Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01958g2.290ON26326313170.0
TDEL0G022002.290ON2612638621e-116
NCAS0B062402.290ON2602617991e-107
KLTH0G10450g2.290ON2612647771e-104
SAKL0E07590g2.290ON2602377571e-101
YIL093C (RSM25)2.290ON2642677561e-100
Kpol_1003.402.290ON2612637551e-100
KAFR0J013502.290ON2642437456e-99
Skud_9.802.290ON2642667413e-98
Suva_9.1062.290ON2642677413e-98
Smik_9.862.290ON2642427403e-98
NDAI0B035402.290ON2612567386e-98
CAGL0D04158g2.290ON2722417283e-96
TBLA0B059602.290ON2662477241e-95
Kwal_27.115092.290ON2612647231e-95
Ecym_33292.290ON2582647055e-93
KNAG0A054102.290ON2662666892e-90
TPHA0C034202.290ON2682496874e-90
KLLA0E08273g2.290ON2612616804e-89
ADL211C2.290ON2251795367e-68
NCAS0C025508.472ON127880730.92
NCAS0A015705.272ON817129711.8
TDEL0B013808.499ON40445667.2
ZYRO0A13816gsingletonON22492648.0
SAKL0G03520g5.473ON36947658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01958g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   511   0.0  
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   336   e-116
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   312   e-107
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   303   e-104
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   296   e-101
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   295   e-100
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   295   e-100
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   291   6e-99
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   290   3e-98
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   290   3e-98
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   289   3e-98
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   288   6e-98
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   285   3e-96
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   283   1e-95
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   283   1e-95
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   276   5e-93
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   270   2e-90
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   269   4e-90
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   266   4e-89
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   211   7e-68
NCAS0C02550 Chr3 complement(477327..481163) [3837 bp, 1278 aa] {...    33   0.92 
NCAS0A01570 Chr1 complement(309025..311478) [2454 bp, 817 aa] {O...    32   1.8  
TDEL0B01380 Chr2 complement(244071..245285) [1215 bp, 404 aa] {O...    30   7.2  
ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa] ...    29   8.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...    30   8.3  

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/263 (94%), Positives = 249/263 (94%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
           KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML
Sbjct: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120

Query: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMXX 180
           VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRM  
Sbjct: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQE 180

Query: 181 XXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240
                       MFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG
Sbjct: 181 EIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240

Query: 241 QEKQEGEPNKSDEDGQETEELHL 263
           QEKQEGEPNKSDEDGQETEELHL
Sbjct: 241 QEKQEGEPNKSDEDGQETEELHL 263

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  336 bits (862), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 202/263 (76%), Gaps = 2/263 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVLERTSAYLRSGLLR TPAWY VVAS+PP TKFTRE R INPS  KK    
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
           K+  +  N KGF+KTR S+ D+K  +++LY+APKL+F+EDQLREVFY+QHPWE SRPK+L
Sbjct: 61  KDHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKVL 120

Query: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMXX 180
           VEN+  E FDWS++ QL KPLDGESV+QRT++LL+ +    + +AYD+ RFEFYRLRM  
Sbjct: 121 VENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQQ 180

Query: 181 XXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240
                       MFGS++  SAID+GV+QEQ+ ID+WKQKAIEET+LLAARRA+P+E+W 
Sbjct: 181 EVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAWA 240

Query: 241 QEKQEGEPNKSDEDGQETEELHL 263
               E +P+K D + Q+ EE+ L
Sbjct: 241 --AGEEQPDKKDLEDQDIEEIVL 261

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  312 bits (799), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 193/261 (73%), Gaps = 1/261 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           M++QTNA+N++ERTSAYL+SGLL+ TPAWY+VVA +PPT KFTRE R INPST +     
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
           ++  E +N+KGFYKTR +  DRK   ++LYK PKLQ++EDQLR +F+ QHPWE SRPK+L
Sbjct: 61  RDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKIL 120

Query: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMXX 180
           VEN + E FDWS++ QLGKPLDGESVVQRT+YLL+ D ++ +I AY++ RFEFYR R+  
Sbjct: 121 VENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTD-KMDMITAYNQARFEFYRFRIQQ 179

Query: 181 XXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240
                       MFGSVF+ S ID+G+E+EQ+VI  WK+KA +ETEL+AARRA+P++SW 
Sbjct: 180 EVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSWI 239

Query: 241 QEKQEGEPNKSDEDGQETEEL 261
             +        DE G E  EL
Sbjct: 240 SAEAGATEENLDEQGSELLEL 260

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  303 bits (777), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 195/264 (73%), Gaps = 4/264 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q NAVNVLERTS+YL++GLL++TPAWY VVA VPP+ +F RE R +NPST K+T + 
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KEFDEGINRKG-FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
            EF E  + +   YKTR S  +R+   S+L+ APKL++ ED+LREVFY+QHPWE SRPKM
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           LVEN    ++DWS + QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLR+ 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        MFGSVF  SAID+G+E+EQ++IDVWKQKAI++TE+++AR  +P+ESW
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 240 GQEKQEGEPNKSDEDGQETEELHL 263
               QE +P +SD   ++T+EL L
Sbjct: 241 S--AQESQP-QSDAKAEDTKELQL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  296 bits (757), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/237 (57%), Positives = 178/237 (75%), Gaps = 1/237 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVN+LERTSAYLR+GLL + PAWY VVASVPP+  F RE +  NPS  K     
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KEFDEGIN-RKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
            E+ E +  + G YKTR S  DRK   ++LYKAPKL + ED+LRE+FYQQHPWE SRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           L+EN   E++DWS + QLGKPLDGESVVQRT+YLL++  +L +++AYD+ RFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPA 236
                        MFGSVF SS+I+YG+E+EQ+VI+ WK+KAI++TEL+AAR + P+
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  295 bits (756), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 194/267 (72%), Gaps = 7/267 (2%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVL+RTSAYL+SGLL+ETPAWY VVAS+PP+TKFTRE RF NPS G    + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  KEFDE--GINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPK 118
            +  E    N KG YKTR +S D++    RLY+ PKL ++ED+LR +FY+QHPWE SRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 119 MLVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLR 177
           +LVENEI +EN+DWS+M Q+G+PLDGESV+QRT+YL++      +++AYD  R+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAE 237
           M              MFGS+F  SAI++G+++EQ V+DVW++K +EETEL+AAR ++PA 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 238 SWGQEKQEGEPNKS-DEDGQETEELHL 263
           SW   K +   N + +E+   +E LH 
Sbjct: 241 SW---KDDTTLNTAQEEESTTSENLHF 264

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 183/263 (69%), Gaps = 2/263 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q NAVNVLERTSAYLR+GLL + PAWY VVASVPP  KF R  +  NPS  +   Q 
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
              D      G +KTR ++ DR     +LY A KL ++EDQLRE+FY+QHPWE SRPK+L
Sbjct: 61  HSLDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKIL 120

Query: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMXX 180
           +EN  +E +DWS+M Q+GKPLDGESVVQRT+YL++      ++ AYD  R+EFYRLRM  
Sbjct: 121 IENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQQ 180

Query: 181 XXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240
                       MFGSVF  SAI+YG+++EQ+VID WK+KAI +TE++AARR +P+ESW 
Sbjct: 181 HIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESWA 240

Query: 241 QEKQEGEPNKSDEDGQETEELHL 263
            +  E +P K+D+  ++ EE+ L
Sbjct: 241 TD--EKDPKKNDDIEEDVEEIKL 261

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  291 bits (745), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 181/243 (74%), Gaps = 1/243 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNA N+LERTSAYL++GLLR  PA+Y V+A VPP+TKFTRE + +NPSTG+   ++
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
           +E  + +N +G YKTR ++ DR    SRLYKA +L++LED LR++FY QHPWE SRPK++
Sbjct: 61  RELTDKVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKIV 120

Query: 121 VENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           +EN I N + DWS + QLGKP+DGESVVQRT++L++      + D YD+ RFEFY++RM 
Sbjct: 121 IENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        MFGS+F  +A++YG+++EQ VI  WKQ+AI ETELL A+RA+P++SW
Sbjct: 181 RDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDSW 240

Query: 240 GQE 242
            QE
Sbjct: 241 AQE 243

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  290 bits (741), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 188/266 (70%), Gaps = 5/266 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVL+RTSAYL+SGLL+ETPAWY VVAS+PP+TKFTRE RF NPS G    + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KEFDE--GINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPK 118
            +  +    N+ G YKTR ++ D++    +LYK PKL ++ED+LR +FY+QHPWE SRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 119 MLVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLR 177
           +LVENEI +E++DW  M QLGKPLDGESVVQRT++LL+      +++AYD  R+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAE 237
           M              MFGS+F  SAI++G+++EQ V+DVW++K IEETEL+AA+ ++PA 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 238 SWGQEKQEGEPNKSDEDGQETEELHL 263
           SW  +         DE+    E LH 
Sbjct: 241 SWKDDTTLD--TAQDEEPTTAENLHF 264

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  290 bits (741), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 190/267 (71%), Gaps = 7/267 (2%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGK---KT 57
           MK+QTNAVNVL+RTSAYL+SGLL++TPAWY VVAS+PP+TKFTRE RF NPS G+   K 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 58  VQWKEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRP 117
           V   E  +  N  G YKTR +  DR+    +LYK PKL ++ED+LR +FY+QHPWE SRP
Sbjct: 61  VDVTERQQA-NANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRP 119

Query: 118 KMLVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRL 176
           K+LVENE+ +EN+DWS+M QLGK LDGESV+QRT++LL+      +++AYD  R+EFY L
Sbjct: 120 KILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYAL 179

Query: 177 RMXXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPA 236
           RM              MFGS+F  S+I++G+++EQ V+DVW++K IEETEL+AAR ++PA
Sbjct: 180 RMEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPA 239

Query: 237 ESWGQEKQEGEPNKSDEDGQETEELHL 263
            SW  +         DE+   TE LH 
Sbjct: 240 GSWKDDATLD--TAQDEEPVTTENLHF 264

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  289 bits (740), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 180/242 (74%), Gaps = 3/242 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVL+RTSAYL+SGLL++TPAWY VVAS+PP+TKFTRE  F NPS G    + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  KEFDEG--INRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPK 118
            +  E    N  G YKTR ++ D++    +LYK PKL ++ED+LR +FY+QHPWE SRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 119 MLVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLR 177
           +LVENEI +E++DWS+M QLGKPLDGESV+QRT+YLL+       ++AYD  R+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 178 MXXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAE 237
           M              MFGS+F  SAI++G+++EQ V+++W++K IEETEL+AAR ++PA 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 238 SW 239
           SW
Sbjct: 241 SW 242

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  288 bits (738), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 185/256 (72%), Gaps = 8/256 (3%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVN++ERTSAYL SGLL+ TPAWY VVAS+PPT KFTRE +  NP+TG+    +
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  KEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKML 120
           K+    +N KG YKTR +  DRK   + LYK PKL +LED+LR +F++QHPWE SRPK+L
Sbjct: 61  KDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKIL 120

Query: 121 VENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMXX 180
           +EN + ENFDWS++ Q  K LDGESVVQRT+YLL+ +P + ++ AY++ RFEFYRLR+  
Sbjct: 121 IENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQQ 180

Query: 181 XXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESWG 240
                       MFGS+F  ++ ++G+E+EQ+VI+ WK+KAI+ET+L+  R ++P++SW 
Sbjct: 181 DISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSWA 240

Query: 241 QEKQ--------EGEP 248
             ++        EGEP
Sbjct: 241 APEEQDLEEDFTEGEP 256

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  285 bits (728), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 179/241 (74%), Gaps = 1/241 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVLERTSAYLR+G+++ETPAWY VVAS+PP TKFTRE   INPST KK  + 
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  KEFD-EGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
           K+ D E +NR G YKTR ++ +RK  + ++YK PKL +LED++R +FY+QHPWE +RPK+
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           + ENEIN N DW  M QLG+PLDGE+VVQRT+YLL+   +  I DAYD+ R EFYRLRM 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        MFGSVF  S I++GV +EQ+VI+ WK+ A  ++ELL+A++ + +++ 
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKAA 240

Query: 240 G 240
           G
Sbjct: 241 G 241

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  283 bits (724), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 181/247 (73%), Gaps = 1/247 (0%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q NAVNVLERTSAYL++G++++ P WY VVA+ PP+ KFTRE +FINPST K+TV++
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KEFDEGINRK-GFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
           K   + +NR  G YKTR +S D+K   S LYK PKL ++ED+LR++FY+QHPWE +RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           ++EN     +DWS + QLGKPLDGESVVQRT++LL+      +IDAY++ RFEFYRLRM 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        MFG+VF S+ I++G+E+EQ +ID WK +AI+ETE+  A+R+  + SW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 240 GQEKQEG 246
             +  EG
Sbjct: 241 KTDSLEG 247

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  283 bits (723), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 142/264 (53%), Positives = 191/264 (72%), Gaps = 4/264 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q NAVNVLERTS+YLR+G+L++TPAWY+VVA +PP+ +F RE R +NPST  +  + 
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KEFDEGINRKG-FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
            EF E  N +   YKTR S  D++   ++LYKAPKL++ ED+LRE+F++QHPWE SRPKM
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           LVEN   +++DWS + QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLR+ 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        M GSVF  SAID+G+++EQ++IDVWKQKAI+++ELL+AR  +P+ESW
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTNPSESW 240

Query: 240 GQEKQEGEPNKSDEDGQETEELHL 263
                  +   +D   QETEE+ L
Sbjct: 241 SSSPSSQD---NDSKVQETEEIKL 261

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  276 bits (705), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 177/264 (67%), Gaps = 7/264 (2%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNA N+LERTS++LR GLL  TP WY V+   PP+TKF R+ + +NPSTG  T + 
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  KEFDEGINRK-GFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
           +EF +  N   G YKTR +  +++   S +Y+APKL + ED+LR +FY+QHPWE SRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           LVEN+ +E  DWS + QLGKPLDGESVVQRT+YLL       +IDAYD+ RFEFYRLRM 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        M GSVF  SA+++G+ +EQ VID WK+KA+++ EL++A+R+  + +W
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 240 GQEKQEGEPNKSDEDGQETEELHL 263
           G  +          D  E EEL L
Sbjct: 241 GTREDNA------NDAVEIEELEL 258

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  270 bits (689), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 137/266 (51%), Positives = 182/266 (68%), Gaps = 3/266 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVN+LERTSA+L SG++++ PAWY VVA+ PP  KF R+  F+NPSTGK  V  
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  KEF-DEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
           K F D   N    YKTR S  D++   + LY+ PKL +LEDQLR++FY QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMX 179
           L+EN +   FDWS + QLGK LDGESVVQR ++LL+      +  AYD+ RFEFYR+RM 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 180 XXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239
                        M+GSV++ SAI++G+E+E +VI+ WK++ I+ETE + ARRASP+ESW
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

Query: 240 G--QEKQEGEPNKSDEDGQETEELHL 263
              + + E E    ++DGQE E L L
Sbjct: 241 NPEELEGENEETAEEKDGQEVENLFL 266

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  269 bits (687), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 174/249 (69%), Gaps = 4/249 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q NAVNVLERTS+YLRSGLL + PAWY VVA +PP+ KF R  +F NPS  KK  + 
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  KEFDEGI--NRKG--FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSR 116
           +  DE +  +R G   +K+R +  D+K     +YK  KL ++EDQLREVFY QHPWE SR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 117 PKMLVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRL 176
           PK++VEN  +E +DWS++ QLGK LDGE+VVQR +YL++K   +       + R+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 177 RMXXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPA 236
           RM              MFGSVF  S I++G++QEQ+VIDVWK+KAI ETEL+ A+R +P+
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

Query: 237 ESWGQEKQE 245
           E+W QEK+E
Sbjct: 241 ETWAQEKEE 249

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  266 bits (680), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 187/261 (71%), Gaps = 3/261 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+Q  AVNVLERTSAYL+SG+L++TPAWY V+A VPPT KF R  +  +P  GK     
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KEFDE-GINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
            ++     N  G YKTR +S ++K   S+LY++PKL ++ED+LR++F+QQHPWE SRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 120 LVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRM 178
           LVEN +  + +DWS++ QLGKPLDGESVVQRT++LL+   +  +IDAYD+ RFEFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 179 XXXXXXXXXXXXXXMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAES 238
                         MFGSVF +++I+YG+ +EQ+VID WK+KA+++ EL+AAR +SP+ S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 239 WGQEKQEGEPNKSDEDGQETE 259
           W  E +E E    D+D +E +
Sbjct: 241 WTNETEE-EQKPIDQDVEEIQ 260

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  211 bits (536), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 133/179 (74%), Gaps = 3/179 (1%)

Query: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60
           MK+QTNAVNVL+RTS YL++GLL++TPAWY VVA +PP TKF RE +  +P +GK   + 
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KEFDEGINRKG-FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119
               + +NR    YKTR  S DR+   + ++K  KL+F+ED+LR +F+QQHPWE SRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQ--TAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRM 178
           LVEN  NE +DWS M QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLRM
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>NCAS0C02550 Chr3 complement(477327..481163) [3837 bp, 1278 aa] {ON}
           Anc_8.472 YPL016W
          Length = 1278

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 19/80 (23%)

Query: 96  QFLEDQLR---EVFYQQHPWEFSRPKMLVEN--------EINENFDWSYMSQLGKPLDGE 144
           Q LE +LR   E+   Q P +F R K  + N        ++N  +D +Y+SQ+G+ +D  
Sbjct: 625 QLLESKLRKEYELKLSQLPKKFQRTK--IRNYSALKRPIDLNNGYDMNYISQIGEKIDS- 681

Query: 145 SVVQRTIYLLQKDPELGIID 164
               + I+L    PELG ++
Sbjct: 682 ---NKPIFLFA--PELGAVN 696

>NCAS0A01570 Chr1 complement(309025..311478) [2454 bp, 817 aa] {ON} 
          Length = 817

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 63  FDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSR------ 116
           FD  +NR  F  TR SS +R      L+K  ++  + D L    Y       +R      
Sbjct: 441 FDHELNRIYFIATRKSSIERHVYYVELHKPEEIHPVTDTLSRGVYGISFSAGARFALLSY 500

Query: 117 --PKM----LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPEL-GIIDAYDRT 169
             PK+    +++ +  EN D+         LDG +++ +T+Y L+K+ +L  I+  YD  
Sbjct: 501 RGPKVPYQKIIDFKSKENLDFG-------ELDG-NILGKTLYYLEKNEKLREILKEYDVP 552

Query: 170 RFEFYRLRM 178
           + EF  L +
Sbjct: 553 KKEFKELNL 561

>TDEL0B01380 Chr2 complement(244071..245285) [1215 bp, 404 aa] {ON}
           Anc_8.499 YPL049C
          Length = 404

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 223 EETELLAAR----RASPAESWGQEKQEGEPNKSDEDGQETEELHL 263
           + TE  AAR    RAS AE    E+ E +P+ S  D  +TE +HL
Sbjct: 295 QRTEKSAARKQDVRASDAEDSSDERPEEQPDGSGNDEDDTESVHL 339

>ZYRO0A13816g Chr1 complement(1099212..1099886) [675 bp, 224 aa]
           {ON} some similarities with uniprot|P38363 Saccharomyces
           cerevisiae YML132W COS3 Protein involved in salt
           resistance interacts with sodium:hydrogen antiporter
           Nha1p member of a family of conserved often
           subtelomerically- encoded proteins
          Length = 224

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 9/92 (9%)

Query: 20  SGLLRE-TPAWYQVVASVPPTTKFTREARFINPSTGKKTVQWKEFDEGIN----RKGFYK 74
           SGLL    PAW+Q V   P T K  ++    NP  G  T +W E    +N    R+  ++
Sbjct: 69  SGLLFGLIPAWFQYVKEHPNTKKLVQQVLESNP--GVDTRKWNEIANILNPFFYRENIWR 126

Query: 75  TRNSSFDRKPMDSRLYKAPKLQ-FLEDQLREV 105
           T    F+ + +  R++K   L+ +LE Q   V
Sbjct: 127 TPYFFFNGRHVQ-RVFKYNVLKPYLEGQFEGV 157

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
          similar to uniprot|P28241 Saccharomyces cerevisiae
          YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
          isocitrate dehydrogenase which catalyzes the oxidation
          of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 18 LRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQWKEFD 64
          LRS +LR+ P  +      P   +FT +    NPSTGK TV + E D
Sbjct: 2  LRSQVLRQLPRRFLSSKKQPSIGRFTGKP---NPSTGKYTVSFIEGD 45

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,176,757
Number of extensions: 1126984
Number of successful extensions: 3958
Number of sequences better than 10.0: 34
Number of HSP's gapped: 4019
Number of HSP's successfully gapped: 34
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)