: 72  DDQSEQEEVDEDERKGKVYGALLTILETEHP 102

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/560 (64%), Positives = 448/560 (80%), Gaps = 5/560 (0%)

Query: 155 HFNMQSE-SIDSLDEAWKQKKIVNKSGKIRVDDDESLIYT-KTLAGKG---QEFELPSHK 209
           HFN  SE + D L+ A+    +  KS K  + D++++I +  T+ GK    +E +     
Sbjct: 164 HFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKS 223

Query: 210 GHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXX 269
             + SY LK++L++ N++L+S+ D L PLQ+++VDP+F                      
Sbjct: 224 SSIHSYFLKQRLRVANDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDL 283

Query: 270 XVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIE 329
             LH LNH+YKTRDRILKDN RL  N D E+ DQGFTRPKVLIV PTRDTAY+++SK+I 
Sbjct: 284 YALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIIS 343

Query: 330 KSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNF 389
           KSGLDQVDKK K  DQF ++ LPPSSKPKSF+H FKGNTNDFFVLGVKFTRKAI+LYSNF
Sbjct: 344 KSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNF 403

Query: 390 YQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMN 449
           YQSD+IVCSPLG+Q+I+ENTD+K RQDDFLSSIE++IIDQL+SIE+QN++H+FTIF H+N
Sbjct: 404 YQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLN 463

Query: 450 KIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQ 509
           KIP++QH+ DF R+RMWYIN+QA+L RQT+IFT+YVTP AN L+N +CRN  GRWKNH  
Sbjct: 464 KIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEI 523

Query: 510 ITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILL 569
           I  E S++S+LG +V+Q FQR D+ G SV+DEPDYRF+ F+SVI+PSI KST Y DGIL+
Sbjct: 524 IEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILI 583

Query: 570 YIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFR 629
           YIPDY D++R+RNYLK+KTT+LFGDINEYS+ R+L S RSLFQQGR+KVLLYTERLHH+R
Sbjct: 584 YIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYR 643

Query: 630 RYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERI 689
           RYE+KGVKSV+FY+PP+NPEFYNEVVRYIGKSAFLG+ DLNISTVR +Y KLDGL+LERI
Sbjct: 644 RYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERI 703

Query: 690 VSSKRAAVLTHGQNEIYEFK 709
           V SKRA +L H QNE+YEF+
Sbjct: 704 VGSKRAGILCHAQNEVYEFQ 723

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 1/86 (1%)

Query: 1  MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVAXXXXXXXXXXXXXXAT 60
          M KR+  G+    GS+KRGR++LR+IRR+   K   +E                      
Sbjct: 1  MSKRSHEGSQHA-GSKKRGRQELRTIRRSAGAKVSSQEVFNSSIVDDEEQELNESNESEQ 59

Query: 61 NEVQEQEDSKEKAYGALLTILKSEHP 86
           E  ++E+ K K YGALLTILKSEHP
Sbjct: 60 EEDIDEEEKKNKVYGALLTILKSEHP 85

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 449/558 (80%), Gaps = 3/558 (0%)

Query: 155 HFNMQSES-IDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQE--FELPSHKGH 211
           HFN  S+  +D +   +K K+I  KS K  +D  ES I+ K L    Q+   + P     
Sbjct: 147 HFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSS 206

Query: 212 LSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXV 271
             SY +K++LKIQN+LL+S  + LTPL++K++DP+F                        
Sbjct: 207 YDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYS 266

Query: 272 LHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKS 331
           LHVLNHIYKTRD+ILKDNQRL  N D E LDQGFTRPKVLIV PTRDTAYQ+V  +IEKS
Sbjct: 267 LHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKS 326

Query: 332 GLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQ 391
           GLDQ+DKK K +DQFF+D LPP+SKPKSFRH FKGNTNDFFVLG+KFTRKAI+LYSNFYQ
Sbjct: 327 GLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQ 386

Query: 392 SDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKI 451
           SD+I+CSPLG+Q+ILENTD+KKRQDDFLSSIE+MI+DQL+SIE+QN+SH++TI  H+NKI
Sbjct: 387 SDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKI 446

Query: 452 PKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQIT 511
           P++Q + DF R+RMWYIN+QAK LRQT++FTRY++PTAN ++NGKC N+ GRWKN+  I+
Sbjct: 447 PQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIIS 506

Query: 512 GEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI 571
            E SS+ +LG +++QIFQR DL G +VVDE DYRF++FTSV++ +I KSTGYEDGIL+YI
Sbjct: 507 SEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYI 566

Query: 572 PDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRY 631
           P+Y D++R+RNY+K+KTTILF +INEYS  +QL S RS+FQQGR KVLLYTERLHH+RRY
Sbjct: 567 PEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRY 626

Query: 632 EIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVS 691
           E+KG+KSVIFY+PP+NPEFYNEV+R+  K+AFLG +D+NIST+R VYSKLDGLAL+RIV 
Sbjct: 627 ELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVG 686

Query: 692 SKRAAVLTHGQNEIYEFK 709
           SKRAA+L HGQNE Y+FK
Sbjct: 687 SKRAAILCHGQNESYDFK 704

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 14/92 (15%)

Query: 1  MVKRTGNGTDAIDGSRKRGRKDLRSIRR------ARNDKEPVEEPEIPVAXXXXXXXXXX 54
          M + +G      +G +KRGR +LRSIRR      +++D++ V E E              
Sbjct: 1  MARHSGTS----EGPKKRGRTELRSIRRPNRSQHSKHDQQVVHESE---NEDSLESSSDD 53

Query: 55 XXXXATNEVQEQEDSKEKAYGALLTILKSEHP 86
              A  E  E  D KEK YGALLTIL SEHP
Sbjct: 54 DEDIAQAEA-ENSDRKEKVYGALLTILNSEHP 84

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/706 (55%), Positives = 482/706 (68%), Gaps = 14/706 (1%)

Query: 17  KRGRKDLRSIRR-ARNDKEPVEEPEIPVAXXXXXXXXXXXXXXATNEVQEQEDSKEKA-- 73
           KRGRK LR I R  RN  E                          +E    +D +E+   
Sbjct: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAH 63

Query: 74  -YGALLTILKSEHPX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEANLVDTPGXX 129
            YGALL+IL S HP                                  + A+L D+    
Sbjct: 64  VYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLDDSVDKD 123

Query: 130 XXXXXXXXXXXXXXXXXXXXXXXXXHFNMQSE-SIDSLDEAWKQKKIVNKSGKI-RVDDD 187
                                    HFN  SE   + LD A+K+K +  +S K+  + D+
Sbjct: 124 EEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHDN 183

Query: 188 ESLIYTKT----LAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIV 243
           E  I++K     L G     + P  KG++ SY +K+KLK+ N LL+ +   LTPL + +V
Sbjct: 184 EGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTLV 243

Query: 244 DPIFXXXXXXXXXXXXXXXXXXXXXXXVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQ 303
           DPIF                        LH+LNHIYKTRDRILK+N +L  N D E LDQ
Sbjct: 244 DPIFQYRDLLFEYEDFSQETEYRDLY-TLHILNHIYKTRDRILKNNHKLQENDDQELLDQ 302

Query: 304 GFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHT 363
           GFTRPKVL+VAPTR+TAY I+ K+I+KSGLDQVDKKSK +DQF+ED LPP+SKPKSF+H 
Sbjct: 303 GFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHV 362

Query: 364 FKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIE 423
           FKGNTNDFFVLG+KFTRK ++LYSNFYQSD+IVCSPLG+QLILENTD+KKRQDDFLSSIE
Sbjct: 363 FKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIE 422

Query: 424 LMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTR 483
           ++++DQL+S+EFQN +H+ +IF H+NKIP++QHD+DF R+RMWYIN+QA+L RQTLIFT+
Sbjct: 423 MLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTK 482

Query: 484 YVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPD 543
           YV+P AN L+NGKC N  GR+KN   I+ E+S++++LG +VRQ+F R DL   S VDEPD
Sbjct: 483 YVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPD 542

Query: 544 YRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQ 603
           YRF+FFTSV VP I KSTGYEDGILLYIPDY DF+RVRNY KD+T ILFG+I EYSD RQ
Sbjct: 543 YRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQ 602

Query: 604 LTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAF 663
           +TS R+LFQQG++KVLLYTERLHHFRRY+IKGVKSVIFY+PPSNPEFY E++R IGK+AF
Sbjct: 603 VTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAF 662

Query: 664 LGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709
           LG+ DLNISTVRC Y KLD L+LERIV SKRAAVLT  QNEIYEFK
Sbjct: 663 LGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/560 (63%), Positives = 447/560 (79%), Gaps = 6/560 (1%)

Query: 155 HFNMQSESI-DSLDEAWKQKKIVNKSGKIRVDDDES--LIYTKTLA--GKGQEFELPSHK 209
           HFN   E++ D +   +  KKI   S KI++   E    IY+K +   G   + E P  K
Sbjct: 158 HFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKK 217

Query: 210 GHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXX 269
             L SY +K++L+I NNLL+ +D+ LT LQ+ +VDP+F                      
Sbjct: 218 SSLDSYFIKKRLEITNNLLDGKDN-LTKLQKSLVDPMFQYVDILHEYENYGSDEQEYREL 276

Query: 270 XVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIE 329
             LH+LNH+YKTRD++LKDNQRL  N + EFLDQGFTRPKVLIV PTRDTAY +V  +I 
Sbjct: 277 YTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIR 336

Query: 330 KSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNF 389
           KSGLDQV+KK K + QFFED LPPSSKPKSF+  FKGNTNDFFVLG+KFTRKA++LYSNF
Sbjct: 337 KSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNF 396

Query: 390 YQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMN 449
           YQSD+I+CSPLGL +I ENTD+KK+QDDFLSSIE+ I+DQL+S+E+QN+SH+  IF H+N
Sbjct: 397 YQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLN 456

Query: 450 KIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQ 509
           KIP+EQHD DF R+RMWYIN+QA+L RQT+IFT+YV+PTAN ++NGKCRNI GRW+N  Q
Sbjct: 457 KIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQ 516

Query: 510 ITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILL 569
           +T E+SS+ KLG ++RQIFQR DL G ++ DEPD+RF+FF SV++ SI KSTGYEDGIL+
Sbjct: 517 LTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILV 576

Query: 570 YIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFR 629
           YIP+Y+D++RVRNY+K+KTT+LFGDINEYSD R+L S RSLFQQGR+KVLLYTERLHH+R
Sbjct: 577 YIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYR 636

Query: 630 RYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERI 689
           RYEIKGVKSVIFY PP+NPEFYNEVVR+IGK+AFLG+ D+NI+TVR VYSKLD L+LERI
Sbjct: 637 RYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERI 696

Query: 690 VSSKRAAVLTHGQNEIYEFK 709
           V ++RAAVL+  +NE+YEFK
Sbjct: 697 VGTQRAAVLSRAENEVYEFK 716

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 16 RKRGRKDLRSIRRARNDKEPVEEPEIPVAXXXXXXXXXXXXXXATNEVQ-EQEDSKE--- 71
          +KRGR  LR+I+R++  K+                        +  E + E +D+K+   
Sbjct: 8  KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEED 67

Query: 72 ------KAYGALLTILKSEHP 86
                + YGALLTILKSEHP
Sbjct: 68 VGKKRNQVYGALLTILKSEHP 88

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/558 (62%), Positives = 437/558 (78%), Gaps = 5/558 (0%)

Query: 155 HFN-MQSESIDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAG-KGQEFELPSHKGHL 212
           HFN + +  +  LD A+K  +   +  K     +E ++Y+K +A  +G E  +      L
Sbjct: 149 HFNRVSAADVAQLDAAFKNGRAQYRVQK-EARGEEEILYSKPVASSEGTEGPVRVPARSL 207

Query: 213 SSYPLKRKLKIQNNL-LESQDDVLTPLQRKIVDPIFXXXXXXXXXXXXXXXXXXXXXXXV 271
             Y +K++L++ N L  +  +  LTP Q+ ++DP+F                        
Sbjct: 208 RGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELY-T 266

Query: 272 LHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKS 331
           LH+LNH+YKTRDRILK+NQ+L  NPD E LDQGFTRPK L+V PTR TAY +V  ++++S
Sbjct: 267 LHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQS 326

Query: 332 GLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQ 391
           G++QVDKKSK +DQF++  LPP+SKPKSF+H FKGNTNDFFVLG+KFTRKAIRLYSNFYQ
Sbjct: 327 GIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQ 386

Query: 392 SDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKI 451
           SD+IVCSPLGLQLI+ENTD+KKRQDDFLSSIE+M++DQL+SIEFQN++H+  IFAH+NKI
Sbjct: 387 SDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKI 446

Query: 452 PKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQIT 511
           P++Q D DF R+RMWYI +QAKL RQT++FTRY++P AN LLN KC N  GR K+H  ++
Sbjct: 447 PQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVS 506

Query: 512 GEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI 571
            E+S + +LG ++RQIFQR ++ G S VDEPD+RF+FFTSV+VP I K+TGY+ GILLYI
Sbjct: 507 AEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYI 566

Query: 572 PDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRY 631
           P+Y DFIRVRNYLKDKT ILFGDINEYSD RQLTS R+LFQ GRIKVLLYTERLHHFRR+
Sbjct: 567 PEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRF 626

Query: 632 EIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVS 691
           E+KGVKSVI Y+PPSNPEFY E++RYIGKSAFLG  DLNI+TVRC+YSK+D LALERIV 
Sbjct: 627 ELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVG 686

Query: 692 SKRAAVLTHGQNEIYEFK 709
           +KRAAVLTHGQNE+YEFK
Sbjct: 687 TKRAAVLTHGQNEVYEFK 704

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 94/207 (45%), Gaps = 43/207 (20%)

Query: 474 LLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDL 533
           L +QTL+FT  ++ +   + NG  RN G        I G  S+      +++QI + V  
Sbjct: 347 LEKQTLMFTATMSSSIERIANGYLRNPG-----FVTIGGSGSAP-----QIQQIIEYV-- 394

Query: 534 GGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDY---ADFI--RVRNYLKDKT 588
                 DE   RF+  T  I+P+      Y   ++++I +Y   AD++  + +   K + 
Sbjct: 395 ----ATDE--QRFKMLTQDILPN------YRPPVIIFI-NYKVTADWLLRKFQEESKFRV 441

Query: 589 TILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNP 648
           TIL G  ++      L +    F++G++ +++ T+     R  +I  V  V+ +Q PS  
Sbjct: 442 TILHGSKSQTQREHSLKA----FREGKVDIMVATDVAG--RGIDIPNVSLVVNFQMPSKL 495

Query: 649 EFYNEVVRYIGKS-------AFLGDTD 668
           + Y   +   G++        FLGD D
Sbjct: 496 DDYIHRIGRTGRANQKGTTLTFLGDKD 522

>KLLA0F17435g Chr6 complement(1596081..1599896) [3816 bp, 1271 aa]
            {ON} similar to uniprot|Q04217 Saccharomyces cerevisiae
            YMR128W ECM16 Essential DEAH-box ATP-dependent RNA
            helicase specific to the U3 snoRNP predominantly
            nucleolar in distribution required for 18S rRNA synthesis
          Length = 1271

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 63/146 (43%), Gaps = 18/146 (12%)

Query: 434  EFQNVSHLFTIFAHMNKIPKEQHDTDFGR--VRMWYINEQAKLLRQTLIFTRYVTPTANF 491
            +F +V  L +  + ++ IPK+QH +   +  +R   + E  KL +Q +   R VT   N 
Sbjct: 1003 KFSDVFRLLSAVSALDFIPKDQHSSFMEKNFLRAKTVEEIMKLRKQVMFIIRSVTSRENV 1062

Query: 492  LLNGKCRNIGGRWKNHHQITGEQSSVS-----KLGFRVRQIF-QRVDLGGASVVDEPDYR 545
             +N K  ++        QI   +  ++     ++  R  Q+F + V +   ++ + P   
Sbjct: 1063 AVNVKDEDLKSSIPTDVQIKLLKQMITAGFIDQVAVRADQLFPEDVTINKTNIFNIP--- 1119

Query: 546  FRFFTSVIVPSITKSTGYEDGILLYI 571
                    VP + + T   D I +YI
Sbjct: 1120 -------YVPVLAEKTSSLDDIFVYI 1138

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 81/194 (41%), Gaps = 34/194 (17%)

Query: 476 RQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGG 535
           RQTL+FT  +TP    +  G  R      K  +   G  +    L   ++QI +      
Sbjct: 388 RQTLMFTATMTPVIEKIAAGYMR------KPVYATIGVDTGSEPL---IQQIVE------ 432

Query: 536 ASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI--PDYADFI--RVRNYLKDKTTIL 591
               D  + +F+   S++       T YE  I+++I     AD++  R +     + TIL
Sbjct: 433 --YADNEEQKFKKLKSIV-------TKYEPPIIIFINYKQTADWLAERFQKETNMRVTIL 483

Query: 592 FGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFY 651
            G  ++     Q   +  LF+ GR++V++ T      R  +I  V  V+ +Q     + Y
Sbjct: 484 HGSKSQ----EQREHSLQLFRSGRVQVMIATNVAA--RGLDIPNVSLVVNFQISKKIDDY 537

Query: 652 NEVVRYIGKSAFLG 665
              +   G++A  G
Sbjct: 538 IHRIGRTGRAAKKG 551

>NDAI0F02670 Chr6 complement(652448..656332) [3885 bp, 1294 aa] {ON}
           Anc_2.176 YNL102W
          Length = 1294

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 24/74 (32%)

Query: 322 QIVSKVIEKSGLDQVDKKSKLRDQFFE------------------------DVLPPSSKP 357
           +IV  ++EK GLD +  K + +   FE                        D++PP    
Sbjct: 235 EIVPLLLEKYGLDNIRAKPEKKKYAFELPDIPHEANYLKVLMPFNTPKSSNDLIPPDLSS 294

Query: 358 KSFRHTFKGNTNDF 371
            +F H F GNTN F
Sbjct: 295 DTFSHVFGGNTNIF 308

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 76/180 (42%), Gaps = 34/180 (18%)

Query: 468 INEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQI 527
           +N  +   RQTL+FT  +TP    +  G  R      K  +   G  +    L   +RQ+
Sbjct: 363 VNVDSATNRQTLMFTATMTPVIEKIAAGYMR------KPVYATIGLDTGSEPL---IRQV 413

Query: 528 FQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYI--PDYADFI--RVRNY 583
            +          D  + +F+   SV++        YE  I+++I     AD++  R +  
Sbjct: 414 VE--------YADNEEEKFKKLKSVVIK-------YESPIIIFINYKQTADWLAERFQTE 458

Query: 584 LKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQ 643
              K TIL G  ++     Q   +  LF+ G++++++ T      R  +I  V  V+ +Q
Sbjct: 459 TNMKVTILHGSKSQ----EQREHSLQLFRTGKVQIMIATNVAA--RGLDIPNVSLVVNFQ 512

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 6/115 (5%)

Query: 558 TKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIK 617
           T S   E  IL++         V  YL++        I+   D R+       F+ GR  
Sbjct: 356 TASQDQESKILIFASTKRTCDEVTKYLREDGWPALA-IHGDKDQRERDWVLEEFRSGRSP 414

Query: 618 VLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNIS 672
           +++ T+     R  ++KG+  VI Y  P N E Y   V  IG++   G T   IS
Sbjct: 415 IMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 464

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 6/109 (5%)

Query: 564 EDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTE 623
           E  IL++         +  YL+D        I+   D R+     + F+ GR  +++ T+
Sbjct: 356 ESKILVFASTKRTCDEITKYLRDDGWPALA-IHGDKDQRERDWVLNEFRTGRSPIMVATD 414

Query: 624 RLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNIS 672
                R  ++KG+  VI Y  P N E Y   V  IG++   G T   IS
Sbjct: 415 VAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 458

>ZYRO0C01034g Chr3 complement(71256..72758) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q08750 Saccharomyces cerevisiae
           YOR298W MUM3 Protein of unknown function involved in the
           organization of the outer spore wall layers
          Length = 500

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 435 FQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLN 494
           F+N   L   FA++N + + QH+T F   + ++ N   KL+ +T               +
Sbjct: 285 FRNFISLIKCFANINHVKRRQHNTLFDHAKFFFENGMDKLIYKTSA-------------H 331

Query: 495 GKCRNIGGRWKNHHQITGEQSSV 517
           GK R+ G    N   I G  +S+
Sbjct: 332 GKQRDAGQEQANAAMIVGLPNSL 354

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,940,671
Number of extensions: 2883585
Number of successful extensions: 7817
Number of sequences better than 10.0: 35
Number of HSP's gapped: 7961
Number of HSP's successfully gapped: 53
Length of query: 709
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 592
Effective length of database: 40,065,477
Effective search space: 23718762384
Effective search space used: 23718762384
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)