Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01936g2.288ON95395347710.0
TDEL0G021902.288ON93689129120.0
NDAI0G006702.288ON96890128550.0
NCAS0G037802.288ON95789228300.0
Suva_14.3242.288ON96889727860.0
Skud_14.3062.288ON97089827530.0
YNL023C (FAP1)2.288ON96589927500.0
Smik_14.3082.288ON96589627440.0
KAFR0H033002.288ON96690126850.0
KNAG0H019902.288ON97391126620.0
TBLA0B059502.288ON99590226440.0
CAGL0M06919g2.288ON95690125950.0
TPHA0D015302.288ON96290125340.0
Kpol_1039.452.288ON96890824800.0
KLTH0G10406g2.288ON96389524650.0
SAKL0E07634g2.288ON97490924250.0
Kwal_27.115182.288ON95389224140.0
KLLA0E08317g2.288ON92189323380.0
Ecym_33272.288ON92688621570.0
ADL213W2.288ON90890321220.0
Skud_12.825.235ON899189810.65
KLLA0E00551g4.7ON24267790.72
TBLA0F020807.304ON73449771.8
Kpol_340.88.415ON946112753.5
NCAS0G013802.17ON77045753.5
YLR014C (PPR1)5.235ON904132736.4
CAGL0J09130g7.304ON59264726.6
Kpol_520.334.332ON46455726.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01936g
         (953 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1842   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1126   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1104   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1094   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1077   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1065   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1063   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1061   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1038   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1030   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1023   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...  1004   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   980   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   959   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   954   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   938   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   934   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   905   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   835   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   822   0.0  
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    36   0.65 
KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}...    35   0.72 
TBLA0F02080 Chr6 complement(509605..511809) [2205 bp, 734 aa] {O...    34   1.8  
Kpol_340.8 s340 (17972..20812) [2841 bp, 946 aa] {ON} (17972..20...    33   3.5  
NCAS0G01380 Chr7 complement(246345..248657) [2313 bp, 770 aa] {O...    33   3.5  
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    33   6.4  
CAGL0J09130g Chr10 (902880..904658) [1779 bp, 592 aa] {ON} some ...    32   6.6  
Kpol_520.33 s520 (83358..84752) [1395 bp, 464 aa] {ON} (83358..8...    32   6.8  

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1842 bits (4771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 912/953 (95%), Positives = 912/953 (95%)

Query: 1   MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFXXXXXXXXXXXXXXXXXXXRMMYYE 60
           MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEF                   RMMYYE
Sbjct: 1   MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFSDDSDETTDEETTDEDEDDRMMYYE 60

Query: 61  RAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKTWKC 120
           RAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKTWKC
Sbjct: 61  RAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKTWKC 120

Query: 121 PNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHLGPHPE 180
           PNCLDESNKVPRKSRPTCWCGKVV          SCGQTCDAPICEHGCSKVCHLGPHPE
Sbjct: 121 PNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHLGPHPE 180

Query: 181 CTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLCGGC 240
           CTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLCGGC
Sbjct: 181 CTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLCGGC 240

Query: 241 NETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDVRVVEY 300
           NETLHSKPDKGAVIKCYCGLHESPSIRCG            QGNGWIGVFRCKDVRVVEY
Sbjct: 241 NETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDVRVVEY 300

Query: 301 ACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTCESK 360
           ACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTCESK
Sbjct: 301 ACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTCESK 360

Query: 361 CGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCESLM 420
           CGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCESLM
Sbjct: 361 CGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCESLM 420

Query: 421 SCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHKCQR 480
           SCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHKCQR
Sbjct: 421 SCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHKCQR 480

Query: 481 KCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHTPMP 540
           KCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHTPMP
Sbjct: 481 KCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHTPMP 540

Query: 541 HLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQKKCH 600
           HLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQKKCH
Sbjct: 541 HLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQKKCH 600

Query: 601 DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTN 660
           DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTN
Sbjct: 601 DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTN 660

Query: 661 SQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNFEELGLP 720
           SQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNFEELGLP
Sbjct: 661 SQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNFEELGLP 720

Query: 721 FRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSE 780
           FRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSE
Sbjct: 721 FRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSE 780

Query: 781 SQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNF 840
           SQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNF
Sbjct: 781 SQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNF 840

Query: 841 VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIF 900
           VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIF
Sbjct: 841 VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIF 900

Query: 901 PESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAPTESS 953
           PESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAPTESS
Sbjct: 901 PESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAPTESS 953

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1126 bits (2912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/891 (60%), Positives = 660/891 (74%), Gaps = 7/891 (0%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYERAV+EIA GD YVCMICTVEMDYTCKM+AC  CYRVFDY+CIREWALKST +T+D
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   + +VP K+RPTCWCGK V          SCGQTCDAPIC HGCSK CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQ-QFTCEESCGLLLPCGVHKCSKKCHS 234
           GPHP+C R I+ KC+CG+HTR+  C +  S + + QF C E CGL L CG+HKC + CHS
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217

Query: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKD 294
           G+CG C   L++K +K   I+CYCGL    S +C             +G+ WIG F C  
Sbjct: 218 GICGPCPAVLNAKSNK-LKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSG 276

Query: 295 VRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHI 354
           +R +EYAC +HSFVE C+P+PS+  +I CPFSP +L++CPCGRT L  L + R  CT  I
Sbjct: 277 IRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPI 336

Query: 355 PTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNT 414
           P C+S CGKKLACG+HTCP+ CH+G CMDPC+Q E   C C    + VPCQF+E PRC+T
Sbjct: 337 PNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDT 396

Query: 415 KCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCG 474
           KCESLMSCRRHRCTE+CC G+P AERR+KTP +SREL+DES VE+EH+CLK CNLTL+CG
Sbjct: 397 KCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCG 456

Query: 475 RHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPC 534
            HKCQRKCHPG+CPPCLESD NDLVCPCGKTVVEAPVRCGT+LPPC Y CI V+++ Y C
Sbjct: 457 CHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKC 516

Query: 535 GHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHT 594
           GH PMPH CHP  E CP CTA V KPCKCGKK  VRTLCFQ DVSCG  C KPL +C H 
Sbjct: 517 GHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHM 576

Query: 595 CQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKES 653
           CQK CH  G CQ KC+QIC +KR+ CDHKC   CHG + CPD PCP SV IKC C  KES
Sbjct: 577 CQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKES 636

Query: 654 TEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSN----AL 709
              CG NS+T S + T  L CDEECER KR  QL++A G+    D+   +  ++    A 
Sbjct: 637 FITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAA 696

Query: 710 VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVH 769
           VA++FEEL LPF E  L  +++Q+ +C  IE+VLN+F+D+E+K+SLHFKPM+PAQRHF+H
Sbjct: 697 VANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIH 756

Query: 770 ELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRY 829
           ELAK+Y LY ESQD EPKRSV+VKK+ NG S KP I L+++LPIYQ FK+ EKE K +R+
Sbjct: 757 ELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRF 816

Query: 830 EMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYK 889
           E Q  T  VNF+PK EP +E AK N F ++N++ GT  EDL+RI+ +HLKPTLV+NP +K
Sbjct: 817 EAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFK 876

Query: 890 ALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQV 940
                   LI+PE Y++++VN E D+E LVGHFD++CKE FIGDG+ELC +
Sbjct: 877 IQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHI 927

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/901 (58%), Positives = 653/901 (72%), Gaps = 11/901 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYER ++EIA+GD+YVCMICTVEMDYTC+M+AC +CYRVFDYDCIREWA+KST +T+D
Sbjct: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   + KVP K+R TCWCGKVV          SCGQTC+A IC HGC+ +CHL
Sbjct: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGR-NQQFTCEESCGLLLPCGVHKCSKKCHS 234
           GPHPECTR++SI C+CG+HT+D+ C +  + + N +F C++ CGL L CG+HKC +KCHS
Sbjct: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237

Query: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFRC 292
           GLCG C E L    +   ++KCYCG     S++C               +GN WIGVF C
Sbjct: 238 GLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFAC 297

Query: 293 KDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTD 352
           K++R V+Y C +HSF+E C   P+L  +  CP+SP +L++CPCG+TPL KL + R  CTD
Sbjct: 298 KEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCTD 357

Query: 353 HIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRC 412
            IPTCES C K L CGKH CP+KCH G CMDPC+Q E   C CE +SFLVPCQF   P C
Sbjct: 358 PIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPHC 417

Query: 413 NTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLT 472
           N KCESLMSCRRHRC E+CCSG+P AE+RKKT F S++L+DE+LVEAEH+CLK CNL L+
Sbjct: 418 NIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLLS 477

Query: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532
           CG H+CQRKCHPG+CPPCLESD NDLVCPCGKT+VEAPVRCGTKLPPCP+ CI VVR+ Y
Sbjct: 478 CGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNEY 537

Query: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592
           PCGHTPMPH CHP +E CPPCTA V KPCKCGK  +VRTLCFQ DVSCG+IC  PL  C 
Sbjct: 538 PCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLPLKDCP 597

Query: 593 HTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651
           H C K+CH  G CQ KC+QICGK+R+NCDH C +PCHG   CPD PC  S  + C CGR+
Sbjct: 598 HKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCECGRR 657

Query: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKE----NGDSSVENTVSN 707
           E+   CG  S   SA  T  L CDEECE ++R  QLK+A G+KE    + D   E     
Sbjct: 658 ETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERLKDI 717

Query: 708 ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767
              A  FEEL LPF E  L+I+SRQ+R+C  IE ++N F+DD+ + SLHFKPM+P QRHF
Sbjct: 718 VPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQRHF 777

Query: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827
           +HEL+KAY LY ESQDPEPKRSV++KK  N  S+KPS +L + LP+YQ FK+ EKE K++
Sbjct: 778 IHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFSLSKVLPLYQTFKELEKERKLQ 835

Query: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886
            +E +    LVN  VP+      +A+ NGFLI++L+ GT  EDL+RI+G++LK TL++NP
Sbjct: 836 EFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIKNP 895

Query: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQP 946
            Y  L D    +I+PE Y  +T N E D + LVGHFD + K+ FI +GVELC++ + L  
Sbjct: 896 QYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVLST 955

Query: 947 E 947
           E
Sbjct: 956 E 956

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/892 (59%), Positives = 664/892 (74%), Gaps = 7/892 (0%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYERA++EIA+GD+YVCMICTVEMDYTC+M+AC +CYRVFDY+CIREWALKST +T+D
Sbjct: 50  MHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVD 109

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   + KVP K+RPTCWCGKVV          SCGQTC+A  C HGCSK+CHL
Sbjct: 110 RIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHL 169

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQ-QFTCEESCGLLLPCGVHKCSKKCHS 234
           GPHPECTRII+IKC+CG+HT+D+ C +    R + +F C+E CGL L CG+H+C KKCHS
Sbjct: 170 GPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHS 229

Query: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXX--XXXXXXXXQGNGWIGVFRC 292
           GLCG C E L++K    A I+CYCG  +  +I+C               +G  W+GVF+C
Sbjct: 230 GLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKC 289

Query: 293 KDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTD 352
            ++R V+Y C +HSFVE C   P++     CPFSP +L++CPCG+TPL +L ++R KCTD
Sbjct: 290 DNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTD 349

Query: 353 HIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRC 412
            IPTC+S+CGK L CG+HTCP+ CH G CMDPC+Q +K  C C  +SFLVPCQF +DP+C
Sbjct: 350 PIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQC 409

Query: 413 NTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLT 472
            TKCESLMSCRRHRCTE+CC+G+P AE RKK  F S++L+DESLVE +H+CLK CNL L+
Sbjct: 410 TTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLS 469

Query: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532
           CG+HKCQRKCHPG+CPPCLESD NDLVCPCG+T++EAPVRCGTKLPPCPY CI VVR  Y
Sbjct: 470 CGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEY 529

Query: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592
           PCGHTPMPH CHP  E CPPCTA+V KPCKCGK   VRTLCFQ DVSCG+IC  PL +C 
Sbjct: 530 PCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLENCN 589

Query: 593 HTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651
           HTCQK+CH  G CQ  C+QIC KKR+NC+H C KPCHG   CPD PC  S+ I C CGRK
Sbjct: 590 HTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRK 649

Query: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS---VENTVSNA 708
           E+   CG  S   SA+    + CDEECE ++R  QLK+A G+ ++  S+   VE     A
Sbjct: 650 ETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLA 709

Query: 709 LVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFV 768
            VA+ FEEL LP+ ET L+IY++Q+++CD IE +LN  +DD+ + SLHFKPM+P QRHF+
Sbjct: 710 KVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFI 769

Query: 769 HELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRR 828
            E AK++ LY+E+QD EPKRSV+VKKE +G S+KP I+L +ALP+YQ FK+ EKE K++ 
Sbjct: 770 QEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKE 829

Query: 829 YEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVY 888
           +E +  T L+N     E  V  AKY+GFLI+ ++ GT  EDLQRI+G+ L  TL+ NP Y
Sbjct: 830 FEARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIVNPQY 889

Query: 889 KALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQV 940
             + D   ALI+PE+Y +++   E D+E LVGHFDFI KE FI DGVELC V
Sbjct: 890 LIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDV 941

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/897 (57%), Positives = 641/897 (71%), Gaps = 9/897 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYERA++EIA+GD+Y+CMICTVEMDYTC+MFAC KCYRVFDY CIREWALKST +T+D
Sbjct: 54  MQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 113

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           K WKCPNC     KVP ++RPTCWCGKVV          SCGQTC+AP C HGCSK+CHL
Sbjct: 114 KIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHL 173

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHPECTR + IKC+CG+H++ + C +      + F C+E CGL L CG+HKC KKCHSG
Sbjct: 174 GPHPECTRTVEIKCRCGKHSKSIFCYQ-SKAMKKHFDCQEECGLPLSCGIHKCKKKCHSG 232

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFRCK 293
           LCG C E + S+      IKCYCG+H   SI+C                GN WIGVF CK
Sbjct: 233 LCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACK 292

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
           D+R V+YAC +HSF+E C   P++  +  CPF P++L++CPCGRT L +L + R  CTD 
Sbjct: 293 DIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDP 352

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           IPTC S+C K L CGKH+CP+ CH+G CMDPC+Q +   C CE  +FLVPC F+E P CN
Sbjct: 353 IPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCN 412

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473
            KCESLMSCRRHRC ++CCSG+P A  RKK  F S++L+DESLVEA+H+CLK CNLTL+C
Sbjct: 413 IKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSC 472

Query: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533
           G HKCQRKCHPG+CPPCLESD NDLVCPCGKTV+ APVRCGTKLP C Y+CI VVR    
Sbjct: 473 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESE 532

Query: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593
           CGH PMPH CHP +  CPPCT  V KPCKCGKK  VRT+CFQ DVSCG  C KPL  C H
Sbjct: 533 CGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCHH 592

Query: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652
           TCQK CH    CQ  C+QIC +KR NCDH CPKPCHG   CPD PC   V I C CGR E
Sbjct: 593 TCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRIE 652

Query: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSN----A 708
               CG  S  +S +   +L C+EECE +KR  +L++A G+ E  + S  N +       
Sbjct: 653 KKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKKLV 712

Query: 709 LVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFV 768
            VA+ FEEL LPF ETVL++Y++Q+ +C  IE+++N  + D+ +SSLHFKPM+P QRHF+
Sbjct: 713 SVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRHFI 772

Query: 769 HELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRR 828
            ELAKAY LYSESQD EP RSV++KKE N +S++P ++L EA P+Y++FK+ +KE KI+ 
Sbjct: 773 RELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKIQE 832

Query: 829 YEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPV 887
           ++ +    L+NF V   EP VELAK NGFL++ L +G + +DL+R +  HLK TLV  P 
Sbjct: 833 FQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVKPQ 892

Query: 888 YKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944
           Y  + D   AL++PE+Y +V+VNTE DM+ LVGHFDF+ KE F+ D + LC + E L
Sbjct: 893 YLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEEL 949

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1065 bits (2753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/898 (57%), Positives = 632/898 (70%), Gaps = 11/898 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           + YYERA++EIA+GD+Y+CMICTVEMDYTC+MFAC KCYRVFDY CIREWALKST +T+D
Sbjct: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           K WKCPNC     KVP ++RPTCWCG VV          SCGQTC+AP C HGC K+CHL
Sbjct: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHPECTR++ IKC CGRH++ + C +  + R ++F C+E CGL L CGVHKC KKCHSG
Sbjct: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMR-RRFNCQEECGLSLSCGVHKCKKKCHSG 233

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFRCK 293
           LCG C E + +       IKCYCG H   SI+C                GN W GVF C 
Sbjct: 234 LCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACA 293

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
           D+R V+YAC +HSF+E C   P++  Q  CPF P++L++CPCGRT L +L + R  C D 
Sbjct: 294 DIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDP 353

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           IPTC S+C K L CGKH CP+ CH+G CMDPC+Q +  NC CE  +F +PC F+E PRCN
Sbjct: 354 IPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCN 413

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473
            KCESLMSCRRHRC ++CCSG+P A RRKK+ F S++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 414 IKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSC 473

Query: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533
           G HKCQRKCHPG+CPPCLESD NDL+C CGKTVV APVRCGTKLP C + CI VVR    
Sbjct: 474 GLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESW 533

Query: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593
           CGH PMPH CHP    CPPCT  V KPC+CGKK  VRT+CFQ DVSCG  C  PL  C H
Sbjct: 534 CGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCYH 593

Query: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652
           TCQK CH  G CQ  C+QICG+KR++C H CPKPCHG   CPD PC   V I C CGR +
Sbjct: 594 TCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRIK 653

Query: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709
            +  C     T+S   +  L C+EECE +KR  +L++A G+ E  ++ + N + +AL   
Sbjct: 654 KSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNEL-DALSEL 712

Query: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767
             VA  FEEL LPF E  L++YS+Q+R+C  IE +LN  +D E +SSLHFKPM+P QRHF
Sbjct: 713 VSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRHF 772

Query: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827
           +HE+AKAY LY+ESQD EP RSV++KKE N  S KP ++L EA P+Y++FKQ +KE K++
Sbjct: 773 IHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKLQ 832

Query: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886
            ++ +    L+NF V   E  +E AK NGFL++NL  G   EDL+R +  HLK TLV NP
Sbjct: 833 EFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVANP 892

Query: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944
            Y  L D   ALI+PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC V E +
Sbjct: 893 QYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEI 950

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1063 bits (2750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/899 (57%), Positives = 638/899 (70%), Gaps = 11/899 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYERA++EI+ GD+YVCMICTVEMDYTC+MFAC +CYRVFDY CIREWALKST +T+D
Sbjct: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   S +VP K+RPTCWCGKVV          SCGQTC+A  C HGCSK+CHL
Sbjct: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHL 169

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHPECTR++ I C CG+H++ + C +    + + F C+E CGL L C +H C KKCH G
Sbjct: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMK-KNFNCQEVCGLPLSCSIHTCKKKCHPG 228

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFRCK 293
           LCG C E + SK      IKCYCG H   +I+C                GN WIGVF C 
Sbjct: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
           D RVV+Y+C +HSF+ESC   P++  +  CPF P+ L++CPCGRT L +L + R  C D 
Sbjct: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           IPTC+S+CGK L CGKH+CP+ CH+  CM+PC+Q +   C CE  +F VPC F+  PRCN
Sbjct: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473
            KCESLMSCRRHRCT++CCSG+P A RRKK  F +++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSC 468

Query: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533
           G HKCQRKCHPG+CPPCLESD NDLVCPCG TVV APVRCGTKLP C + CI VVR    
Sbjct: 469 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGEST 528

Query: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593
           CGH PMPH CH  +  CPPCT  V KPCKCGKK+ VRT+CFQ DVSCG  C  PL  C H
Sbjct: 529 CGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCYH 588

Query: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652
           TCQK CH  G CQ  C+Q CG+KR+NC+H+CPKPCHG   CPD PC   V I C CGR +
Sbjct: 589 TCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRIK 648

Query: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709
            +  CG  S  +S + +  L C+EECE +KR  +LK+A G+KE  ++   N + +AL   
Sbjct: 649 KSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNEL-DALKKL 707

Query: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767
             VA+ FEEL LPF E  L++YS+Q+R+C  IE++LN  +DD+ +SSLHFKPM+P QRHF
Sbjct: 708 VSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827
           + ELAKAY LYSESQD EP RSV++KKE NG SNKP ++L EA P+Y++FKQ +KE K +
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKAQ 827

Query: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886
            ++ +    L+NF V   EP VE+AK NGFL++NL  G   EDL+R +  HLK TLV NP
Sbjct: 828 EFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVNP 887

Query: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQ 945
            Y  L D   AL++PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC   E L+
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEELE 946

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/896 (57%), Positives = 636/896 (70%), Gaps = 11/896 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYER+++EI++GD+Y+CMICTVEMDYTC+MFAC +CYRVFDY CIREWA+KST +T+D
Sbjct: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC     KVP  +RPTCWCGKVV          SCGQTC APIC HGCSK CHL
Sbjct: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHL 169

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHPECTR++ I C CG+H++ + C +      + F C+E CGL L C VH C +KCH+G
Sbjct: 170 GPHPECTRMVEIMCHCGKHSQSIFCYQ-SKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNG--WIGVFRCK 293
           LCG C E + SK      IKCYCG H   SI+C              GNG  WIGVF C 
Sbjct: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
           D+R V+++C +HSF+E C   PS+  +  CPF P++L++CPCGRT L++L + R  C D 
Sbjct: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           IPTC S+C K L CGKH+CP+ CH+  CMDPC+Q +   C CE  +F VPC F+  PRCN
Sbjct: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473
            KCESLMSCRRHRCT++CCSG+P A +R+K  F S++LLDESLVEA+H+CLK CNLTL+C
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSC 468

Query: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533
           G HKCQRKCHPG+CPPCLESD NDL+CPCGKTVV APVRCGT+LP C + CI VVR    
Sbjct: 469 GIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESS 528

Query: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593
           CGH PMPH CHP    CPPCT  V KPCKCGKK  VRT+CFQ+DVSCG  C   L  CRH
Sbjct: 529 CGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCRH 588

Query: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652
           TCQK CH  G CQ  C+QICG +R++C H CPKPCHG   CPD PCP  V I C CGR E
Sbjct: 589 TCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRNE 648

Query: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNAL--- 709
            +  C   S  + A+ +  L CDEECE +KR  +L++A G+KE  ++   N + +AL   
Sbjct: 649 KSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNEL-DALKKL 707

Query: 710 --VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767
             VA+ FEEL LPF ET L++YS+Q+R+C  IE +LN  +DD+ +SSLHFKPM+P QRHF
Sbjct: 708 VSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRHF 767

Query: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827
           + ELAKAY LYSESQD EP RSV++KKE NG SNKP ++L EALP+Y++FKQ +KE K++
Sbjct: 768 IRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKVQ 827

Query: 828 RYEMQNVTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886
            ++ +    L+NF V   +P VE+AK NGFL+RNL  G   EDL+R +  HLK TLV NP
Sbjct: 828 EFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVNP 887

Query: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGE 942
            Y  L D   AL++PE+Y   +VNTE DME LVGHFDF+ KE F+ D + LC   E
Sbjct: 888 QYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDE 943

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1038 bits (2685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/901 (56%), Positives = 634/901 (70%), Gaps = 13/901 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           MMYYERA++EIA GD+Y+CMICTVEMDYTCKM+AC KC R+FDYDCIREWALKST +T +
Sbjct: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   + KVP K+R TCWCGKVV          SCGQTC+AP+C HGCSK+CHL
Sbjct: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172

Query: 176 GPHPECTRIISIKCKCGRHTRDVRC--SEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCH 233
           GPHPEC R I++KC CG+H R + C  S+  SGR  +F+CEE CGL L CG+H C KKCH
Sbjct: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232

Query: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCK 293
           SGLCG C E L    +K A IKCYCGL    S  C             +GN W+GVF C 
Sbjct: 233 SGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSCN 292

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
            +R VEY+C +HSFVESC   P++     CPFSPN+L++CPCGRTPLN L + R+KCTD 
Sbjct: 293 KIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTDP 352

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           +PTCE+ C K L CGKH CP+ CH G CMDPC+Q +K  C C    FL PCQF  +P CN
Sbjct: 353 VPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHCN 412

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTC 473
            KCESLMSCRRHRCTE+CCSG+P AE+RKKT F S ++ DE+LVEA+HVCLK CNL L+C
Sbjct: 413 IKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLSC 472

Query: 474 GRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYP 533
           G+H+CQRKCHPG+CPPCLESD NDLVCPCGKTVVEAPVRCGTKL PC + CI V+R+   
Sbjct: 473 GKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNESV 532

Query: 534 CGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRH 593
           CGH P+PH CHP ++ CPPCTA V KPCKCGK+  VRT+CFQ+DVSCG+IC  PL +C H
Sbjct: 533 CGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPLLTCHH 592

Query: 594 TCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKE 652
            CQK CH +G CQVKC+Q+C KKRVNC H+C K CHG   C D PCP S  I C CGR+E
Sbjct: 593 KCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCGRRE 652

Query: 653 STEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDS---SVENTVSNAL 709
           S   C   S   SA++   L C+EECE VKR  +L++A G+ E  +      E   S A 
Sbjct: 653 SYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQSFAQ 712

Query: 710 VASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVH 769
            A+N+++L LP+ E  L  Y++Q  +C+ IE +L  F+DD  + SLHFKPM+P QR+F+H
Sbjct: 713 SATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRYFIH 772

Query: 770 ELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRY 829
           E+AKA+ LY+ESQD EPKRSV++KK  +G S KP++ L + LP+YQ FK+ EKE K +++
Sbjct: 773 EIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKAKQF 832

Query: 830 EMQNVTNLVNFVPKFEPTVELAK---YNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNP 886
           E +    L+N     + T+E  K    NG +I+NL++G   E L   + +  K TL++NP
Sbjct: 833 EARTTARLMNIT--LDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKNP 890

Query: 887 VYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQP 946
            Y  +   N  LI+PES++++T     D++ LVGHF+ I KE  IGD VE+C +   L  
Sbjct: 891 QYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENELPE 948

Query: 947 E 947
           E
Sbjct: 949 E 949

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/911 (55%), Positives = 624/911 (68%), Gaps = 17/911 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           + YYERAV+EIA+GD Y CMICTVEMDYTCKMFAC KCYRVFDYDC+REWA+KST +T+D
Sbjct: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           + WKCPNC   + KVP K+RPTCWCGKVV          SCGQTCDA IC HGCSK+CHL
Sbjct: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQ-FTCEESCGLLLPCGVHKCSKKCHS 234
           GPHPEC R  S+KC+CG+ T+++ C E    R +  F C E C  LLPCG+H+C K CHS
Sbjct: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230

Query: 235 GLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKD 294
           GLCG C E L  K      I CYCG H   SI+C              G+ WIGV+ CKD
Sbjct: 231 GLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACKD 290

Query: 295 VRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHI 354
           +R VEY+C QHSF E C   P++     CPFSP  L++C CG+TPL  LG+AR +C D I
Sbjct: 291 IRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDPI 350

Query: 355 PTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNT 414
           P CES+C K L CGKHTCP++CH+G CMDPC+Q +K  C CE  +FLVPC F+  P C  
Sbjct: 351 PHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQL 410

Query: 415 KCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCG 474
           KCESL+SCRRH+C E+CCSG+P AE R+K     +++ DE+L+EAEHVCLK+CNLTL+CG
Sbjct: 411 KCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSCG 470

Query: 475 RHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPC 534
           +H+CQRKCHPG+CPPCLESD NDLVCPCGKT+V APVRCGTKLP C + CI VV     C
Sbjct: 471 QHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISEC 530

Query: 535 GHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHT 594
           GH P+PH CHP ++ CPPCTA V KPCKCGK S VRT+CFQ+DVSCGQ C KPL +C H 
Sbjct: 531 GHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPNCHHF 590

Query: 595 CQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKES 653
           CQK CH  G CQ  C+Q+C K  VNC HKC K CHG   CPD  C   V I+C CGRKE 
Sbjct: 591 CQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGRKEV 650

Query: 654 TEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKE---NGDSSVENTVSN--- 707
              CG  S   S+  T  L CDEECE   R  QLK+A G+ +   NG +  E   +    
Sbjct: 651 EVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTRLEG 710

Query: 708 -ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRH 766
            A  A+ FEEL  PF E+ ++ Y RQ ++C  IE  LNNF+D+E KSSLHFKPMKP QR 
Sbjct: 711 LASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQRL 770

Query: 767 FVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKI 826
           F+ ELAKAY LYSE+QDPEPKRSV+VKK  +G S KP  +L E  P+YQ+FK  EKE K+
Sbjct: 771 FIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKERKM 830

Query: 827 RRYEMQNVTNLVNFVPKFEPTVEL-----AKYNGFLIRNLTDGTNGEDLQRIYGEHLKPT 881
           + +  +  T+L+N   K    V        + N FLI+N++ GT  +DL+ ++G++++ T
Sbjct: 831 QDFLAKTTTHLINV--KLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEKT 888

Query: 882 LVRNPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVG 941
           L+RNP Y+ LP+ N A+++PE Y  ++ N   DME LVGH +FI  + F+ D  ELC   
Sbjct: 889 LIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDAS 948

Query: 942 EYLQPEAPTES 952
             L PE  +E+
Sbjct: 949 SKL-PEEISEN 958

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/902 (56%), Positives = 622/902 (68%), Gaps = 14/902 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           +MYYERAV+EIA+GD+Y CMICTVEMD+TCKM+AC  CYRVFDYDCIREWALKST +T+D
Sbjct: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           KTWKCPNC   S KVP K RPTCWCGKVV          SCGQTC+A IC H C K CHL
Sbjct: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCHL 188

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQ--FTCEESCGLLLPCGVHKCSKKCH 233
           G HPECT+++ I C+CGR T+D+ C E    R Q+  F C++ CGL LPCG+HKC +KCH
Sbjct: 189 GSHPECTQLLKITCRCGRETKDIYCHE---SRRQKSIFHCDQECGLTLPCGIHKCRRKCH 245

Query: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFR 291
           SGLCG C E L  +   G  IKCYCGLH    + C               +   W+G+F 
Sbjct: 246 SGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFD 304

Query: 292 CKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCT 351
           CK++R V Y C +H FVE C   P+LP  + CPFSPN+L++CPCG+T L  +   R KCT
Sbjct: 305 CKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCT 364

Query: 352 DHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPR 411
           D IPTC++ C K L CGKH CP+ CH G CMDPC+Q +K +C CE R+FLVPCQF+  P 
Sbjct: 365 DPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPV 424

Query: 412 CNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTL 471
           C  KCESLMSCRRHRC E CCSG+P AERRKKT   S +  DE+LVEAEHVCLK CNL L
Sbjct: 425 CKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKL 484

Query: 472 TCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDG 531
           +CG H CQRKCHPG CPPCLESD NDLVCPCGKTV+ APVRCGT LPPC Y CI V+R  
Sbjct: 485 SCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGE 544

Query: 532 YPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSC 591
             CGH PMPH CH  ++ CP CTA V KPCKCGKK  VRT+CFQ+DVSCG  C  PL  C
Sbjct: 545 SDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDC 604

Query: 592 RHTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGR 650
            H CQK+CH  G CQ  C QIC  KR NC H C + CH   PCPD PC   V + C CGR
Sbjct: 605 YHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGR 664

Query: 651 KESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKEN-GDS----SVENTV 705
           ++  +PC + S   S ++T  L CDEEC  + R  +LK A G+    GD     ++E   
Sbjct: 665 RKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQ 724

Query: 706 SNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQR 765
           +   VA  +EEL LPF E VL +Y++Q ++C  IE +LN F+D++ KSSLHFK MK  QR
Sbjct: 725 NRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQR 784

Query: 766 HFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETK 825
            FVH LA AYK+YSESQDPEP RSV+VKK  NG S+KP +TL+EALP+Y++FK+ +KE K
Sbjct: 785 SFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKK 844

Query: 826 IRRYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRN 885
            + YE +    L+N   + +      KYNGFLI+NL  GT  EDL+RI+GE LKPTLV++
Sbjct: 845 KQEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904

Query: 886 PVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQ 945
           P Y  + + +   I P  Y+++++N E DME+L+G FD +CKE FIGD VELC + E L 
Sbjct: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALL 964

Query: 946 PE 947
            E
Sbjct: 965 QE 966

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/901 (53%), Positives = 616/901 (68%), Gaps = 17/901 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           M YYE+AV+EI +GD+Y C+ICTVE+DYTCK++AC KCYRV+DY+CIREWA KST +  D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           K W CPNC      +P+K+RPTCWCG+ V          SCGQTC+A IC HGCS++CHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPH ECTR++SIKC CG+ T+D+ C +     ++ F CE  C  LLPCG+HKC++KCH+G
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQ-RRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXX--XXXXXXXXXQGNGWIGVFRCK 293
           LCG C ET+ SK +    I+CYCG      I+C               +G  WIGVF C 
Sbjct: 238 LCGSCPETIISK-NTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCD 296

Query: 294 DVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDH 353
            +R V Y CG+HSF E CK  PS+  ++ C FSP  L++CPCG+  L  L + R KCTD 
Sbjct: 297 KIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDA 356

Query: 354 IPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCN 413
           IPTC   CGK L CGKH CP+ CH GDCMDPC Q EK  C CE + F +PC F +  RCN
Sbjct: 357 IPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCN 416

Query: 414 TKCESLMSCRRHRCTEKCCSGKPGAERRKKT-PFTSRELLDESLVEAEHVCLKSCNLTLT 472
            KCESLMSCRRHRCTE+CC+G+P AERR+KT     R+L DES +E  H+CLK CNLTL+
Sbjct: 417 LKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLS 476

Query: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532
           CG HKC RKCH G+CPPCLESD NDLVCPCGKT+VEAPVRCGTKLP CPY CI VVR   
Sbjct: 477 CGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGET 536

Query: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592
            CGH+PMPH CHPP+  CP CTA V KPCKCGK+  VRT+CF +DVSCG++C + L +C 
Sbjct: 537 DCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCY 596

Query: 593 HTCQKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651
           H CQKKCH+ G CQ  C+Q C   R+ C+H+CPKPCH  E CPD PC   V I C CGR 
Sbjct: 597 HKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRI 656

Query: 652 ESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS-------VENT 704
           E    CG  S+   A  +  + CDEEC  ++R  QLK+A G+ +   ++       +E  
Sbjct: 657 EKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQV 716

Query: 705 VSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQ 764
           +S    AS F +L LPF E V+  Y R + +C +IE+ LN  IDD  ++SLHFKPM+P Q
Sbjct: 717 IS---TASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQ 773

Query: 765 RHFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKET 824
           R+F+ ELAKAY LYSESQDPEP RSV+VKK L+G S KP +++ EA P+YQ++K+ EKE 
Sbjct: 774 RYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEK 833

Query: 825 KIRRYEMQNVTNLVNFVPKFEPTVE-LAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLV 883
           K   +E    T L+NF P+  P +E  A++NGFL+ N+ + T+ +DLQ ++  +LK TLV
Sbjct: 834 KQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLV 893

Query: 884 RNPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEY 943
             P ++ LP+R  A+I+P  Y ++++N E DME LV HFDF+ KE  +  GVELC +   
Sbjct: 894 VEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENV 953

Query: 944 L 944
           L
Sbjct: 954 L 954

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/901 (52%), Positives = 609/901 (67%), Gaps = 14/901 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           ++YYE+ +++I++GD Y CMICT+EMDYTCKM+AC  CYRVFDY+CI+EWA KS  +T+D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           K WKCPNC   S ++P ++RPTCWCGKV+          SCGQTC+   C HGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVG-SGRNQQFTCEESCGLLLPCGVHKCSKKCHS 234
           GPH EC+ I ++KCKCGR+ +D+ C ++  S +N  + C E C L L CGVHKC + CHS
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 235 GLCGGCNETLHSK------PDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIG 288
           GLCG C E L S+       ++    KCYCG +    I C             +G+ WIG
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284

Query: 289 VFRCKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARV 348
            F CK  R+V YAC +HSF+E C+   S+  +  CP++P +L SCPCG+T L +L Q R 
Sbjct: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344

Query: 349 KCTDHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFRE 408
           KCTD IPTCE++CGK L CGKHTCPY CH G CMDPC+Q E TNC C  + FLVPC F +
Sbjct: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404

Query: 409 DPRCNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCN 468
            P+C  KCESLMSCRRHRC +KCC+GKP A++RKK   T  EL DESLVEA H+CLK CN
Sbjct: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464

Query: 469 LTLTCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVV 528
           L L+CG H C RKCHPGRCP CL SD NDLVCPCGKTV+EAPVRCG+KLPPCP+ CI V+
Sbjct: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524

Query: 529 RDGYPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPL 588
              YPCGH P PH CHP  E CPPCTA V++PCKCGK   V+ +CFQ+  SCG+ICNK L
Sbjct: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584

Query: 589 GSCRHTCQKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCA 647
            +C H CQ KCH+ G CQ  C+Q+C K R NC+H+C   CHG  PCPD PC     + C 
Sbjct: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644

Query: 648 CGRKESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS---VENT 704
           CGRK+    C       SAS+   L CDE+CE   R  QL+DA G   + D+S   +++ 
Sbjct: 645 CGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDI 703

Query: 705 VSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQ 764
            S     S +EEL LP+ ++V++ YS+Q ++C  IE +L  F+ D+ K++LHFKPMKPAQ
Sbjct: 704 QSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQ 763

Query: 765 RHFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKET 824
           RHFV EL+ ++ LYSESQDPEPKRSV+VK+++  ++  P+I+L+E LP++  FK+ EKE 
Sbjct: 764 RHFVRELSTSFNLYSESQDPEPKRSVFVKRKV--DTRIPNISLEEVLPLWTGFKKLEKER 821

Query: 825 KIRRYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVR 884
           KI+ +E  +    +N+ PK          NGF I+ ++ G   EDL  ++G+ LK TL++
Sbjct: 822 KIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIK 881

Query: 885 NPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944
           N  YK LP+ + A+I+PE Y+ +T +   D+E LVGHFDFI KE  I D + LC V  Y+
Sbjct: 882 NVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYI 941

Query: 945 Q 945
            
Sbjct: 942 N 942

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/908 (52%), Positives = 613/908 (67%), Gaps = 18/908 (1%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           +M+YERA+K+IA+GD Y CMICT+E+D T KM+ACS CYRVFDYDCIREWA+KS+ +++D
Sbjct: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           K WKCPNC   SNK+P ++RPTCWCGK V          SCGQTC+A  C H CS  CHL
Sbjct: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEV--GSGRNQQFTCEESCGLLLPCGVHKCSKKCH 233
           GPHP+C R  +I C+CG+HT+DV C  +  G  RN++F C E C + L CG+HKCS+ CH
Sbjct: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245

Query: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXX--XXXXXQGNGWIGVFR 291
           SG CG C E +  K      + CYCG      IRC               +GN WIGVF+
Sbjct: 246 SGSCGPCPELITKK------VNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFK 299

Query: 292 CKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCT 351
           C  +R VEYAC  HSF E+C   P++     CP+SP +L++CPCG+T L+     R KCT
Sbjct: 300 CNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCT 359

Query: 352 DHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPR 411
           D I TCE++C K L CGKH CP+ CH G CMDPC Q E   C C  + F VPCQF E PR
Sbjct: 360 DPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPR 419

Query: 412 CNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTL 471
           CN KCESLMSCRRHRCT +CCSGKP A++RKK  F+  +LLDESLVEAEH+CLK CNL L
Sbjct: 420 CNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKL 479

Query: 472 TCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDG 531
           +CG H C RKCH G+CPPCLESD +DLVCPCGKTVVEAPVRCGTKLP C + CI  +   
Sbjct: 480 SCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGS 539

Query: 532 YPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSC 591
           YPCGH P  H CHP +  CPPCT  V KPCKCGK+   + LCFQ+  SCG++C K L  C
Sbjct: 540 YPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGC 599

Query: 592 RHTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGR 650
            H CQ KCH  G CQ KC QIC K+RVNC H C + CHG   CPD PC     + C CGR
Sbjct: 600 HHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGR 659

Query: 651 KESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLK---ENGDSSVENTVSN 707
           ++    CG  S T S  +T+ L CD+ C + +R  +L++A G+K   E+ +S +E     
Sbjct: 660 RKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKI 719

Query: 708 ALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHF 767
               +++EEL LPF ETVL++YS+Q  +C+ IE ++N F++D+ K SLHFKPM   QR+F
Sbjct: 720 VEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNF 779

Query: 768 VHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIR 827
           +H L +AY++YSESQD EPKRSVY+KK  N  +  P+I+L+EALP+YQ++K+ EKE K++
Sbjct: 780 IHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKERKVQ 837

Query: 828 RYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPV 887
            +E +     +N+ P         KYNGFLI+ +T GT  +DL  ++G HLKPTL+++  
Sbjct: 838 SFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQ 897

Query: 888 YKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPE 947
           Y  LPD   A+++P+ Y  ++ N E D+E L GHFD++ KE  +G+ VE+C + + LQ E
Sbjct: 898 YSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQTE 957

Query: 948 A--PTESS 953
           +  P+E +
Sbjct: 958 SAEPSEET 965

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/895 (52%), Positives = 599/895 (66%), Gaps = 16/895 (1%)

Query: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117
           YYE+ +KEIA+GD Y CMICTVEMD+TC M+AC +CYRVFDY+CIREWA+KST +++ KT
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHLGP 177
           WKCPNC  E   VP K+RPTCWCGK +          SCGQTCDAPIC HGCS  CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237
           HP C R++  KC+CG+ ++DV CSE      + F C   CGL LPCGVHKC ++CH+G+C
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFCSE-ARKHQELFRCGNPCGLTLPCGVHKCQRECHNGVC 241

Query: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDVRV 297
           G C ET+  +      I CYCGL   PSI+C              G  WIG F C  +R 
Sbjct: 242 GECPETIAKE------INCYCGLESLPSIKC-QDVKIQSKSQDGSGKKWIGAFACSRIRT 294

Query: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357
           VEY+C +HSF E CK  PS+  +I CP+SP  L++CPCG TPL  +   R KCTD IPTC
Sbjct: 295 VEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTC 354

Query: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417
           ++ CGK L+CG+H CP+KCH G CM+ C   +K  C C +R F+VPC+F+  PRCNTKCE
Sbjct: 355 DATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCE 414

Query: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477
           SLMSCRRHRC E+CC G+  A+ R+K  F +R+ LDESLVEA+H+CLK CNL L+CGRH 
Sbjct: 415 SLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHF 474

Query: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537
           CQRKCHPG CPPCLESD NDLVCPCGKTV  APVRCGT LPPC   CI  ++    CGH 
Sbjct: 475 CQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHP 534

Query: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQK 597
           PMPH CH  +E CP CTA V K CKCGK   VRTLCFQ +VSCG++C K L SC H+C K
Sbjct: 535 PMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTK 594

Query: 598 KCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEP 656
            CH +G CQ  C+Q+CG  R NC H C   CH G PCPD PC  +V +KC CG + S   
Sbjct: 595 TCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFAT 654

Query: 657 CGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVA---SN 713
           C  +     A   R L C E+C   +R  +L +A G+        E  V  A +A   + 
Sbjct: 655 CAAHEGQDPAD-QRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTT 713

Query: 714 FEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAK 773
           F+EL LPF E  L+I+++Q  +C  IE  LN  + D  K SLHFKPMKP QRHF+HELA+
Sbjct: 714 FQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQ 773

Query: 774 AYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQN 833
           AYKLY ESQD EPKRSVYVKK ++  S KPS++L+EALP+YQ+FK  +KE K++  E   
Sbjct: 774 AYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERKLKELERST 831

Query: 834 VTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPD 893
            T ++N+    E +  +A+ NG LI+ + +GT+ + ++  + ++LK TL+++P Y  L D
Sbjct: 832 TTRILNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKL-D 890

Query: 894 RNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEA 948
               ++F E+Y+  ++N E D+ R+VGH D I K+ F+ +GV +C+V + +  E 
Sbjct: 891 SGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEET 945

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/909 (51%), Positives = 608/909 (66%), Gaps = 21/909 (2%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           + YYE+ + EI +GD+Y CMICT+EMDYTC M+AC +CYRV+D++CIREWALKS+ +++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
           KTWKCPNC   ++++P K+R TCWCGKVV          SCGQTC+APIC HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHPEC R   +KC CG+HT+D+ C +        + C E C LLLPCGVHKC +KCHSG
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQ-SEEEKASYQCGEPCNLLLPCGVHKCQRKCHSG 226

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDV 295
            CG C ET+  K      I CYCG+     I C              G  WIGVF C  +
Sbjct: 227 PCGNCEETISGK------IMCYCGMETREQIIC-KDVKSVAKSKNKSGEIWIGVFSCAHL 279

Query: 296 RVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIP 355
           R VEY+CG HSF ESC   P+   ++ CPFSP +L++CPCG TPL  L   R KCTD IP
Sbjct: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339

Query: 356 TCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTK 415
           TCE++C K L CGKH+CP+ CH+G CMDPCV  +K +C C ++SFLVPCQF ++  CNTK
Sbjct: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399

Query: 416 CESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGR 475
           CESLMSCRRHRCTE+CCSG+  A +R+KT F +R+ LDESLVEA+H+CLK CNL L+CG 
Sbjct: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGI 459

Query: 476 HKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCG 535
           H C+RKCHPG+C PCLESD NDL CPCGKTVV APVRCGTKLPPC + CI  ++    CG
Sbjct: 460 HYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCG 519

Query: 536 HTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTC 595
           H PMPH CH  E+ CP CTA + K CKC K   VRTLCFQ DVSCG+IC  PL +C HTC
Sbjct: 520 HPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTC 579

Query: 596 QKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654
           ++ CH+ G CQ  C+QICG  R  C+HKC   CH G+ CPD  C   V + C+CGRKES 
Sbjct: 580 KRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESI 639

Query: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714
            PC  ++   S+ +   L CD++CE  KR   L +A G+KE   + VE        A +F
Sbjct: 640 LPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSF 699

Query: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774
           +EL LPF E+ L++YS+Q+ +C+ IES L+  + D  ++SLHFKPMK  QR F+HELA A
Sbjct: 700 DELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANA 759

Query: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNV 834
           Y LYSESQD EPKRSV+VKK +  +S+ P + L EALP+Y +FKQ +KE K++  E    
Sbjct: 760 YALYSESQDREPKRSVFVKK-VENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTT 818

Query: 835 TNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPD 893
             L N+ V         A++N FL++ +  G   ++L     E+L+ TL++NP Y+ L +
Sbjct: 819 RRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLEN 878

Query: 894 RNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVG---------EYL 944
            +  LI+PE +  ++ N E D++RL  +   ICKE  I +GV+L ++          EYL
Sbjct: 879 GDF-LIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEEYL 937

Query: 945 QPEAPTESS 953
           Q E P + +
Sbjct: 938 QEEQPEKQA 946

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/892 (52%), Positives = 605/892 (67%), Gaps = 17/892 (1%)

Query: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117
           YYE+ VKEI +GD Y CMICTVEMD+TC M+AC  CYRVFD++CIREWALKST +++ KT
Sbjct: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104

Query: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHLGP 177
           WKCPNC  E  +VP K+RPTCWCGK V          SCGQTCDA ICEHGCS +CHLGP
Sbjct: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164

Query: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237
           HP C R++ +KC CG+  + V C E G   +  F C+  CGL LPCG+HKC +KCHSG+C
Sbjct: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDS-FICDSPCGLTLPCGIHKCQRKCHSGIC 223

Query: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDVRV 297
           G C E+++        I CYC L   PS++C              GN W+G F C+++R 
Sbjct: 224 GECPESIY------GTINCYCKLESKPSLKC-TEVRIEGRSRDSSGNKWVGAFSCENIRT 276

Query: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357
           VE++C +HSF E CK  PS+  Q+ CPFSP  L++CPCGR+PL ++  +R +CTD IPTC
Sbjct: 277 VEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTC 336

Query: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417
           +S CGK L CGKH CP+KCH G CM+ C+  +K  C C AR F+VPC+F+E  RCNTKCE
Sbjct: 337 DSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCE 396

Query: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477
           +LMSCRRHRC E+CC G+  A+ R+K  F +R+ LDESLVEA+H+CLK CNL L+CG+H 
Sbjct: 397 ALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHF 456

Query: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537
           C+RKCHPG C PCLESD NDLVCPCGKTVV APVRCGT LP C + CI  ++   PCGH 
Sbjct: 457 CKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHP 516

Query: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQK 597
           PMPH CHP EE CP CTA V K CKC K   VRTLCFQ DVSCG++C K L  C+H CQK
Sbjct: 517 PMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQK 576

Query: 598 KCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEP 656
            CH +G CQ  C+Q CGK R NC+H+C   CH G PCPD PC   V IKC CG + +T  
Sbjct: 577 ACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVT 636

Query: 657 CGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKEN---GDSSVENTVSNALVASN 713
           CG N     A  T  L C+ +C+  +R  +L +A G+K +   G  S+E+  + A   S 
Sbjct: 637 CGANENRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVST 695

Query: 714 FEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAK 773
           F+EL LPF E  L+I+S+Q  +C  IE  L   ++D+ K SLHFKPM+P QRHF+HEL +
Sbjct: 696 FQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQ 755

Query: 774 AYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQN 833
           AY LY ESQD EPKRSV+VKK    +S +PSI+L+ ALP+Y +FK  ++E K++  E   
Sbjct: 756 AYHLYCESQDQEPKRSVFVKK--TADSQRPSISLKVALPLYYSFKSAQREKKLKETERHT 813

Query: 834 VTNLVNF-VPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALP 892
            T ++N+ V     T   A++NG L++N+ +G N + +Q  + E+LK TL+++P Y  L 
Sbjct: 814 TTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLA 873

Query: 893 DRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944
             ++ L++ + YS  +VN E D+ER+VGH D I KE  + +GV   +V  +L
Sbjct: 874 SGDV-LVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/893 (51%), Positives = 580/893 (64%), Gaps = 17/893 (1%)

Query: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117
           YYE+ VKEI  GD YVCMICTVE+D TC+M+AC  CYRVFDY+C+REWALKST +T+DK+
Sbjct: 34  YYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKS 93

Query: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHLGP 177
           WKCPNC   ++K+P++ R TCWCGKVV          SCGQTC+A  C HGCSKVCHLGP
Sbjct: 94  WKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGP 153

Query: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237
           HPEC   + IKCKCG+H + + CS      N  + C + CGLLLPCG H C K CH+G C
Sbjct: 154 HPECLIPVQIKCKCGKHCKQIPCSRSKVLGNS-YNCGDVCGLLLPCGKHTCQKTCHTGFC 212

Query: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDVRV 297
           G C   + ++      + CYCG      I+C              G  WIGV+ C +VR 
Sbjct: 213 GPCESIIKTE------LPCYCGSDVKSGIQCSDLRVLDYSKDV-SGKKWIGVYSCGEVRT 265

Query: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357
           + Y+C  H++VE C     + +   CPFSP  L++CPCG+T L +L + R KCTD IPTC
Sbjct: 266 LHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTC 325

Query: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417
            + CGK+L+CGKHTCP+ CH GDCMDPC+   KT C C +++FL PCQ  + PRCN KCE
Sbjct: 326 SNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCE 385

Query: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477
           S MSCRRH+C E CCSGKP A++R+KT F  R+L +E+LVE EHVCLK CNL L+CG H 
Sbjct: 386 SNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHD 445

Query: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537
           C  KCHPG+CPPCLESDPNDLVCPCGKTVV APVRCGTKLPPCP  CI +     PCGH 
Sbjct: 446 CTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHR 505

Query: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQD--VSCGQICNKPLGSCRHTC 595
             PH CHP    CPPCTANV K C+C KK D+RTLC   D  V+CG  C  PL +C H C
Sbjct: 506 VGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKC 565

Query: 596 QKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654
           QKKCH +G C++KC + CG KR  C H C + CHG  PCP+  C   VVI C C R+   
Sbjct: 566 QKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQ 625

Query: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714
             CG    T S S T +L CDEEC +++R  +L +A G+ E   ++ E   S  LVA  F
Sbjct: 626 VECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKF 685

Query: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774
           ++L +P+ E VL +Y +Q  +CD I +V + FI+D +K SLH KPM+  QR F+ ELA A
Sbjct: 686 DDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASA 745

Query: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNV 834
           Y LYSESQD EP RSVY+KK +  +S KP +TL++A  +YQ FK  EKE     Y  +  
Sbjct: 746 YALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVT 804

Query: 835 TNLVNFVPKFEPTVELAKY---NGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKAL 891
             L+N +P  E  +  A Y   N  +I  + D +  ++++ +  + LK TLV+ P Y+ L
Sbjct: 805 KTLIN-IPASETPLP-APYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFL 862

Query: 892 PDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944
            D N  LIFPE+YS +T NT  DME+++       ++  +  GVE+CQV E L
Sbjct: 863 KDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/886 (48%), Positives = 562/886 (63%), Gaps = 21/886 (2%)

Query: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115
           + YYE+A+K+I  G  Y C+ICTVE+D TC+M+ACS CYRV+DY+CI EWA KS+ R+ D
Sbjct: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87

Query: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHL 175
            TWKCPNC    NKV  K R TCWCGK +          SCGQTC A IC+HGC+  CHL
Sbjct: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147

Query: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235
           GPHP+C   + +KCKCG+ T  + C +  + +  + +C+  CGL LPCGVH C K CHSG
Sbjct: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVK-PKLSCKLPCGLPLPCGVHTCQKICHSG 206

Query: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDV 295
            CG CN  +  K       KCYCG +   SI C             +   WIGVF CK++
Sbjct: 207 PCGRCNTVMSGK------FKCYCGSNHLDSIIC-KDVAVTKMSRSGKHKKWIGVFSCKNI 259

Query: 296 RVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIP 355
           R V Y C +HSF ESCKP+PS   +I CP+SPN+ ++C CG T L  + Q R KCTD IP
Sbjct: 260 REVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIP 319

Query: 356 TCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTK 415
           TC+ +CGK L+CGKHTCP  CH G CMDPC+Q E+  C C+ R+FL PCQF   P CN K
Sbjct: 320 TCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIK 379

Query: 416 CESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGR 475
           CE+LMSCRRHRC ++CCSGKP A  R  T     +  DESL+EAEH+C K+CN  L+CG 
Sbjct: 380 CENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGL 439

Query: 476 HKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCG 535
           H C  KCHPG+CPPCLESD NDLVCPCGK+V+ APVRCGT  P C Y CI+ +R   PCG
Sbjct: 440 HHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCG 499

Query: 536 HTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTC 595
           H    H CHP  E CPPCTA V KPCKCGK +  RT+CFQ D+SCG+ C   L +C H C
Sbjct: 500 HRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLC 559

Query: 596 QKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654
           QK+CH  G C   C ++CG KR  C+H C   CHG E CPD PC   VV+ C CGR+   
Sbjct: 560 QKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLK 619

Query: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714
            PCG      SA+ T+ L CD++C +V++   L   L   E+ + +   + S     +++
Sbjct: 620 VPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSY 679

Query: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774
           E+LGLP+ E ++ ++S+Q  +C NI+  L   ++D+ + SLHFKPMK  QR FVHEL+KA
Sbjct: 680 EDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKA 739

Query: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQ-N 833
           + LYSESQD EPKRSV+VK  +   S  P+I L EAL +YQ  K  +KE   R  E+Q N
Sbjct: 740 FGLYSESQDREPKRSVFVK--ILKTSKIPAIGLSEALLLYQRMKTFQKER--RDLELQHN 795

Query: 834 VTNLVNFVP----KFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYK 889
            T ++  +P        T+E A  N  LI  +      E+++  + E LK TL+++P ++
Sbjct: 796 TTKILISIPIDDGSDSKTLE-ASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFR 854

Query: 890 ALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGV 935
            +   + A I+P ++ +++ N E D++RLV +F  +C+   IG  V
Sbjct: 855 LI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/903 (47%), Positives = 555/903 (61%), Gaps = 28/903 (3%)

Query: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117
           YYE+ V E+  G+TY C+ICTVEMD +C M+AC +CYRV+DY+CIR WALK+T  T+D+T
Sbjct: 18  YYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVDRT 77

Query: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVXXXXXXXXXXSCGQTCDAPICEHGCSKVCHLGP 177
           WKCPNC   + KVP K+R TCWCGK V          SCGQTC APIC+HGCSK+CHLGP
Sbjct: 78  WKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHLGP 137

Query: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237
           H EC   I  KC+CG+ T ++ C E  + + + F+C++ CGL +PCG+HKC + CH+G C
Sbjct: 138 HEECMVRIDFKCRCGKLTEEIPCYEAKAAK-RNFSCDQPCGLPMPCGIHKCERVCHNGPC 196

Query: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGXXXXXXXXXXXXQGNGWIGVFRCKDVRV 297
           G C E +         IKCYCGL     + C             +   WIG F C  +R 
Sbjct: 197 GPCKEEI------AGDIKCYCGLTTRNKMVCSEVSVVARSKVS-KYKSWIGAFACDRMRE 249

Query: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357
           V Y+CG+HSF E C   PSLPK+  CP+SP    +CPCG+T L +LG  R  CTDHI +C
Sbjct: 250 VPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSC 309

Query: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417
              CGK+L+CG HTCP  CH+G+CMDPC+   +  C CE R FLVPCQF   P C  KCE
Sbjct: 310 GKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCE 369

Query: 418 SLMSCRRHRCTEKCCSGKP-----GAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLT 472
           SLMSCRRHRC E+CCSG+P      + RR+++P       DES VEA+HVCLK CN  L 
Sbjct: 370 SLMSCRRHRCAERCCSGRPHSVKRNSRRRRESPD------DESEVEAQHVCLKDCNRVLL 423

Query: 473 CGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGY 532
           CG H C  KCH G+CPPCLESD NDL+CPCGKT+V APVRCGTKLP C + C + + D +
Sbjct: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483

Query: 533 PCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCR 592
           PCGH+P  H CHP +E CPPCT  VKK C+CG K+++RT C+  DVSC + C KPL  C 
Sbjct: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542

Query: 593 HTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRK 651
           H CQ  CH DG CQ  C+Q CG  R  C+H C   CHG   CP+ PC     I C+CG K
Sbjct: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602

Query: 652 ESTEPCGTNS-QTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALV 710
            ST+ C   + +      ++ LSCDE+C + +R  QL  A G+ E   S  +  +  A  
Sbjct: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQR 662

Query: 711 ASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHE 770
           + +F++L LPF E VL+++++Q ++C  IE  L   +DD    +LHFKPM+ AQR FVHE
Sbjct: 663 SQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHE 722

Query: 771 LAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYE 830
           L+ ++ LYSESQDPEPKRSVYVKK   G S  P+I L +A P+Y +FK+ E+E K    E
Sbjct: 723 LSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKANS-E 779

Query: 831 MQNVTNLVNFVPKFEPTVEL-AKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYK 889
                 LV+      P  +  A  N  L+  LT   +   L+  + ++   TL+  P Y 
Sbjct: 780 SAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY- 838

Query: 890 ALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAP 949
            +       IFP  Y  ++ N E D+ +L G+F  + +E  +   +  C++   L     
Sbjct: 839 -VVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGS 897

Query: 950 TES 952
            ES
Sbjct: 898 CES 900

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 35.8 bits (81), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 76/189 (40%), Gaps = 39/189 (20%)

Query: 672 LSCDEECERVKRCAQLKDALGLKENG-------DSSVENTVSNALVASNFEELGLP--FR 722
           ++ D   E + +  +  +ALG    G       DSS  +       A+NF +      F 
Sbjct: 185 ITTDARAEELHQSNKEINALGTINGGSFNSFLGDSSGISFARLVFTATNFRQDSGDDVFD 244

Query: 723 ETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSESQ 782
           E    I  R+Q+Y + +E+          ++SL F P++   RH    +   + + + SQ
Sbjct: 245 ED---IKQREQKYKEYVEA----------ENSLKFDPLELPPRHVAEVMISRFFVDTNSQ 291

Query: 783 DPEPKRSVYVKK-----------ELNGESNKPSITLQEALPIYQAF------KQREKETK 825
            P   R ++++K           ++   S+K +I  +  +P+   F      K      K
Sbjct: 292 LPLLHRELFLRKYFEPIYGPWNSDITLASDKTNINTEFEIPVTSTFASHTEQKHGNNNNK 351

Query: 826 IRRYEMQNV 834
           I R+  +NV
Sbjct: 352 INRFSSENV 360

>KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}
           similar to uniprot|P10080 Saccharomyces cerevisiae
           YHL034C SBP1 Single-strand nucleic acid binding protein
          Length = 242

 Score = 35.0 bits (79), Expect = 0.72,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 9/67 (13%)

Query: 857 LIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIFPESYSDVTVNTECDME 916
            + NL+  T+ EDLQ+++GE +K   V  P  ++  DR     +P  ++ VT + + D+E
Sbjct: 20  FVGNLSPETSPEDLQKVFGESVK---VEIPTLQS--DRT----YPRIFAFVTFDDKVDVE 70

Query: 917 RLVGHFD 923
            L   FD
Sbjct: 71  DLRSKFD 77

>TBLA0F02080 Chr6 complement(509605..511809) [2205 bp, 734 aa] {ON}
           Anc_7.304 YDL189W
          Length = 734

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 729 YSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKL 777
           Y RQ  +  NIES++ NFI D   ++L+  PM    R   H++A+ + L
Sbjct: 97  YDRQ--FIINIESLIVNFI-DSNDTNLNLNPMNSYYRLLSHQIAQYHNL 142

>Kpol_340.8 s340 (17972..20812) [2841 bp, 946 aa] {ON}
           (17972..20812) [2841 nt, 947 aa]
          Length = 946

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 17/112 (15%)

Query: 670 RELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNFEEL-----------G 718
           +++S DE  E  K+ A LK A  L     S + N V      +N E+             
Sbjct: 400 KKISLDEISE--KQLAYLKFAFDLI----SHIFNNVIAKGWENNLEKYEYLAMVRIVICW 453

Query: 719 LPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHE 770
           +   ++V+    R +++CD+  ++LNNF+  +K + +    ++P + +F  E
Sbjct: 454 IKSNKSVIQYSHRNRKFCDSFVNLLNNFLSSKKFTEMTIPDVRPGRAYFFQE 505

>NCAS0G01380 Chr7 complement(246345..248657) [2313 bp, 770 aa] {ON}
           Anc_2.17 YNL224C
          Length = 770

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 735 YCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYS 779
           +  NI   L++F++D  +SSL F P+ P     V + AK Y + S
Sbjct: 594 HVQNIRDELDSFLNDTNRSSLFFPPLDPHGNKTVSKFAKHYYMKS 638

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 22/132 (16%)

Query: 672 LSCDEECERVKRCAQLKDALG-LKEN------GDSSVENTVSNALVASNFEELGLPFRET 724
           ++ D   E ++RC +   ALG ++E+      GDSS  +       A+NF +      + 
Sbjct: 191 MTSDARAEELRRCNKEISALGTMRESSFNSFLGDSSGISFAKLVFTATNFRQDS---GDD 247

Query: 725 VLA--IYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSESQ 782
           VL   I  R+Q+Y        N + + E     HF P++   RH    +   + + + SQ
Sbjct: 248 VLDEDIKQREQKY--------NGYAEAENNP--HFDPLELPPRHAAEVMISRFFVDTNSQ 297

Query: 783 DPEPKRSVYVKK 794
            P   R +++KK
Sbjct: 298 LPLLHRELFLKK 309

>CAGL0J09130g Chr10 (902880..904658) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|Q05672 Saccharomyces
           cerevisiae YDL189w
          Length = 592

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 715 EELGL-PFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAK 773
           EELGL P   T L      +++  + E  + NFID   ++SL  +PM    R   H++A+
Sbjct: 23  EELGLSPAMITALFKRPHDRQFIIDKEQAIINFID-SNQNSLELRPMNSYYRMLSHQIAE 81

Query: 774 AYKL 777
            + L
Sbjct: 82  YHHL 85

>Kpol_520.33 s520 (83358..84752) [1395 bp, 464 aa] {ON}
           (83358..84752) [1395 nt, 465 aa]
          Length = 464

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 57  MYYERAVKEIARGDTYVCMICT------VEMDYTCKMFACSKCYRVFDYDCIREW 105
           ++Y +A  ++++  TY C+ C       V+ D    M  C+KC  VF +DC+  W
Sbjct: 277 LHYNQAATKLSKHCTYACVTCRRCDQWCVKEDLDDSMVRCNKCEFVFCFDCLHSW 331

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,830,893
Number of extensions: 4249263
Number of successful extensions: 10413
Number of sequences better than 10.0: 64
Number of HSP's gapped: 9507
Number of HSP's successfully gapped: 72
Length of query: 953
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 834
Effective length of database: 39,836,145
Effective search space: 33223344930
Effective search space used: 33223344930
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)