Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01914g2.287ON36836818540.0
TDEL0G021802.287ON36935116310.0
Smik_9.852.287ON37135016010.0
Suva_9.1052.287ON37135016000.0
YIL094C (LYS12)2.287ON37135015970.0
CAGL0G02585g2.287ON37235015870.0
Skud_9.792.287ON37135015810.0
KNAG0A054202.287ON37235015590.0
NCAS0B062502.287ON37335015580.0
KLTH0G10384g2.287ON36735015430.0
NDAI0B035502.287ON37235115360.0
KLLA0E08339g2.287ON36935015310.0
SAKL0E07656g2.287ON36835015220.0
Kwal_27.115282.287ON36735015160.0
Kpol_1003.392.287ON37034914950.0
TPHA0C034102.287ON37134914620.0
KAFR0J013602.287ON37335114600.0
TBLA0B059402.287ON36935014390.0
Ecym_33262.287ON36635014050.0
ADL214C2.287ON36735013290.0
KLLA0E03125g5.473ON3683594586e-53
NCAS0H022505.473ON4223524591e-52
NDAI0C014105.473ON3693544517e-52
CAGL0I07227g5.473ON3683604508e-52
KNAG0B040705.473ON3733524518e-52
Ecym_23135.473ON3703594508e-52
TPHA0D015602.278ON3603504491e-51
Suva_8.1885.473ON3693524482e-51
TPHA0J027705.473ON3763524473e-51
ADL223W2.278ON3623494463e-51
Smik_15.3165.473ON3693524464e-51
Kwal_55.212735.473ON3683524412e-50
KLTH0F15048g5.473ON3683544394e-50
Kpol_543.85.473ON3683544394e-50
Kpol_440.125.473ON3683524384e-50
SAKL0G03520g5.473ON3693584378e-50
TDEL0C038402.278ON3613494351e-49
Skud_15.3005.473ON3693584351e-49
YOR136W (IDH2)5.473ON3693584352e-49
KAFR0J014102.278ON3503564323e-49
ZYRO0D11220g5.473ON3683534315e-49
TBLA0B022405.473ON3733544316e-49
Smik_14.2902.278ON3603494298e-49
Kpol_1039.352.278ON3593514298e-49
YNL037C (IDH1)2.278ON3603494262e-48
KAFR0B063705.473ON3783594254e-48
AFR137C5.473ON3673524245e-48
Ecym_33162.278ON3623494246e-48
Skud_14.2932.278ON3613494221e-47
KLLA0F04103g2.278ON3613494211e-47
TDEL0A033705.473ON3713664212e-47
Kwal_23.50122.278ON3613524202e-47
TPHA0E014805.473ON3773504202e-47
NCAS0B062902.278ON3593514132e-46
SAKL0E07876g2.278ON3613514081e-45
KLTH0G10186g2.278ON3603524072e-45
NDAI0B035902.278ON3593494044e-45
TBLA0B069102.278ON3653524028e-45
CAGL0G02673g2.278ON3583494002e-44
ZYRO0D02838g2.278ON3613523992e-44
KNAG0A052802.278ON3613523923e-43
TBLA0C015001.402ON3653683749e-41
Ecym_12961.402ON3633653704e-40
YCL018W (LEU2)1.402ON3643693582e-38
Skud_3.431.402ON3643693582e-38
KLTH0H12188g1.402ON3643643563e-38
Smik_3.661.402ON3643693564e-38
KLLA0D04906g1.402ON3623663547e-38
AAL012C1.402ON3723663531e-37
Kwal_0.2251.402ON3643603469e-37
NDAI0G042301.402ON3633643442e-36
TDEL0B060001.402ON3623663432e-36
Suva_14.3022.278ON3002913367e-36
KNAG0I012801.402ON4473643457e-36
Kpol_1048.631.402ON3643663363e-35
Suva_3.31.402ON3643693354e-35
ZYRO0E04796g1.402ON3623673312e-34
CAGL0H03795g1.402ON3653643214e-33
NCAS0C048701.402ON3653653205e-33
KAFR0I022001.402ON3653613181e-32
SAKL0D08690g1.402ON3643693181e-32
TPHA0B037301.402ON3653722855e-28
CAGL0D00770g4.254ON4232221345e-08
KNAG0I013201.396ON4121061311e-07
CAGL0H03663g1.396ON4181061311e-07
NCAS0A087201.396ON4131061302e-07
YNL009W (IDP3)1.396ON4201911302e-07
KAFR0H031601.396ON4211331292e-07
Kwal_23.42104.254ON4221481292e-07
Kpol_1048.701.396ON4191061282e-07
KAFR0I021301.396ON4081061274e-07
Ecym_13061.396ON4151261274e-07
Kpol_1055.784.254ON4271571265e-07
YDL066W (IDP1)4.254ON4281061256e-07
Suva_4.1844.254ON4291061257e-07
TPHA0B022104.254ON4331491248e-07
TBLA0C012901.396ON4181061248e-07
KLTH0H12012g1.396ON4131411248e-07
NDAI0D043604.254ON4241061249e-07
Skud_4.1894.254ON4291061231e-06
NCAS0G036201.396ON4181961231e-06
ZYRO0E05016g1.396ON4111441231e-06
AAL022W1.396ON4151261221e-06
KNAG0D044104.254ON4281711231e-06
KNAG0H016701.396ON4241061221e-06
TDEL0E011604.254ON4232111222e-06
Smik_4.1694.254ON4281061212e-06
SAKL0H02860g4.254ON4211331212e-06
NDAI0G008501.396ON4191061202e-06
AER061C4.254ON4251791203e-06
Smik_14.3191.396ON4181261193e-06
Kwal_0.1911.396ON4111411185e-06
NCAS0A025104.254ON4262111185e-06
CAGL0B04917g1.396ON4111301175e-06
TDEL0B061001.396ON4141261176e-06
SAKL0D08426g1.396ON4111411177e-06
KLTH0D14476g4.254ON4201501167e-06
TBLA0A080104.254ON4281091169e-06
KAFR0G032604.254ON4211471169e-06
KLLA0F12342g1.396ON4151061159e-06
KLLA0B03355g4.254ON4291061151e-05
Skud_12.2391.396ON4121061151e-05
Smik_12.2351.396ON4121061132e-05
Skud_14.3181.396ON4201261122e-05
YLR174W (IDP2)1.396ON4121061113e-05
TPHA0B036601.396ON4221061113e-05
ZYRO0B12496g4.254ON4221261113e-05
Suva_10.2711.396ON4121261095e-05
Ecym_32654.254ON4241061079e-05
Suva_14.3391.396ON4171711071e-04
NDAI0G051601.396ON4201061007e-04
Suva_14.303singletonON5350830.005
KNAG0A037508.531ON83085850.066
KLLA0C17380g4.39ON111994741.4
KAFR0A053703.455ON120177704.0
KNAG0F002201.32ON36857686.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01914g
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   718   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   632   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   621   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   620   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   619   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   615   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   613   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              605   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   604   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   598   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   596   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   594   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   590   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   588   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   580   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   567   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   566   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   558   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   545   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   516   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   181   6e-53
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    181   1e-52
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   178   7e-52
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   177   8e-52
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   178   8e-52
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   177   8e-52
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   177   1e-51
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   177   2e-51
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   176   3e-51
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   176   3e-51
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   176   4e-51
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   174   2e-50
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   173   4e-50
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   173   4e-50
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   173   4e-50
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   172   8e-50
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   172   1e-49
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   172   1e-49
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   172   2e-49
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   171   3e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   170   5e-49
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   170   6e-49
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   169   8e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   169   8e-49
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   168   2e-48
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   168   4e-48
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   167   5e-48
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   167   6e-48
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   167   1e-47
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   166   1e-47
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   166   2e-47
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   166   2e-47
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   166   2e-47
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   163   2e-46
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   161   1e-45
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   161   2e-45
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   160   4e-45
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            159   8e-45
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   158   2e-44
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   158   2e-44
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              155   3e-43
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   148   9e-41
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   147   4e-40
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   142   2e-38
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   142   2e-38
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   141   3e-38
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   141   4e-38
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   140   7e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   140   1e-37
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   137   9e-37
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   137   2e-36
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   136   2e-36
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   134   7e-36
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   137   7e-36
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   134   3e-35
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      133   4e-35
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   132   2e-34
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             128   4e-33
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   127   5e-33
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   127   1e-32
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   127   1e-32
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   114   5e-28
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    56   5e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    55   1e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    55   1e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    55   2e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    55   2e-07
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    54   2e-07
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    54   2e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   2e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    54   4e-07
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    54   4e-07
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    53   5e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    53   6e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    53   7e-07
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    52   8e-07
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    52   8e-07
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    52   8e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    52   9e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    52   1e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    52   1e-06
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    52   1e-06
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    52   1e-06
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    52   1e-06
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    52   1e-06
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    52   2e-06
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    51   2e-06
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    51   2e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     51   2e-06
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    51   3e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    50   3e-06
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    50   5e-06
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    50   5e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    50   5e-06
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    50   6e-06
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    50   7e-06
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    49   7e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    49   9e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    49   9e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    49   9e-06
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    49   1e-05
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    49   1e-05
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    48   2e-05
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    48   2e-05
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    47   3e-05
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    47   3e-05
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    47   3e-05
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    47   5e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    46   9e-05
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    46   1e-04
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    43   7e-04
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    37   0.005
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    37   0.066
KLLA0C17380g Chr3 (1524716..1528075) [3360 bp, 1119 aa] {ON} wea...    33   1.4  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...    32   4.0  
KNAG0F00220 Chr6 complement(21846..22952) [1107 bp, 368 aa] {ON}...    31   6.4  

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/368 (95%), Positives = 353/368 (95%)

Query: 1   MFXXXXXXXXXXXXXXXPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60
           MF               PKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60

Query: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120
           AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV
Sbjct: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120

Query: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180
           RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT
Sbjct: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180

Query: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240
           IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD
Sbjct: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300
           SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360

Query: 361 VDDILSKI 368
           VDDILSKI
Sbjct: 361 VDDILSKI 368

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/351 (87%), Positives = 324/351 (92%)

Query: 18  PKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDT 77
           PKSM IGLIPGDGIGKEVIPAGKQVLE L  KHGL FDFIDL+AGW  FQ+ GKALP+ T
Sbjct: 19  PKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQT 78

Query: 78  VKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMI 137
           V+VLK QCQGALFGAVQSPTTKV GYSSPIVALRKELGLYANVRPVKSVE   DR VDM+
Sbjct: 79  VQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKDRPVDMV 138

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           IVRENTEDLYIK EKTYVD+ATGTRVAEA KRISEVATR+IATIALDI+LQRLK+ GHAT
Sbjct: 139 IVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHAT 198

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           LTVTHKSNVLSQSDGLFREICKDVYE NKDKYG+V YNEQIVDSMVYRMFREPECFDVVV
Sbjct: 199 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFDVVV 258

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST
Sbjct: 259 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            LMLEFLGH +PAQDIY+AVDANL +  V TPDLGG +TTQQVV+DILSK+
Sbjct: 319 GLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQVVEDILSKL 369

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/350 (83%), Positives = 329/350 (94%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQVLE L SKHGL F+FIDL AG++ FQ+ GKALPD+TV
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETV 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           KVLKEQCQGALFGAVQSPTTKV GYSSPIVALR+E+GL+ANVRPVKSVE G D+ +DM+I
Sbjct: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKDKPIDMVI 141

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVA+A KRISE+ATR+IATIA+DI+L+RL++RG ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATL 201

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICK+VYE NKDKYG++KYNEQIVDSMVYR+FREP+CFDV+VA
Sbjct: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH   AQDIYKAVDANL +G + TPDLGGKA+TQQVV+D+LS++
Sbjct: 322 LMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKASTQQVVEDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/350 (84%), Positives = 329/350 (94%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQ+LE L SKHGL F+FIDL AG++ FQ+ GKALPD+T+
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETI 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           KVLK+QCQGALFGAVQSPTTKV GYSSPIVALR+E+GLYANVRPVKSVE   D+ +DM+I
Sbjct: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVI 141

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVA+AIKRISEVATR+IA IALDI+LQRL++RG ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICKDVYE NKDKYG++KYNEQIVDSMVYR+FREP+CFDV+VA
Sbjct: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH + AQDIYKAVDANL +G + TPDLGGKA+TQQVVDD+LS++
Sbjct: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/350 (84%), Positives = 328/350 (93%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQVLE L SKHGL F+FIDL AG++ FQ+ GKALPD+TV
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETV 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           KVLKEQCQGALFGAVQSPTTKV GYSSPIVALR+E+GL+ANVRPVKSVE    + +DM+I
Sbjct: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKGKPIDMVI 141

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVA+A KRISE+ATR+IATIALDI+L+RL++RG ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATL 201

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICK+VYE NKDKYG++KYNEQIVDSMVYR+FREP+CFDV+VA
Sbjct: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH E AQDIYKAVDANL +G + TPDLGGKA+TQQVVDD+LS++
Sbjct: 322 LMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKASTQQVVDDVLSRL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/350 (84%), Positives = 321/350 (91%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAGKQ+LE +G K  L F FIDL AGWE FQ  GKALPD+TV
Sbjct: 23  KALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETV 82

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           +VL+  CQGALFGAVQSPTTKV GYSSPIVALRK +GL+ANVRPVK+VE  NDR VDM+I
Sbjct: 83  EVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVI 142

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY D ATGTRVAEA KRISEVATR+IATIALDI+LQRL+SRGHATL
Sbjct: 143 VRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATL 202

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICKDVYE NKDKYG+++YNEQIVDSMVYRMFREPECFDVVVA
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVA 262

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAG+GI+NPIATIRSTA
Sbjct: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTA 322

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLG+PE AQ IYKAVD+N+ +  + TPDLGGK+TTQQVVDDILSKI
Sbjct: 323 LMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI 372

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/350 (82%), Positives = 327/350 (93%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQVLE L SKHGL F+FIDL AG++ FQ+ GKALPD+TV
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETV 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
            VLK+QCQGALFGAVQSPTTKV GYSSPIVALR+E+GL+ANVRPVKSVE   ++ +DM+I
Sbjct: 82  NVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRNKPIDMVI 141

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVA+A KRISE+ATR+IATIALDI+L+RL++RG ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGEATL 201

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQ+DGLFREICK+VYE NKDKYG++KYNEQIVDSMVYR+FREP+CFDV+VA
Sbjct: 202 TVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH   AQDIYKAVDANL +G + TPDLGGKA+TQQVVDD+LS++
Sbjct: 322 LMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/350 (82%), Positives = 321/350 (91%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQVL++L  KHGL FDFIDL+AG++ FQ  GKALPD+TV
Sbjct: 23  KSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETV 82

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           ++LKE+CQGALFGAVQSPTTKV GYSSPIVALRK +GLYAN+RPVKSVE  N+R VDMII
Sbjct: 83  QILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEGSNERPVDMII 142

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVAEA KRISE+AT++IATIALDI+LQRL++ G ATL
Sbjct: 143 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATL 202

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFRE+C+++YE NKDKY  + YNEQIVDSMVYRMFREPECFDV+VA
Sbjct: 203 TVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFREPECFDVIVA 262

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 263 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 322

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH E AQDI+KAVDANL  G V T DLGG ATTQ VVDDIL+++
Sbjct: 323 LMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATTQNVVDDILARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/350 (82%), Positives = 320/350 (91%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAGKQVLE L SKHGL+FDFIDL+AG++ F   GKALPD+TV
Sbjct: 24  KNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETV 83

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           +VLK QCQGALFGAVQSPTTKV GYSSPIVALRKE+GL+ANVRPVKSV    DR VDM+I
Sbjct: 84  QVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDRPVDMVI 143

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY+D+ATGTRVAEA KRISE+ATR+IATIALDI+LQRLK  G ATL
Sbjct: 144 VRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATL 203

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICKDVYE NKDKYG + YNEQIVDSMVYRMFREP+CFDV+VA
Sbjct: 204 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA 263

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 264 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 323

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLGH + AQDI++AV+AN+ +  + TPDLGG +TTQQV +D+L+++
Sbjct: 324 LMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/350 (81%), Positives = 317/350 (90%), Gaps = 1/350 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAG+QVLE L SKHGL+FDFIDL+AGW+ FQ+ GKALPD+T+
Sbjct: 19  KSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETI 78

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
            +L+ QCQGALFGAVQSPT KV GYSSPIVALRK+LGLYANVRPVKSV    +R VDMII
Sbjct: 79  DILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLP-QERPVDMII 137

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIKTEKTY+DE TGTRVAEAIKRISE AT+ IA IAL+I+LQR K  G ATL
Sbjct: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFRE+C+ VYE NKDK+G +KYNEQIVDSMVYRMFREPECFDV+VA
Sbjct: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVA 257

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAPDIAGKGISNP+ATIRSTA
Sbjct: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTA 317

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEF+GHPE AQDI+KAVDANL    + TPDLGGK+TTQQVV+D+LS++
Sbjct: 318 LMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM 367

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/351 (81%), Positives = 319/351 (90%), Gaps = 1/351 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAGKQVL+ L SKHGL FDFIDL+AG++ F   GKALPD+T+
Sbjct: 22  KNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETI 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           +VLK QCQGALFGAVQSPTTKV GYSSPIVALRKE+GLYANVRPVKSVE   D+ VDM+I
Sbjct: 82  QVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEGTTDKPVDMVI 141

Query: 139 VRENTED-LYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           VRENT   + IK E+TY+D ATGTRVAEA KRISE+ATR+IATIALDI+LQRLK+ G AT
Sbjct: 142 VRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKAT 201

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           LTVTHKSNVLSQSDGLFREICKDVYE NKDKYG++ YNEQIVDSMVYRMFREP+CFDVVV
Sbjct: 202 LTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVV 261

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 321

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ALMLEFLGH E AQDI++AV+ANL +  V TPDLGGK+TTQ+V +D+L+++
Sbjct: 322 ALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKSTTQEVTEDVLARL 372

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/350 (80%), Positives = 318/350 (90%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAGK++LE+L  K+GL F FIDL+AGWE FQ  GKALPD+T+
Sbjct: 19  KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI 78

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
            +LK QC+GALFGAVQSPTTKV GYSSPIVALRK LGL+ANVRPVKSV+   DR VD++I
Sbjct: 79  DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRKVDLVI 138

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EK+Y+DEATGTRVA+A KRI+E+AT+ IATIAL I+ QRL+  GHATL
Sbjct: 139 VRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATL 198

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFRE+C++ YE NKDKYG V+YNEQIVDSMVYRMFREPECFDVVVA
Sbjct: 199 TVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVA 258

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGISNPIATIRSTA
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEFLG+PEPA+DI+KAVDAN+ +G   TPDLGG +TTQQV++D+LSK+
Sbjct: 319 LMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/350 (80%), Positives = 314/350 (89%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K + IGLIPGDGIGKEVIPAGK VLE L SKH L+F+FIDL+AGW+ F   GKALPD+T+
Sbjct: 19  KPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETI 78

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           ++LK  CQGALFGAVQSPT KV GYSSPIVALRK+LGLYANVRPVKSV+  NDR VDMII
Sbjct: 79  EILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQGTNDRPVDMII 138

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIKTEKTY+DE TGTRVAEAIKRISE AT  IA IAL+ISLQRLK+ G ATL
Sbjct: 139 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATL 198

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFRE+CK+VYE NK++YG + YNEQIVDSMVYR+FREPECFDV+VA
Sbjct: 199 TVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFDVIVA 258

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSAPDIAGKGISNPIATIRSTA
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTA 318

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEF+G+ E AQDI+KAVD N+ +  + TPDLGGK+TTQQVVDDILSK+
Sbjct: 319 LMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQVVDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/350 (80%), Positives = 314/350 (89%), Gaps = 1/350 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIG+EVIPAGK VLE L SKHGL+F+FIDL+AGW+ F   GKALPD+T+
Sbjct: 19  KSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDETI 78

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
            +LK +CQGALFGAVQSPT KV GYSSPIVALRK+LGLYANVRPVKSV    ++ +DM+I
Sbjct: 79  DILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV-LSQEKPIDMVI 137

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIKTEKTY+DE TGTRVAEAIKRISEVATR IA IAL+I+LQR K  G ATL
Sbjct: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGSATL 197

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREIC+ VYE N+DK+G + YNEQIVDSMVYR+FREPECFDV+VA
Sbjct: 198 TVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA 257

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAPDIAGKGISNP+ATIRSTA
Sbjct: 258 PNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTA 317

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LMLEF+GHPE AQDI+KAVDANL    V TPDLGGK+TTQQVVDD+LS++
Sbjct: 318 LMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVVDDVLSRM 367

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/349 (79%), Positives = 311/349 (89%)

Query: 20  SMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVK 79
           ++ IGLIPGDGIGKEVIPAGK+VLE +G K+ + F FIDL AGW+ F   GKALPD+TV 
Sbjct: 22  NLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVS 81

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMIIV 139
           +LK+QCQGALFGAVQSPTTKV GYSSPIVALRK+LGLYAN+RPVKSV   NDR VDM+IV
Sbjct: 82  ILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIV 141

Query: 140 RENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLT 199
           RENTEDLYIK E+TY+DEATGT+VAEA KRISEVATRKIA IALDI+LQRLK+ G ATLT
Sbjct: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201

Query: 200 VTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAP 259
           VTHKSNVLSQSDGLFRE+C+DVYEKNKD YG V YNEQIVDSMVYR+FREPECFDVVVAP
Sbjct: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAP 261

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 319
           NLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGSAPDI+G+GISNP+ATIRS AL
Sbjct: 262 NLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAAL 321

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML+FLG+ E A+DI  AVD N+  G + TPDLGG ++T +V DDILSK+
Sbjct: 322 MLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/349 (76%), Positives = 308/349 (88%)

Query: 20  SMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVK 79
           ++ IGLIPGDGIGKEVIP+G+QVLE +G KHGL F+FIDL+AGW+ F   GKALP +TVK
Sbjct: 23  NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMIIV 139
            L+E C GALFGAVQSPTTKV GYSSPIVALRKELGLYAN+RPVKSV+   ++ VDM+IV
Sbjct: 83  TLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIV 142

Query: 140 RENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLT 199
           RENTEDLYIK EKTY+DE TGTRVA+A KRISEVATR+IA IALDI+LQRLK+ G+  LT
Sbjct: 143 RENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLT 202

Query: 200 VTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAP 259
           VTHKSNVLSQSDGLFRE+CK+V+E NK  Y +++YNEQI+DSMVYR+FREPECFDV+VAP
Sbjct: 203 VTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAP 262

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 319
           NLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGISNPIATIRSTAL
Sbjct: 263 NLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 322

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           MLEFLGH + AQDI  AVD+NL +  + TPDLGGK +T  VV+D++ ++
Sbjct: 323 MLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/351 (78%), Positives = 310/351 (88%), Gaps = 2/351 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS+ IGLIPGDGIGKEVIPAGKQVL+ L S+HGL F+FIDL+AG++ F   GKALPD+TV
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGND-RNVDMI 137
           KVLKEQCQG LFGAVQSPTT+V  YSSPIVALRKEL LYAN+RPVKSV   +  + VDM+
Sbjct: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKPVDMV 141

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           IVRENTEDLYIK EK+Y D+  G RVAEA KRI+EVATRKIA IALD++LQRLK+ G AT
Sbjct: 142 IVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKAT 200

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           LTVTHKSNVLSQSDGLFREICKDVY+ NKDKY  + YNEQI+DSMVYRMFREPE FDV+V
Sbjct: 201 LTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIV 260

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           APNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCHGSAPDIAGKGI+NPIATIRST
Sbjct: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ALMLEFLGH E AQDI+KAV++N+ +  + TPDLGG ++TQ VVDD+L K+
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/350 (76%), Positives = 303/350 (86%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAGKQVL+ L  KHGL F+FIDL+AG++ F   G ALP DTV
Sbjct: 20  KTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTV 79

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
            +LK +CQGALFGAVQSPTTKV GYSSPIV LRKELGL+ANVRPVK+VE  + + +D++I
Sbjct: 80  DILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVI 139

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLYIK EKTY D   G+R+AEA KRI+E AT++IA  ALDI+LQRLK++G ATL
Sbjct: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFRE+CK+VYE NK  Y  V YNEQIVDSMVYR+FREPECFDV+VA
Sbjct: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGSAPDIAGKGI+NPIATIRSTA
Sbjct: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTA 319

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            MLE+LG+  PAQDIYKAVDAN+    + T DLGG +TTQQV+DDIL K+
Sbjct: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/350 (74%), Positives = 301/350 (86%), Gaps = 1/350 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           KS  IGLIPGDGIGKEVIP G++VLE +G K+G+ F +IDL+AGW+ F   GKALPDDTV
Sbjct: 18  KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           + L+  CQGALFGAVQSPTTKV GYSSPIVALRK LGLYAN+RPVKSV+   DR VD++I
Sbjct: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVI 137

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
            RENTEDLYIK+E+TY+D+ TG RVAEAIKRISE ATR IA IAL+I+LQRLK +GHATL
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQSDGLFREICK VY+ NK K+  V+YNEQIVDSMVYR+F+EP+CFDV+VA
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQCFDVIVA 256

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GI+NPIATIRS A
Sbjct: 257 PNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAA 316

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           L+LEFLG PE A+ I K VD N+ +  + TPDLGG +T +QV +DILS+I
Sbjct: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 295/350 (84%), Gaps = 1/350 (0%)

Query: 19  KSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           K++ IGLIPGDGIGKEVIPAG++VLEA+G KH ++F +  L AGW+ F + G ALP  TV
Sbjct: 19  KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATV 78

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMII 138
           + L+E+CQGALFGAVQSPTTKV GYSSPIVALR++LGLYAN+RPVKSV  G  + VD++I
Sbjct: 79  EALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSV-SGTGQPVDLVI 137

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           VRENTEDLY++ E+TYVD ATG RVAEAIKRISE AT +IA I+L ++LQR +  G   L
Sbjct: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           TVTHKSNVLSQ+DGLF+E+C++VYE NK  YG ++YNEQIVDSMVYR+F+EP CFDVVVA
Sbjct: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTA 318
           PNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAPDIAG+GI+NPIATIRS +
Sbjct: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVS 317

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LML+FLG  E A DI +AV  NL    V +PDLGGK TTQ+V+DDIL++I
Sbjct: 318 LMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 197/359 (54%), Gaps = 29/359 (8%)

Query: 18  PKSMK--IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPD 75
           PK+ K  +  I GDG+G E+  + K +  A  +K  ++++  D+      F      +PD
Sbjct: 31  PKTGKYTVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSP---IFVNGLTTIPD 85

Query: 76  DTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRN 133
             V  + +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    N
Sbjct: 86  PAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYEN 142

Query: 134 VDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSR 193
           V+++++RENTE  Y     + ++      V ++IK I++ A+ ++   A + +    +S+
Sbjct: 143 VNLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSK 197

Query: 194 GHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF 253
               + V HKS +   +DGLF ++ K    K   +Y +++   +++D+ V +  + PE +
Sbjct: 198 ----VLVVHKSTIQRLADGLFVDVAK----KLSSEYPDIELQTELLDNTVLKTVQHPEAY 249

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNP 310
           D  VVV PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP
Sbjct: 250 DDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANP 309

Query: 311 IATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            A + S+ +ML  +G  E A  I KAV   +     N T DLGG A+T    D ++ ++
Sbjct: 310 TALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  181 bits (459), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 192/352 (54%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDGIG E+  + KQ+  A  +K  ++++  D+      F      +P+  V+ + 
Sbjct: 92  VSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSIN 146

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP +SV+  K    NVD++++R
Sbjct: 147 KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIR 203

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ ++   A +      ++ G   L V
Sbjct: 204 ENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEY----CRAIGRPRLVV 254

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   SDGLF  + K++      +Y ++++  +++D+ V ++   P  +   V V 
Sbjct: 255 VHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSYTDAVSVC 310

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PS N+G EI I E  HGSAPDIAGK ++NP A + S+
Sbjct: 311 PNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSS 370

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
            +ML  +G  + A  I  AV + +  G +  T DL G ATT    D ++ K+
Sbjct: 371 VMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  178 bits (451), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 194/354 (54%), Gaps = 27/354 (7%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
             +  I GDGIG E+  + KQ+ +A  +K  + ++  D+      F      +P+  V+ 
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFDA--AKVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMII 138
           + +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    NVD++I
Sbjct: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   +
Sbjct: 149 IRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRV 199

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF ++ K++ ++    Y +++   +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKELSQE----YPDIQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 316 STALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
           S+ +ML  +G    A  I KAV + +  G +  T DL GKATT    D ++ ++
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 187/360 (51%), Gaps = 39/360 (10%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEA------FQQQGKALP 74
             +  I GDGIG E+  + K++ +A            D+   WE       F      +P
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRIFQA-----------ADVPVEWETCDVTPIFVNGLTTIP 84

Query: 75  DDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDR 132
           D  V+ + +    AL G + +P  K  G+ S  + LRK   L+ANVRP KS+E  K    
Sbjct: 85  DPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYE 141

Query: 133 NVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKS 192
           NVD++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++
Sbjct: 142 NVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERVIRYAYEYA----RA 192

Query: 193 RGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPEC 252
            G   L V HKS +   +DGLF  + K++      +Y +++   +++D+    +   P  
Sbjct: 193 IGRPRLIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSS 248

Query: 253 FD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISN 309
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +N
Sbjct: 249 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 308

Query: 310 PIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
           P A + S+ +ML  +G  E A  I KAV   +  G +  T DLGG A+T    D I+ K+
Sbjct: 309 PTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  178 bits (451), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 189/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDGIG E+  + K + +A  ++  + ++F D+      F      +PD  V  + 
Sbjct: 43  VSFIEGDGIGPEISQSVKDIFKA--AEVPINWEFCDVT---PIFVNGLTTIPDPAVASIN 97

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK   L+ANVRP KS+E  K    +VD++++R
Sbjct: 98  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIR 154

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    K+ G   + V
Sbjct: 155 ENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVV 205

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   +DGLF  + K++ ++    Y E+K   +++D+ V  +   P  +   V V 
Sbjct: 206 VHKSTIQRLADGLFVNVAKELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVC 261

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G EI I E  HGSAPDIAG+  +NP A + S+
Sbjct: 262 PNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSS 321

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G  + A  I +AV   +     N T DLGG ATT    D ++  +
Sbjct: 322 VMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 194/359 (54%), Gaps = 29/359 (8%)

Query: 18  PKSMK--IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPD 75
           PK+ K  +  I GDGIG E+  + K +  A  +K  +++++ D+      F      +PD
Sbjct: 33  PKTGKYTVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTP---IFINGLTTIPD 87

Query: 76  DTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRN 133
             V+ + +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    N
Sbjct: 88  PAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYEN 144

Query: 134 VDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSR 193
           VD++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ 
Sbjct: 145 VDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAV 195

Query: 194 GHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF 253
           G   + V HKS +   +DGLF  + ++V      +Y +++   +++D+ V  +  +PE +
Sbjct: 196 GRPKVVVVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKY 251

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP
Sbjct: 252 SDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANP 311

Query: 311 IATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            A + S+ +ML  +G  E A  I  AV A +     N T DL G ATT      ++ ++
Sbjct: 312 TALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 186/350 (53%), Gaps = 27/350 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDGIGKEV  +  ++     +  GL  D       WE     G +  ++  K ++
Sbjct: 31  VTLIPGDGIGKEVTDSVVKIF----ASQGLPID-------WERIDVPGMSNENEVKKAVE 79

Query: 83  EQCQGAL-FGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIV 139
              +  +    +   +    GY S  VALRK+L ++ANV   KS++  K    +VD++++
Sbjct: 80  SLKRNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVI 139

Query: 140 RENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLT 199
           RENTE  Y   E   V       V E++K I++  T +IA  A D +L+  +S    T+T
Sbjct: 140 RENTEGEYSGLEHESV-----PGVVESLKIITKPKTERIARFAFDFALENNRS----TVT 190

Query: 200 VTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAP 259
             HK+N++  SDGLF+    +V EK   +Y ++K N  IVD+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLSDGLFKNTVAEVGEK---EYPDIKVNTIIVDNASMQAVAKPHQFDVMVTP 247

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTA 318
           ++YG IL +  AAL+G  G++P AN G E  + EP       DI  + I+NP A I S  
Sbjct: 248 SMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSAT 307

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LML  LG  E ++ I  AV A + +G   T D+GG A+T +  D ++ K+
Sbjct: 308 LMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/352 (33%), Positives = 189/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDGIG E+  + K++  A  +   + ++F D+      F      +PD  V+ + 
Sbjct: 39  VSFIEGDGIGPEISKSVKKIFSA--ADVPINWEFCDVNP---IFVNGLTTIPDPAVQSIT 93

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    NVD++++R
Sbjct: 94  KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIR 150

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   + V
Sbjct: 151 ENTEGEY-----SGIEHIVCPGVVQSIKLITREASERVIRYAFEYA----RAIGRPRIIV 201

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   +DGLF  + K++      +Y ++ +  +++D+ V  +   P  +   V V 
Sbjct: 202 VHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSVC 257

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAGK  +NP A + S+
Sbjct: 258 PNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 317

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G    A  I  AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 318 VMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  176 bits (447), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 187/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDG+G E+  + K +  A  +   +Q+   D+      F      +P+  VK +K
Sbjct: 46  VPFIEGDGVGPEISKSVKDIFSA--ANVPIQWQPCDV---GPIFVNGLTTIPEPAVKAIK 100

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           E    AL G + +P  K  G+ S  + LRK   L+ANVRP KSV   K    NVD++++R
Sbjct: 101 ESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIR 157

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ K+   A + ++    + G   L V
Sbjct: 158 ENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAI----AVGRPRLIV 208

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +    DGLF +I  ++    + +Y  +K   QI+D+ V  +   P  +   V V 
Sbjct: 209 VHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVC 264

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 265 PNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSS 324

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
            +ML  +G  E A  I  AV + +  G +  T DLGG ATT    + ++ K+
Sbjct: 325 VMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 185/349 (53%), Gaps = 24/349 (6%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDGIGKEV  +  Q+ EA      + ++ ++L A  E  +   KA     V+ LK
Sbjct: 32  VTLIPGDGIGKEVTDSVVQIFEA--ENVPVDWESVELSALEENHEGVQKA-----VESLK 84

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
               G L G   +P  +  G+ S  VA RK+L ++ANV   KS    K   ++VD++I+R
Sbjct: 85  RNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVIIR 142

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K +++  + +IA  A D +L+  +      +  
Sbjct: 143 ENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALKNNRK----AVCA 193

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR    ++  K   +Y EV  +  IVD+   +   +P  FDV+V PN
Sbjct: 194 VHKANIMKLGDGLFRNTVSEIGAK---EYPEVNVSSIIVDNASMQAVAKPHQFDVLVTPN 250

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           LYG IL +  AAL+G  G+VP AN G E  + EP C     DI G+ ++NP A I S+ L
Sbjct: 251 LYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTL 310

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG  E A  I +A    + +G   T D+GG ATT +  + ++ K+
Sbjct: 311 MLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  176 bits (446), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 190/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDGIG E+  + K++  A  +   ++++F D+      F      +PD  V+ + 
Sbjct: 39  VSFIEGDGIGPEISKSVKKIFSA--ANVPIEWEFCDVNP---IFVNGLTTIPDPAVQSIT 93

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVE  K    NVD++++R
Sbjct: 94  KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIR 150

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   + V
Sbjct: 151 ENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIV 201

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   +DGLF  + K++      +Y ++    +++D+ V ++   P  +   V V 
Sbjct: 202 VHKSTIQRLADGLFVNVAKEL----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVC 257

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP A + S+
Sbjct: 258 PNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSS 317

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G    A  I  AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 318 VMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 190/352 (53%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDG+G E+  A K +  A  +K  +Q++  D+      F      +P      + 
Sbjct: 38  VSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTP---LFINGLTTIPQPAQDSIN 92

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++  K    NVD++++R
Sbjct: 93  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIR 149

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I++ A+ ++   A + +    ++     + V
Sbjct: 150 ENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVERPKVLV 200

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   +DGLF  +     EK   +Y +++   +++D+ V    R+P  +   VVV 
Sbjct: 201 VHKSTIQRLADGLFVSVA----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVC 256

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G  E A  I KAV + +  G  N T DL G A+T    + ++S++
Sbjct: 317 VMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  173 bits (439), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 192/354 (54%), Gaps = 31/354 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDG+G E+  A K +  A  +K  +Q++  D+      F      +P      + 
Sbjct: 38  VSFIEGDGVGPEISKAVKDIFAA--AKAPIQWESCDVSP---LFINGLTTIPQPAQDSIN 92

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSV+  K    NVD++++R
Sbjct: 93  KNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIR 149

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS--LQRLKSRGHATL 198
           ENTE  Y     + ++      V ++IK I++ A+ ++   A + +  ++R K      +
Sbjct: 150 ENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAVERPK------V 198

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF  +     E+   +Y +++   +++D+ V    R+P  +   VV
Sbjct: 199 VVVHKSTIQRLADGLFVSVA----EQLSKEYPDIELQTELIDNTVLHTVRDPTKYSDVVV 254

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 316 STALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
           S+ +ML  +G  E A  I KAV   +  G +  T DLGG A+T    + ++S++
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  173 bits (439), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 190/354 (53%), Gaps = 27/354 (7%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
             +  I GDG+G E+  + K++  A      +  +++    G   F      +P+  V++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIFSA----AKVPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMII 138
           + +    AL G + +P  K  G+ S  + LRK   L+ANVRP +S+   K    NVD+++
Sbjct: 91  INKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y     + ++      V ++IK I+  AT ++   A + +    ++ G   L
Sbjct: 148 IRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYT----QAIGRPRL 198

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF ++ +++      +Y ++K   +I+D  +  +  +PE +   V 
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVS 254

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 316 STALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
           S+ +ML+ +G  E A  I  AV   +  G  N T DL G A+T    ++++ ++
Sbjct: 315 SSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  173 bits (438), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 192/352 (54%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDG+G E+  + K +  A  +K  ++++  D+      F      +PD  V+ + 
Sbjct: 38  VPFIEGDGVGPEISKSVKDIFAA--AKVPIEWEPCDVGP---IFVNGLTTIPDAAVQSIN 92

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK   L+ANVRP +SV   K   +NVD++++R
Sbjct: 93  KHLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIR 149

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I++ A+ ++   A + +    ++ G   L V
Sbjct: 150 ENTEGEY-----SGIEHVISPGVIQSIKLITKDASERVIRYAFEYT----RAIGRPRLVV 200

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVA 258
            HKS +   +DGLF  + K++      +Y +++   +++D+ +  +   PE +   V V 
Sbjct: 201 VHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVC 256

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 257 PNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSS 316

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G  E A  I  A+ + +  G  N T DL G ATT    + +++K+
Sbjct: 317 VMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 187/358 (52%), Gaps = 39/358 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEA------FQQQGKALPDD 76
           +  I GDG+G E+  + K +  A            ++   WE+      F      +P  
Sbjct: 39  VSFIEGDGVGPEISKSVKDIFAA-----------AEVPVEWESCDVTPLFINGLTTIPQP 87

Query: 77  TVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNV 134
            V  + +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVE  K    NV
Sbjct: 88  AVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENV 144

Query: 135 DMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRG 194
           D++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G
Sbjct: 145 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYA----RAVG 195

Query: 195 HATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF- 253
              + V HKS +   +DGLF ++ K++      +Y +++   Q++D+ V  +   P  + 
Sbjct: 196 RPKVMVVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYA 251

Query: 254 -DVVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPI 311
             V V PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP 
Sbjct: 252 DTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPT 311

Query: 312 ATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
           A + S+ +ML  +G  E A  I KAV + +  G  N T DL G A+T    + ++ ++
Sbjct: 312 ALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 182/349 (52%), Gaps = 24/349 (6%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKEV  +   + EA      + +D +D+ +G +   ++G     D++K   
Sbjct: 31  VTLIPGDGVGKEVTDSVVSIFEA--ENLPIDWDRVDI-SGLD--HEEGVQAAVDSLK--- 82

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
            + +  L G   +     AG  S  VALRKEL +YANV   KSV   K    NVD++++R
Sbjct: 83  -RNKIGLKGIWHTSAADQAGKGSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIR 141

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K ++E  T +IA  A D +    K      +T 
Sbjct: 142 ENTEGEYSGLEHESV-----PGVVESLKIMTEDKTERIARFAFDFA----KKYNRHAVTA 192

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR +   V E+   +Y +VK    IVD+   +   +P  FDV+V P+
Sbjct: 193 VHKANIMKLGDGLFRNVVTRVGEQ---EYPDVKVGSIIVDNASMQTVAKPHQFDVLVTPS 249

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG IL +  AAL+G  G+V  AN G E  + EP       DI  K I+NP A I S +L
Sbjct: 250 MYGTILGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASL 309

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML+ LG    A  I  AV   + +G   TPD+GG A+T +    ++ K+
Sbjct: 310 MLDHLGLSTSATKISNAVHQVIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 120/358 (33%), Positives = 188/358 (52%), Gaps = 39/358 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEA------FQQQGKALPDD 76
           +  I GDGIG E+  + K++           F+  ++   WE+      F      +PD 
Sbjct: 39  VSFIEGDGIGPEISKSVKKI-----------FNAANVPIEWESCDVNPIFVNGLTTIPDA 87

Query: 77  TVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNV 134
            V+ +      AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVE  K    NV
Sbjct: 88  AVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENV 144

Query: 135 DMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRG 194
           D++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G
Sbjct: 145 DLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIG 195

Query: 195 HATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD 254
              + V HKS +   +DGLF  + K++ ++    Y ++    +++D+ V ++   P  + 
Sbjct: 196 RPRVIVVHKSTIQRLADGLFVNVAKELSKE----YPDIILETELIDNSVLKVVTNPSAYT 251

Query: 255 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPI 311
             V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP 
Sbjct: 252 NAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPT 311

Query: 312 ATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
           A + S+ +ML  +G    A  I  AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 312 ALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  172 bits (435), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 187/358 (52%), Gaps = 39/358 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEA------FQQQGKALPDD 76
           +  I GDGIG E+  + K++  A            ++   WE+      F      +PD 
Sbjct: 39  VSFIEGDGIGPEISKSVKKIFSA-----------ANVPIEWESCDVSPIFVNGLTTIPDP 87

Query: 77  TVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNV 134
            V+ + +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    NV
Sbjct: 88  AVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENV 144

Query: 135 DMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRG 194
           D++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G
Sbjct: 145 DLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYA----RAIG 195

Query: 195 HATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD 254
              + V HKS +   +DGLF  + K++      +Y ++    +++D+ V ++   P  + 
Sbjct: 196 RPRVIVVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYT 251

Query: 255 --VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPI 311
             V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP 
Sbjct: 252 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPT 311

Query: 312 ATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
           A + S+ +ML  +G    A  I  AV + +  G  N T DL G ATT    + ++ ++
Sbjct: 312 ALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  171 bits (432), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/356 (32%), Positives = 188/356 (52%), Gaps = 40/356 (11%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
            +I LIPG+GIGKEV  + + + +A      + ++ +++++      + G     D++K 
Sbjct: 23  FQITLIPGNGIGKEVTDSVRSIFQA--ENLPIDWEIVNIES-----HRDGIKTAVDSIKR 75

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPI-----VALRKELGLYANVRPVKSVEKGNDR--N 133
            K   +G                S PI     VALRK+L ++ANV   KS +  N R  N
Sbjct: 76  NKIALKGIW-------------SSDPIDGSLNVALRKQLDIFANVAIFKSFDNVNTRIPN 122

Query: 134 VDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSR 193
           VD++++RENTE  +   E   VD      V E++K +++  T +IA  A D +  +  +R
Sbjct: 123 VDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTERIARFAFDFA--KKHNR 175

Query: 194 GHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF 253
            H  +T  HK+N++   DGLF+ I   +     ++Y E+K +  IVD+   +   +P  F
Sbjct: 176 NH--VTAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSSIIVDNASMQAVAKPHQF 230

Query: 254 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIA 312
           DV+V+P++YG IL +  AAL+G  G+VP AN G +  + EP       DI G+ ++NP A
Sbjct: 231 DVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTA 290

Query: 313 TIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            I S   ML  LG   PA+ I  AV   + +G   T D+GG A+T +  D +++++
Sbjct: 291 MILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTASTTEFTDAVINEL 346

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 189/353 (53%), Gaps = 27/353 (7%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVL 81
           K+  I GDGIG E+  + K +  A  +K  + F+ + +K           ++P++  K +
Sbjct: 37  KVSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQKSI 91

Query: 82  KEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIV 139
                 AL G + +P  K  G+ S  + LRK  GL+AN+RP KSVE  K    NV+++++
Sbjct: 92  NTNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLI 148

Query: 140 RENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLT 199
           RENTE  Y   E   V       V ++IK I+  A+ ++   A + +    + R    L 
Sbjct: 149 RENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAERPR----LI 199

Query: 200 VTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVV 257
           V HKS +   SDGLF ++ K++    + ++ ++K   +++D+ V     +P  +   V V
Sbjct: 200 VVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSV 255

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIAGK  +NP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 315

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
           + +ML  +G  E A  I KAV   +  G +  T DL G A+T    + ++ K+
Sbjct: 316 SVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 191/354 (53%), Gaps = 27/354 (7%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
             +  I GDG+G E+  + K + +A  ++  + +++ D+             +P+  V+ 
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFKA--AQVPVDWEYCDVSP---LLINGLTTIPEPAVQQ 95

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMII 138
           + +  + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S+   +   +NVD+++
Sbjct: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   L
Sbjct: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF  I K++      ++ ++K   +++D+ V  + R+P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G E+ I E  HGSAPDIAG+  +NP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 316 STALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
           S+ +ML ++G    +  I  A+   +  G  N T DL G ATT    + ++  +
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  169 bits (429), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 187/349 (53%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKE+  + K + EA   K  + ++ +++K      Q   K    + V+ LK
Sbjct: 31  VTLIPGDGVGKEITDSVKTIFEA--EKIPVDWETVNIK------QTDHKEGVYEAVESLK 82

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMIIVR 140
               G L G   +P  +  G+ S  VALRK+L +YANV   KS++    R  ++D+I++R
Sbjct: 83  RNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIR 140

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  +   E   V       V E++K ++   T +IA  A D +    K      +T 
Sbjct: 141 ENTEGEFSGLEHESVPG-----VVESLKIMTRPKTERIARFAFDFA----KKYNRKAVTA 191

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR I  ++ +K   +Y ++  +  IVD+   +   +P  FDV+V P+
Sbjct: 192 VHKANIMKLGDGLFRNIITEIGQK---EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPS 248

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I S+ L
Sbjct: 249 MYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVL 308

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG  E A  I KAV   + +G   T D+GG ++T    ++I++K+
Sbjct: 309 MLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  169 bits (429), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 181/351 (51%), Gaps = 30/351 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPD--DTVKV 80
           + L+PGDG+G+E+  +   + EA            +L   WE  +  G    D    V+ 
Sbjct: 31  VTLLPGDGVGREITDSVVSIFEAE-----------NLPIDWERVELSGLEQEDVHTAVES 79

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMII 138
           LK    G     +   +    G++S  VALRKEL +YANV   KS +  + R  +VD++I
Sbjct: 80  LKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y   E   V       V E++K ++   T +IA  A D +++  +     ++
Sbjct: 138 IRENTEGEYSGLEHESVPG-----VVESLKIMTAQKTERIARFAFDYAMKYNRK----SV 188

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           T  HK+N++   DGLFR +  ++  K   +Y EV  +  IVD+   +   +P  FDV+VA
Sbjct: 189 TAVHKANIMKLGDGLFRNLVTEIGAK---EYPEVGVSSIIVDNASMQAVAKPHQFDVMVA 245

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 317
           P++YG IL +  AAL+G  G+VP AN G +  + EP       DI  + I+NP A I S 
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSA 305

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            LML  LG    A  I KAV   + +G   T D+GG ATT +  + +++K+
Sbjct: 306 TLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 187/349 (53%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKE+  + + + EA      + ++ I++K      Q   K    + V+ LK
Sbjct: 31  VTLIPGDGVGKEITDSVRTIFEA--ENIPIDWETINIK------QTDHKEGVYEAVESLK 82

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMIIVR 140
               G L G   +P  +  G+ S  VALRK+L +YANV   KS++    R  ++D+I++R
Sbjct: 83  RNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIR 140

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  +   E   V       V E++K ++   T +IA  A D +    K     ++T 
Sbjct: 141 ENTEGEFSGLEHESVPG-----VVESLKVMTRPKTERIARFAFDFA----KKYNRKSVTA 191

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR I  ++ +K   +Y ++  +  IVD+   +   +P  FDV+V P+
Sbjct: 192 VHKANIMKLGDGLFRNIITEIGQK---EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPS 248

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I S+ L
Sbjct: 249 MYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTL 308

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG  E A  I KAV   + +G   T D+GG ++T    ++I++K+
Sbjct: 309 MLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 122/359 (33%), Positives = 183/359 (50%), Gaps = 39/359 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG------KALPDD 76
           +  I GDGIG E+  + K + +A             +   WE              +PD+
Sbjct: 46  VSFIEGDGIGPEISRSVKDIFQA-----------ASVPITWETCDVSPILVDGLTTIPDE 94

Query: 77  TVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNV 134
            VK + +   G L G + +P  K  G+ S  + LRK   L+ANVRP KSV   K    NV
Sbjct: 95  AVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNV 151

Query: 135 DMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRG 194
           D++++RENTE  Y     + ++      V ++IK I+  A+ ++   A + +    K+ G
Sbjct: 152 DLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYA----KAIG 202

Query: 195 HATLTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGEVKYNEQIVDSMVYRMFREPECF 253
              + V HKS +   SDGLF  + K++  EKN   +  ++ + +++D+ V  +   P  +
Sbjct: 203 RPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN---FQNIELDTELIDNTVLNVVMNPSKY 259

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PSAN+G +I I E  HGSAPDIAG+  +NP
Sbjct: 260 SDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANP 319

Query: 311 IATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            A + S+ +ML  +G  E    I  AV   +     N T DLGG ATT    + ++  +
Sbjct: 320 TALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  167 bits (424), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 191/352 (54%), Gaps = 27/352 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           +  I GDG+G E+  + K +  A  +   +++++ D+             +P+  V  + 
Sbjct: 37  VSFIEGDGVGPEISQSVKDIFSA--ASVPVEWEYCDVTP---LLVNGLTTIPEPAVASIN 91

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    +VD++++R
Sbjct: 92  KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIR 148

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   + V
Sbjct: 149 ENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVVV 199

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA-- 258
            HKS +   +DGLF  + +++      +Y +++   +++D+ V  +  +PE +  VVA  
Sbjct: 200 VHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVC 255

Query: 259 PNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           PNLYGDILSD  + L  GSLG+ PSAN+G ++ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 256 PNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSS 315

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368
            +ML  +G  E A  I KAV + +     N T DL G A+T    + ++ ++
Sbjct: 316 VMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  167 bits (424), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 122/349 (34%), Positives = 183/349 (52%), Gaps = 24/349 (6%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKEV  +   + EA      + ++ ++L    E  +   KA     V+ LK
Sbjct: 32  VTLIPGDGVGKEVTDSVVNIFEA--ENVPIDWESVELSGLEENMEGVQKA-----VESLK 84

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
               G L G   +P  +  G+ S  VA RK+L ++ANV   KS    K   ++VD++I+R
Sbjct: 85  RNKVG-LKGIWSTPADQ-TGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVIIR 142

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K +++  + +IA  A D +L+  +     ++  
Sbjct: 143 ENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIARFAFDFALKNNRR----SVCA 193

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR    ++  K   +Y E++    IVD+   +   +P  FDV+V PN
Sbjct: 194 VHKANIMKLGDGLFRNTVNEIGAK---EYPELEVKSIIVDNASMQAVAKPHQFDVLVTPN 250

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           LYG IL +  AAL+GS G+VP AN G E  + EP       DI G+ ++NP A I S+ L
Sbjct: 251 LYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTL 310

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG  + A  I KA    + +G   T D+GG A+T Q    I+ K+
Sbjct: 311 MLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 187/349 (53%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKE+  + + + EA   +  + ++ I++K      Q   K    + V+ LK
Sbjct: 31  VTLIPGDGVGKEITDSVRTIFEA--ERIPVDWETINIK------QTDHKEGVYEAVESLK 82

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMIIVR 140
               G L G   +P  +  G+ S  VALRK+L +YANV   KS++    R  ++D+I++R
Sbjct: 83  RNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIR 140

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  +   E   V       V E++K +++  T +IA  A D +    K      +T 
Sbjct: 141 ENTEGEFSGLEHESVPG-----VVESLKVMTKPKTERIARFAFDFA----KKYNRKAVTA 191

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR I  ++    + +Y ++  +  IVD+   +   +P  FDV+V P+
Sbjct: 192 VHKANIMKLGDGLFRNIITEI---GQTEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPS 248

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I S+ L
Sbjct: 249 MYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVL 308

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG  E A  I KAV   + +G   T D+GG ++T    +++++K+
Sbjct: 309 MLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 183/349 (52%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKEV  +  ++ E       + ++ ID+ +G E  +   +A     V+ LK
Sbjct: 32  VTLIPGDGVGKEVTDSVVKIFE--NENIPIDWETIDI-SGLENTENVQRA-----VESLK 83

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMIIVR 140
               G L G   +P  +  G+ S  VALRK+L ++ANV   KS+     R  N+DM+I+R
Sbjct: 84  RNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVIIR 141

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K ++   + +IA  A D +L+  +     ++  
Sbjct: 142 ENTEGEYSGLEHESVPG-----VVESLKIMTRAKSERIARFAFDFALKNNRK----SVCA 192

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR    ++     ++Y E+     IVD+   +   +P  FDV+V PN
Sbjct: 193 VHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTPN 249

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           LYG IL +  +AL+G  G+VP AN G E  + EP       DI G+ ++NP A I S+ L
Sbjct: 250 LYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTL 309

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML  LG    A  I KA    + +G   T D+GG A+T +  + ++ K+
Sbjct: 310 MLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  166 bits (421), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 190/366 (51%), Gaps = 43/366 (11%)

Query: 18  PKSMK--IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPD 75
           PK+ K  +  I GDG+G E+  + K +  A             +   WE+       L  
Sbjct: 34  PKTGKYTVSFIEGDGVGPEISKSVKDIFAA-----------AKVPIVWESCPVT--PLLV 80

Query: 76  DTVKVLKEQCQG-------ALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE- 127
           + V  + EQ Q        AL G + +P  K  G+ S  + LRK  GL+ANVRP KSVE 
Sbjct: 81  NGVTTIPEQAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEG 138

Query: 128 -KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS 186
            K    +VD++++RENTE  Y   E   V       V ++IK I+  A+ ++   A + +
Sbjct: 139 FKTTYEDVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA 193

Query: 187 LQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRM 246
               ++ G   L V HKS +   +DGLF  + K++      ++ +++   +++D+ V  +
Sbjct: 194 ----RAVGRPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNV 245

Query: 247 FREPECF-DVV-VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIA 303
              P  + DVV V PNLYGDILSD  + L  GSLG+ PS N+G ++ I E  HGSAPDIA
Sbjct: 246 VSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIA 305

Query: 304 GKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVD 362
           G+  +NP A + S+ +ML  +G  E A  I KAV   +  G +  T DL G A+T    +
Sbjct: 306 GQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTE 365

Query: 363 DILSKI 368
            ++S++
Sbjct: 366 AVISRL 371

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 180/352 (51%), Gaps = 31/352 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG---KALPDDTVK 79
           + LIPGDG+GKEV  +   + E+            ++   WE  +  G   +      V+
Sbjct: 32  VTLIPGDGVGKEVTDSVVSIFESE-----------NIPIDWETVEISGLDNQEGVQKAVE 80

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMI 137
            LK    G L G   +P+ +  G+ S  VALRK+L ++ANV   KSV     R  NVDM+
Sbjct: 81  SLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDMV 138

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           ++RENTE  Y   E   V       V E++K +++  + +I   A D +++  +     +
Sbjct: 139 VIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIGRFAFDFAVKNNRK----S 189

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           +   HK+N++   DGLFR    +V  K   +Y E+     IVD+   +   +P  FDV+V
Sbjct: 190 VCAVHKANIMKLGDGLFRNCINEVGAK---EYPEIDVKNIIVDNASMQAVAKPHQFDVLV 246

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S
Sbjct: 247 TPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILS 306

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ++LML  LG    A  I KA    + +    T D+GG A+T +  + I+SK+
Sbjct: 307 SSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  166 bits (420), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 181/350 (51%), Gaps = 28/350 (8%)

Query: 25  LIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQ 84
            I GDG+G E+  + + + +A      +  D+++   G      +   +P   V  +   
Sbjct: 49  FIEGDGVGPEISKSVRTIFKA----AKVPIDWVNCDIGPLLINGE-TTIPQTAVDQINNS 103

Query: 85  CQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEK--GNDRNVDMIIVREN 142
              AL G + +P  +  G+ S  + LRK  GL+ANVRP KS+        NVD+I++REN
Sbjct: 104 LI-ALKGPLATPVGQ--GHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVIREN 160

Query: 143 TEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTH 202
           TE  Y   E   V       V ++IK I+  A+ K+   A + +    +S G + L V H
Sbjct: 161 TEGEYSGIEHEIVPG-----VVQSIKLITRKASEKVIKYAFEYT----RSIGRSNLIVVH 211

Query: 203 KSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECF--DVVVAPN 260
           K+ +  + DGLF +  +++     DKY +V    +++D+ V      PE +   V V PN
Sbjct: 212 KATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPN 267

Query: 261 LYGDILSDGAAAL-VGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 319
           LYGDILSD  + L  GSLG+ PSAN+G E V+ E  HGSAPDIAG+  +NP A + S+ +
Sbjct: 268 LYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLSSVM 326

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKG-DVNTPDLGGKATTQQVVDDILSKI 368
           ML  +G  + A  I  AV   +  G +  T DLGG ATT      ++  +
Sbjct: 327 MLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 185/351 (52%), Gaps = 26/351 (7%)

Query: 21  MKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           M + L+PGDG+GKE+  +   + +A      + ++ +D+       Q   +   +  V+ 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQA--ENVPIDWETVDIS------QLDHEDGVNAAVES 80

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMII 138
           LK    G L G   +   +V G+ S  VA RK+L +YANV   KS+   K    NVD++I
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y   E   V       V E++K +++V + +IA  A D +++  +      +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMRHDRK----MV 189

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
           T  HK+N++  SDGLFR     V E     Y ++K +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 317
           P++YG IL +  AAL+G  G+VP  N G E  + EP       DI G+ ++NP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            L+L+ LG  + A  I KAV   + +G+  T D+GG A+T +    ++ K+
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 176/351 (50%), Gaps = 29/351 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKEV  +   + EA            ++   WE     G    +   K ++
Sbjct: 32  VTLIPGDGVGKEVTDSVVSIFEAE-----------NVPIDWETINITGVDSEEGVQKAVE 80

Query: 83  --EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMII 138
             ++ +  L G   +P  +  G+ S  VA RK+L ++ANV   K+V   K    N+D+++
Sbjct: 81  SLKRNKIGLKGIWHTPADQ-TGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVV 139

Query: 139 VRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATL 198
           +RENTE  Y   E   V       V E++K I++  + +IA  A D +L+  +     ++
Sbjct: 140 IRENTEGEYSGLEHESV-----PGVVESLKIITKAKSERIARFAFDFALKNNRK----SV 190

Query: 199 TVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA 258
              HK+N++   DGLFR    +V      +Y E+     IVD+   +   +P  FDV+V 
Sbjct: 191 CAVHKANIMKLGDGLFRNTVNEV---GASEYPEIDVKNIIVDNASMQAVAKPHQFDVLVT 247

Query: 259 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRST 317
           PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI GK ++NP A I S+
Sbjct: 248 PNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSS 307

Query: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
            LML  LG    A  I KA    + +G   T D+GG ++T +    ++ K+
Sbjct: 308 TLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 177/352 (50%), Gaps = 31/352 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG---KALPDDTVK 79
           + LIPGDG+GKEV  +   + E+            ++   WE  +  G   +      V 
Sbjct: 31  VTLIPGDGVGKEVTDSVVSIFESE-----------NVPIDWETVEISGLDNEEGVQKAVD 79

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMI 137
            LK    G L G   +P+ +  G+ S  VALRK+L ++ANV   K+V     R  NVD++
Sbjct: 80  SLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLV 137

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           ++RENTE  Y   E   V       V E++K +++  + +I   A D +L+  +     +
Sbjct: 138 VIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSDRIGRFAFDFALKNNRK----S 188

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           +   HK+N++   DGLFR    ++  K   +Y E++    IVD+   +   +P  FDV+V
Sbjct: 189 VCAVHKANIMKLGDGLFRNCINEIGAK---EYPEIEVKNIIVDNASMQAVAKPHQFDVLV 245

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            PNLYG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S
Sbjct: 246 TPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILS 305

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           +ALML  LG    A  I KA    + +    T D+GG A+T      I+ K+
Sbjct: 306 SALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  160 bits (404), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/349 (31%), Positives = 187/349 (53%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + L+PGDG+GKE+  +   + ++      + ++ +D+ +G +    +G     D++K   
Sbjct: 30  VTLLPGDGVGKEITDSVVSIFKS--ENVPIDWETVDI-SGLD--HTEGVKAAVDSLK--- 81

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
            + +  L G   +P  +V G+ S  VA RK+L +YANV   KS+E  K    NVD++++R
Sbjct: 82  -RNKIGLKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVVIR 139

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K I++  + +IA  A D +    K     ++T 
Sbjct: 140 ENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIARFAFDFA----KRNNRKSVTA 190

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++  SDGLFR     + E   ++Y E++ +  IVD+   +   +P  FDV+V P+
Sbjct: 191 VHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVTPS 247

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ ++NP A + S  L
Sbjct: 248 MYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATL 307

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           +L+ LG  + A  I  AV   + +G   T D+GG A+T +    +++K+
Sbjct: 308 LLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  159 bits (402), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 180/352 (51%), Gaps = 31/352 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG---KALPDDTVK 79
           + LIPGDG+GKEV  +   +           F+  +L   WE     G   +   +  V 
Sbjct: 36  VTLIPGDGVGKEVTDSVVSI-----------FNAENLPIDWERVDISGLDHEEGVEAAVN 84

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMI 137
            LK    G     +   +   + + S  VALRK+L +YANV   K++     R  +VD++
Sbjct: 85  SLKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           I+RENTE  Y   E   V       V E++K I++  + +IA  A D + +R   +    
Sbjct: 143 IIRENTEGEYSGLEHESV-----PGVVESLKIITKEKSERIARFAFDFA-KRFDRK---L 193

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           +T  HK+N++   DGLFR     + E    +Y ++K +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            P++YG IL +  AAL+G  G+VP AN G E  + EP       DI G+ ++NP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           + L+L+ LG    A+ I  AV   + +G V T D+GG A+T +  ++I+ K+
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 182/349 (52%), Gaps = 25/349 (7%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKE+  +   + EA      + ++ +D+    +  Q   +A     V+ LK
Sbjct: 29  VTLIPGDGVGKEITDSVVSIFEA--ENIPVDWERVDISTS-DNIQDVSQA-----VESLK 80

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140
               G     +   +  +A + S  VALRK+L ++A+V   KSV   K    NVD++++R
Sbjct: 81  RNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVIR 138

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  Y   E   V       V E++K I++  + +IA  A D +    K     ++  
Sbjct: 139 ENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIARFAFDFA----KKYNRKSVCA 189

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR     V E   ++Y +++ +  IVD+   +   +P  FDV+V P+
Sbjct: 190 VHKANIMKMGDGLFRNT---VTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVTPS 246

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRSTAL 319
           +YG I+ +  AAL+G  G+V  A+ G E  + EP       DI GK ++NP A I S+ L
Sbjct: 247 MYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTL 306

Query: 320 MLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           ML+ LG  E A+ I KA    +  G V T D+GG A+T +  + I+ ++
Sbjct: 307 MLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 180/352 (51%), Gaps = 30/352 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDT---VK 79
           + LIPGDG+GKEV  +   + +A            ++   W+     G    +D    V+
Sbjct: 31  VTLIPGDGVGKEVTDSVVSIFKAE-----------NVPVDWDRVDISGVDRAEDVKSAVE 79

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMI 137
            LK    G L G   +     AG+ S  VALRKEL +YANV   KS+     +  +VD++
Sbjct: 80  SLKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLV 138

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           ++RENTE  +   E   V       V E++K +++    +IA  A D +    K      
Sbjct: 139 VIRENTEGEFSGLEHESV-----PGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQ 189

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           +   HK+N++   DGLF+ + ++V EK   +Y E++    IVD+   +    P  FDV+V
Sbjct: 190 VVAVHKANIMKMGDGLFKNLVQEVGEK---EYPELQVGNIIVDNASMQTVANPHQFDVLV 246

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            P++YG IL +  AAL+G  G+V  AN G ++ + EP       DI G+ ++NP A I S
Sbjct: 247 TPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILS 306

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           + L+L  LG    A  I KAV A + +G   T D+GG A+T +  + +++K+
Sbjct: 307 SVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  155 bits (392), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 177/352 (50%), Gaps = 30/352 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQG---KALPDDTVK 79
           + L+PGDG+GKE   +   V           F+  ++   WE     G   K      V+
Sbjct: 29  VTLLPGDGVGKECTDSVVSV-----------FNAENIPIDWEIVNISGLDHKEGVAAAVQ 77

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMI 137
            L+    G L G   +     +G+ S  VA RK+L +YANV   KS++  K    +VD++
Sbjct: 78  SLRRNKIG-LKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLV 136

Query: 138 IVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHAT 197
           ++RENTE  +   E   V+      V E++K  +   T +IA  A + +    +  G   
Sbjct: 137 VIRENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYA----QKNGRKA 187

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVV 257
           +   HK+N++   DGLFR     + EK   +Y +++ +  IVD+   +   +P  FDV+V
Sbjct: 188 VCAVHKANIMKLGDGLFRNTVTSIGEK---EYPDIETSSIIVDNASMQAVAKPHQFDVLV 244

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            P++YG I+ +  AAL+G  G+V  AN G E  + EP       DI G+ I+NP A + S
Sbjct: 245 TPSMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLS 304

Query: 317 TALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           +ALML  LG  +  + I  AV   + +GDV T D+GG ATT +    ++ K+
Sbjct: 305 SALMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  148 bits (374), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 196/368 (53%), Gaps = 38/368 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSK-HGLQFDFIDLKAGWEAFQQQGKALPDDTVKVL 81
           I ++PGD +G+E++    +VL+ +  K HG++F+F     G +A  + G  LPD+T++  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 82  KEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRPVKSV----------EK 128
           K Q    L GAV  P     G   P   ++ +RKELGLY N+RP K +          ++
Sbjct: 67  K-QSDAVLLGAVGGPKWGT-GKVRPEQGLLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 129 GNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
              +  D ++VRE    +Y    +    E  G+ VA   ++ S    ++I  +A  +SLQ
Sbjct: 125 EVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMAAFLSLQ 180

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S      + +   ++   ++  +K   Q++DS    + +
Sbjct: 181 NDPPLPIWSL---DKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVK 232

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 233 NPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPD 292

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +A +G  NP+ATI S A+ML+  L   +  + I +AV   L +G + T DLGG +TT ++
Sbjct: 293 LA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG-IRTADLGGNSTTSEL 350

Query: 361 VDDILSKI 368
            D +  ++
Sbjct: 351 GDAVAQEL 358

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/365 (33%), Positives = 185/365 (50%), Gaps = 37/365 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALG-SKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           K+ ++PGD IG+EVI    +VL A+  ++  + F+F     G  A    G  L D T++ 
Sbjct: 6   KVVVLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRPVKSVEKGN------- 130
            K      L GAV  P    +G   P   ++A+RKELGLYAN+RP   + K         
Sbjct: 66  AK-AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLK 123

Query: 131 ---DRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D +I+RE    +Y    K   D+  G         +SEV   +I  +   ++L
Sbjct: 124 PEIAQGTDFVILRELVGGIYFGERKE--DDGDGVAWDSEKYTVSEV--ERITRMGAFLAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q         L    K+NVL+ S  L+R   + V E  K ++ ++    Q++DS    M 
Sbjct: 180 QH---DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMI 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE------IVIGEPCHGSAP 300
           + P  F+ +V+  N++GDI+SD A+ + GSLG++PSA++  E        + EPCHGSAP
Sbjct: 233 KNPRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  KG +NPIA I S A+ML+  L   +  + I  AV   +I+  + T DLGG  TT +
Sbjct: 293 DLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNNTTTE 350

Query: 360 VVDDI 364
           V D +
Sbjct: 351 VGDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 191/369 (51%), Gaps = 37/369 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  ++FDF +   G  A    G  LPD+ ++ 
Sbjct: 6   KIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 66  SK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D ++VRE    +Y    K    E  G  VA   ++ +    ++I  +A  ++L
Sbjct: 124 PQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  K+++  +K   Q++DS    + 
Sbjct: 180 QHEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NPIATI S A+ML+  L  PE  + I  AV   L  G + T DLGG  +T +
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTE 350

Query: 360 VVDDILSKI 368
           V D +  ++
Sbjct: 351 VGDAVAEEV 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 191/369 (51%), Gaps = 37/369 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  ++FDF +   G  A    G  LPD+ ++ 
Sbjct: 6   KIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 66  SK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D ++VRE    +Y    K    E  G  VA   ++ +    ++I  +A  ++L
Sbjct: 124 PQFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  K+++  +K   Q++DS    + 
Sbjct: 180 QHEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NP+ATI S A+ML+  L  PE  + I  AV   L  G + T DLGG  +T +
Sbjct: 293 DLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAG-IRTGDLGGSNSTTE 350

Query: 360 VVDDILSKI 368
           V D +  ++
Sbjct: 351 VGDAVAKEV 359

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  141 bits (356), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 187/364 (51%), Gaps = 35/364 (9%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  ++F+F     G  A    G+ LPD +++ 
Sbjct: 6   KIVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEA 65

Query: 81  LKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSVEK 128
            K +    L GAV  P   T        ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 66  AK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 129 GNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
            + R  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++LQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S  L+R   K V E  K+++  +    Q++DS    M +
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PEIVIG----EPCHGSAPD 301
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+        EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +  KG  NPIATI S A+MLE  L   E    + +AV   L  G + T DL G  +TQ+V
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSG-IRTGDLRGSNSTQEV 351

Query: 361 VDDI 364
            D +
Sbjct: 352 GDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  141 bits (356), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 190/369 (51%), Gaps = 37/369 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  + FDF +   G  A    G  LPD+ ++ 
Sbjct: 6   KIVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 66  SK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D ++VRE    +Y    K    E  G  VA   ++ +    ++I  +A  ++L
Sbjct: 124 PQFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  K+++  +K   Q++DS    + 
Sbjct: 180 QHEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NPIATI S A+ML+  L  PE  + I  AV   L  G + T DLGG  +T +
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAG-IRTGDLGGSNSTTE 350

Query: 360 VVDDILSKI 368
           V D +  ++
Sbjct: 351 VGDAVAKEV 359

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  140 bits (354), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 188/366 (51%), Gaps = 35/366 (9%)

Query: 20  SMKIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           S  I ++PGD +GKEV     +VL A+   +  ++F+F     G  A    G  LPD+ +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 79  KVLKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSV 126
           +  K +    L GAV  P   T        ++ +RKELGLYAN+RP          +  +
Sbjct: 62  EASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPL 120

Query: 127 EKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS 186
           +    +  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++
Sbjct: 121 KPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLA 176

Query: 187 LQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRM 246
           LQ+       +L    K+NVL+ S  L+R   K V E  K ++ ++    Q++DS    +
Sbjct: 177 LQQNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMIL 229

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 299
            + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 230 VKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSA 289

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358
           PD+    + NPIATI S A+ML+  L   E  + + +AV  N++   V T DLGG  +T 
Sbjct: 290 PDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNSTT 347

Query: 359 QVVDDI 364
           +V D I
Sbjct: 348 EVGDAI 353

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 191/366 (52%), Gaps = 39/366 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEAL-GSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           +I ++PGD IG+EV+    +VL A+  S   + FDF     G  A    G ALPD+ +  
Sbjct: 6   RIVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            KE     L GAV  P  +  G   P   ++ LR+ELG+YAN+RP          +  + 
Sbjct: 66  AKE-ADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPLR 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               R+ D+++VRE     Y    + + DE  G  VA    + +    ++IA +A  ++L
Sbjct: 124 PEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFLAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  + ++  V+   Q++DS    + 
Sbjct: 180 QHDPPLPVWSLD---KANVLASSR-LWR---KTVEETFQSEFPNVQLQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P  F+ VVV  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAP 292

Query: 301 DI-AGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358
           D+ AGK  +NPI  I S A+ML+  L      + + +AV   L  G V T DL G ++T 
Sbjct: 293 DLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSG-VRTGDLLGSSSTS 349

Query: 359 QVVDDI 364
           +V D I
Sbjct: 350 EVGDAI 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  137 bits (346), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 185/360 (51%), Gaps = 35/360 (9%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +   QF+F     G  A    G+ LPD +++ 
Sbjct: 6   KIVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEA 65

Query: 81  LKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSVEK 128
            K +    L GAV  P   T        ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 66  AK-KSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKP 124

Query: 129 GNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
              R  D ++VRE    +Y    K    E TG  VA   ++ S    ++I  +A  ++LQ
Sbjct: 125 ECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLALQ 180

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S  L+R   K V E  K+++  +    Q++DS    + +
Sbjct: 181 HSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 301
            P   + V++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +  KG  NPIATI S A+ML+  L   E    + +AV   L  G V T DL G +TT +V
Sbjct: 294 LP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSG-VRTADLKGTSTTSEV 351

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 182/364 (50%), Gaps = 35/364 (9%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+    + + FDF     G  A    G  LPD+ ++ 
Sbjct: 5   KIVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEA 64

Query: 81  LKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRPVKSVEKGN-------- 130
            K      L GAV  P   T        ++ +RKELGLYAN+RP     +          
Sbjct: 65  SK-NSDAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 131 --DRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
              +  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++LQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S  L+R   K V E  K+++  +    Q++DS    + +
Sbjct: 180 HNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PEIVIG----EPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+        EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +  KG  NPIATI S A+ML+  L   +    I +AV   L  G + T DLGG  +T +V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAG-IRTGDLGGSNSTTEV 350

Query: 361 VDDI 364
            D I
Sbjct: 351 GDAI 354

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  136 bits (343), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 186/366 (50%), Gaps = 35/366 (9%)

Query: 20  SMKIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           S  I ++PGD +G+E+     +VL+A+   +    F+F     G  A    G  LPD+ +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 79  KVLKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSV 126
           +  K +    L GAV  P   T        ++ +RKEL LYAN+RP          +  +
Sbjct: 62  EASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPL 120

Query: 127 EKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS 186
           +    +  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++
Sbjct: 121 KAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLA 176

Query: 187 LQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRM 246
           LQ        +L    K+NVL+ S  L+R   K V +  K+++  +  N Q++DS    +
Sbjct: 177 LQHNPPLPIWSL---DKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMIL 229

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSA 299
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSA
Sbjct: 230 VKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSA 289

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358
           PD+A KG  NP+ATI S A+ML+  L   E    I KAV   L  G + T DLGG  +T 
Sbjct: 290 PDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG-IRTGDLGGSNSTS 347

Query: 359 QVVDDI 364
           +V D +
Sbjct: 348 EVGDAV 353

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  134 bits (336), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 155/291 (53%), Gaps = 25/291 (8%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82
           + LIPGDG+GKEV  + K + EA      + ++ I++K      Q   K   ++ V+ L+
Sbjct: 31  VTLIPGDGVGKEVTDSVKTIFEA--ENIPIDWETINIK------QTDHKEGVNEAVESLR 82

Query: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR--NVDMIIVR 140
               G L G   +P  +  G+ S  VALRK+L +YANV   KS++    R  ++D+I++R
Sbjct: 83  RNKIG-LKGLWHTPADQ-TGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIR 140

Query: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200
           ENTE  +   E   V       V E++K +++  T +IA  A D +    K      +T 
Sbjct: 141 ENTEGEFSGLEHESV-----PGVVESLKIMTKPKTERIARFAFDFA----KKYNRKAVTA 191

Query: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPN 260
            HK+N++   DGLFR I  ++ +K   +Y ++  +  IVD+   +   +P  FDV+V P+
Sbjct: 192 VHKANIMKLGDGLFRNIITEIGQK---EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPS 248

Query: 261 LYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP-CHGSAPDIAGKGISNP 310
           +YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP
Sbjct: 249 MYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  137 bits (345), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 184/364 (50%), Gaps = 37/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVL 81
           I ++PGD +G+E+     +VL A+ S +  + FDF     G  A    G  LPD+ ++  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 82  KEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVEK 128
           K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 150 K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 207

Query: 129 GNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
              +  D+ IVRE    +Y    K   DE  G         +SEV  ++I  +A  ++LQ
Sbjct: 208 EIVKGTDICIVRELVGGIYFGERKE--DEGDGVAWDSEKYSVSEV--QRITRMAGFLALQ 263

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S  L+R   K V E  K+++  +    Q++DS    + +
Sbjct: 264 HNPPLPVWSLD---KANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 316

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PEIVIG----EPCHGSAPD 301
            P   + VV+A N++GDI+SD A+ + GSLG++PSA++   P+        EPCHGSAPD
Sbjct: 317 NPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 376

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +  KG  NP+ATI S A+ML+  L   E    + KAV   L  G V T DL G  +T +V
Sbjct: 377 LP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG-VRTADLRGSNSTSEV 434

Query: 361 VDDI 364
            D I
Sbjct: 435 GDAI 438

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  134 bits (336), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 185/366 (50%), Gaps = 38/366 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGSKH--GLQFDFIDLKAGWEAFQQQGKALPDDTVK 79
           KI ++PGD +G+E++    +VLEA+ S    G++F+F     G  +    G  LPD+ + 
Sbjct: 5   KIVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALD 64

Query: 80  VLKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRPVKSV---------- 126
             K      L GAV  P     G   P   ++ +RKEL LYAN+RP   V          
Sbjct: 65  AAK-NSDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPL 122

Query: 127 EKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDIS 186
           ++   +  D  +VRE    +Y    K   D+  G+        I EV  ++I  +A  ++
Sbjct: 123 KEEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAAFLA 178

Query: 187 LQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRM 246
           LQ        +L    K+NVL+ S  L+R   K V E  K+++  +K   Q++DS    +
Sbjct: 179 LQHDPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAMIL 231

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PEIVIG----EPCHGSA 299
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+        EPCHGSA
Sbjct: 232 VKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSA 291

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358
           PD+  KG  NPIATI S A+ML+  L   +    I +AV   L  G + T DL G  +T 
Sbjct: 292 PDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAG-IRTADLKGSNSTS 349

Query: 359 QVVDDI 364
           +V D +
Sbjct: 350 EVGDAV 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  133 bits (335), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 187/369 (50%), Gaps = 37/369 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  ++FDF     G  A    G  L D+ ++ 
Sbjct: 6   KIVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 66  SK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               R  D ++VRE    +Y    K    E  G  VA   ++ +    ++I  +A  ++L
Sbjct: 124 PQFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  K+++  +K   Q++DS    + 
Sbjct: 180 QHQPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NPIATI S A+ML+  L      Q I  AV   L  G + T DLGG  +T +
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAG-IRTGDLGGSNSTIE 350

Query: 360 VVDDILSKI 368
           V D +  ++
Sbjct: 351 VGDAVAKEV 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 188/367 (51%), Gaps = 37/367 (10%)

Query: 20  SMKIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTV 78
           S  I ++PGD  G+E+     +VLEA+       +F+F     G  A    G  LPDD +
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDAL 61

Query: 79  KVLKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKS 125
              K+     L GAV  P     G   P   ++ +RKEL LYAN+RP          +  
Sbjct: 62  AAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 119

Query: 126 VEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDI 185
           ++  + +  D ++VRE    +Y    K    E  G  VA   ++ ++   +++  +A  +
Sbjct: 120 LKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFL 175

Query: 186 SLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYR 245
           +LQ        +L    K+NVL+ S  L+R   K V E  K+++ ++K N Q++DS    
Sbjct: 176 ALQHNPPLPIWSLD---KANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMI 228

Query: 246 MFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGS 298
           + + P   + +V+  NL+GDI+SD A+ + GSLG++PSA++   P+      + EPCHGS
Sbjct: 229 LVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGS 288

Query: 299 APDIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATT 357
           APD+  KG  NPIA I S A+ML+  L   +  + + KAV   L  G V T DLGG  +T
Sbjct: 289 APDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSG-VRTGDLGGSNST 346

Query: 358 QQVVDDI 364
            +V D I
Sbjct: 347 SEVGDAI 353

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  128 bits (321), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 182/364 (50%), Gaps = 36/364 (9%)

Query: 23  IGLIPGDGIGKEVIPAGKQVLEALGS--KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           I ++PGD +G+E+     +VL A+       + F F     G  A    G  LPD+ ++ 
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALEA 66

Query: 81  LKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSVEK 128
            K +    L GAV  P   T        ++ +RKEL LYAN+RP          +  ++ 
Sbjct: 67  SK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 125

Query: 129 GNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQ 188
              R  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++LQ
Sbjct: 126 EIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMALQ 181

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFR 248
                   +L    K+NVL+ S  L+R   K V E  K+++ ++    Q++DS    + +
Sbjct: 182 HNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMILVK 234

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 235 NPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 294

Query: 302 IAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360
           +  KG  NP+ATI S A+ML+  L   E  + I +AV   L  G + T DL G  +T +V
Sbjct: 295 LP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSG-IRTADLKGTNSTTEV 352

Query: 361 VDDI 364
            D +
Sbjct: 353 GDAV 356

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  127 bits (320), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 116/365 (31%), Positives = 182/365 (49%), Gaps = 36/365 (9%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS--KHGLQFDFIDLKAGWEAFQQQGKALPDDTVK 79
           KI ++PGD +G E+     +VL+A+       ++FDF     G  A    G  L D+ ++
Sbjct: 6   KIVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALE 65

Query: 80  VLKEQCQGALFGAVQSPT--TKVAGYSSPIVALRKELGLYANVRP----------VKSVE 127
             K +    L GAV  P   T        ++ +RKELGLYAN+RP          +  + 
Sbjct: 66  ASK-KADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D ++VRE    +Y    K    E  G  VA   ++ S     +I  +A  ++L
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V    K+++  +    Q++DS    + 
Sbjct: 181 QHNPPLPIWSL---DKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +++  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NP+ATI S A+ML+  L   +  + + +AV   L  G V T DLGG  +TQ+
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAG-VRTGDLGGSNSTQE 351

Query: 360 VVDDI 364
           V D I
Sbjct: 352 VGDAI 356

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  127 bits (318), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 181/361 (50%), Gaps = 37/361 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
            I + PGD IG E++    +VL+A+      + F +     G  A    G+ L D+ ++V
Sbjct: 6   NITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEALQV 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRPVKSV----------E 127
            K      L GAV  P     G   P   ++ +RKELG+YAN+RP + V          +
Sbjct: 66  AK-NSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
           +   +  D +IVRE    +Y    +    EA    VA   +  S    ++I  +A  ++L
Sbjct: 124 REIVQGTDFVIVRELVGGIYFGERQ----EAGDDGVAWDKESYSVPEIQRITRMAAFLAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q        +L    K+NVL+ S  L+R   K V E  K+++  +  N  ++DS    + 
Sbjct: 180 QHNPPLPVWSL---DKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDSAAMTLV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + VV+  N++GDI+SD A+ + GSLG++PSA++   P+    + + EPCHGSAP
Sbjct: 233 QNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+     +NPIATI S A+M +  L   +    I +AV   +  G + T DLGGK TT +
Sbjct: 293 DLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAG-IKTGDLGGKNTTTE 350

Query: 360 V 360
           V
Sbjct: 351 V 351

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  127 bits (318), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 188/369 (50%), Gaps = 37/369 (10%)

Query: 22  KIGLIPGDGIGKEVIPAGKQVLEALGS-KHGLQFDFIDLKAGWEAFQQQGKALPDDTVKV 80
           KI ++PGD +G+E+     +VL+A+   +  ++FD+     G  A    G  LPD+ +  
Sbjct: 6   KIVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDA 65

Query: 81  LKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP----------VKSVE 127
            K+     L GAV  P     G   P   ++ +RKEL LYAN+RP          +  ++
Sbjct: 66  AKKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 123

Query: 128 KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISL 187
               +  D ++VRE    +Y    K    E  G  VA   ++ S    ++I  +A  ++L
Sbjct: 124 PEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLAL 179

Query: 188 QRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMF 247
           Q+       +L    K+NVL+ S  L+R   K V E  K+++  +    Q++DS    + 
Sbjct: 180 QQNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILV 232

Query: 248 REPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PE----IVIGEPCHGSAP 300
           + P   + +V+  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAP
Sbjct: 233 KSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 292

Query: 301 DIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359
           D+  K   NPIATI S A+ML+  L   E    + +AV   L  G + T DL G+ +T +
Sbjct: 293 DLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAG-IRTADLRGENSTSE 350

Query: 360 VVDDILSKI 368
           V D ++  +
Sbjct: 351 VGDAVVKAV 359

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  114 bits (285), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 109/372 (29%), Positives = 182/372 (48%), Gaps = 42/372 (11%)

Query: 18  PKSMKIGLIPGDGIGKEVIPAGKQVLEALGS--KHGLQFDFIDLKAGWEAFQQQGKALPD 75
           P+   I ++PGD +G EV     ++L+A+     + ++F+F     G  A    G  LPD
Sbjct: 2   PEIKNIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPD 61

Query: 76  DTVKVLKEQCQGALFGAVQSPTTKVAGYSSP---IVALRKELGLYANVRP---------- 122
           ++++  K +    L GAV  P     G   P   ++ +RKEL LYAN+RP          
Sbjct: 62  ESLEASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLD 119

Query: 123 VKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIA 182
           +  +++   +  D  +VRE    +Y    K    E  G  VA   ++ S    ++I  +A
Sbjct: 120 LSPLKEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMA 175

Query: 183 LDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSM 242
             +++Q        +L    K+NVL+ S  L+R   K V E  ++++  +K + Q++DS 
Sbjct: 176 AFLAMQHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSA 228

Query: 243 VYRMFREPECFD-VVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPEIVIGE 293
              + + P   + +++  N++GDI+SD A+ + G        SL  +P  N      + E
Sbjct: 229 AMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSA--FGLYE 286

Query: 294 PCHGSAPDIAGKGISNPIATIRSTALMLEF-LGHPEPAQDIYKAVDANLIKGDVNTPDLG 352
           PCHGSAPD+  KG  NPI TI S A+ML+  L   E    + +AV   ++  ++ T DLG
Sbjct: 287 PCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADLG 344

Query: 353 GKATTQQVVDDI 364
           G  +T  + D +
Sbjct: 345 GSNSTSDIGDAV 356

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 102/222 (45%), Gaps = 25/222 (11%)

Query: 149 KTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLS 208
           K E   V +  G  VA A+    E + R  A  +  ++LQ+        L ++ K+ +L 
Sbjct: 176 KAEVMEVYDYKGPGVALAMYNTDE-SIRGFAHSSFKLALQK-----KLNLFLSTKNTILK 229

Query: 209 QSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDI 265
           + DG F++I ++VY+   K K+ E  + Y  +++D MV +M +    F ++   N  GD+
Sbjct: 230 KYDGRFKDIFQEVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDV 288

Query: 266 LSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS----------APDIAGKGISNPIAT 313
            SD  A   GSLG++ S  + P+      E  HG+            + +   I++  A 
Sbjct: 289 QSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAW 348

Query: 314 IRSTALMLEFLGHPEPAQ--DIYKAVDANLIKGD-VNTPDLG 352
            R  A   E  G P+  +  +I ++   N ++ D + T DL 
Sbjct: 349 TRGLAKRGELDGTPDVVRFANILESATLNTVQQDGIMTKDLA 390

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG+F++I + +YE+  K+K+ E  + Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQMLKSSGGY- 268

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++I + +Y+++ K K+ E  + Y  +++D MV +M +    F 
Sbjct: 208 LFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGF- 266

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+  I   E  HG+
Sbjct: 267 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFESEAAHGT 312

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+ + +D+YE+   +  E   + Y  +++D MV +M +    F 
Sbjct: 209 LYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDLGIWYEHRLIDDMVAQMLKSKGGF- 267

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 268 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGKTFESEAAHGT 313

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 20/191 (10%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGEVK--Y 234
            A  + +++L+R        L  T K+ +L   D  F++I  ++++K  K+K+  +K  Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 293 EPCHGSAPDIAGKG------ISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLI-KGD 345
           E  HG+      K        +N IA+I +    +   G  +   D+ K    NL+ K  
Sbjct: 306 EAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKF--GNLLEKAT 363

Query: 346 VNTPDLGGKAT 356
           ++T  +GGK T
Sbjct: 364 LDTVQVGGKMT 374

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 69/133 (51%), Gaps = 15/133 (11%)

Query: 175 TRK----IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKN-KDKY 229
           TRK     A  + +++L+R        L  T K+ VL + DG F++I +++YE + K ++
Sbjct: 188 TRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQF 242

Query: 230 GEVK--YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
            E+   Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 243 DEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAP 301

Query: 288 E--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 77/148 (52%), Gaps = 13/148 (8%)

Query: 157 EATGTR-VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFR 215
           + TG R VA A+    E + R  A  +  ++L +        L ++ K+ +L Q DG F+
Sbjct: 181 KGTGARGVALAMYNTDE-SIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFK 234

Query: 216 EICKDVY-EKNKDKYGE--VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAA 272
           +I ++VY ++ + ++ +  + Y  +++D MV +M +    F V+   N  GD+LSD  A 
Sbjct: 235 DIFQEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQ 293

Query: 273 LVGSLGVVPSANVGPE--IVIGEPCHGS 298
             GSLG++ S  V P+      E  HG+
Sbjct: 294 GFGSLGLMTSMLVTPDGKTFESEAAHGT 321

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG +++I  D+YEK+ KDK+    + Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           V+   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L Q DG F++I K VYE   K+ + E  + Y  +++D MV +M +    F 
Sbjct: 205 LYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQMLKSKGGF- 263

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 264 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGT 309

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGEV--KY 234
            A  + +++L+R        L  T K+ +L + DG F++I + +YE+  K K+  V   Y
Sbjct: 194 FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 308 EAAHGT 313

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I +++YE +     E   + Y  +++D MV +M +    F 
Sbjct: 218 LFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQMIKSKGGF- 276

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDI-----AGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+          GK  
Sbjct: 277 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYEQGKET 336

Query: 308 S-NPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIK 343
           S N IA+I + +  L   G  +   D+ K   ANL++
Sbjct: 337 STNSIASIFAWSRGLAKRGELDSTPDVIKF--ANLLE 371

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I ++VYE + K K+ +  + Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I +++YE + K K+ E  + Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 75/149 (50%), Gaps = 12/149 (8%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYG--EVKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ ++V++   KDK+    +KY  +++D MV +M +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 308 S-NPIATIRSTALMLEFLGHPEPAQDIYK 335
           S N IA+I + +  L   G  +   D+ K
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMK 376

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEK---NKDKYGEVKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L Q DG F++I +++Y K   +K K   + Y  +++D MV +M +    F 
Sbjct: 213 LYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF- 271

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 272 IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFESEAAHGT 317

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 163 VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY 222
           VA A+   +E + R  A  + +++LQR        L  T K+ +L + DG F++  + +Y
Sbjct: 180 VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 223 E---KNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGV 279
           E   + + +   + Y  +++D MV +M +    F V+   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 280 VPSANVGPE--IVIGEPCHGS 298
           + S  V P+      E  HG+
Sbjct: 293 MTSVLVTPDGRAFESEAAHGT 313

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I + +YE + K K+ +  + Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I ++VYE + K K+ +  + Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 27/196 (13%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++I  ++Y  + KD++ +  + Y  +++D MV +M +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP-----DIAGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+         AGK  
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKPT 329

Query: 308 S-NPIATIRSTALMLEFLGHPEPAQDIYK--------AVDANLIKGDVNTPDL------G 352
           S N IA+I + +  L   G  +   D+ K         +D   I G + T DL      G
Sbjct: 330 STNSIASIFAWSRGLIQRGKLDNNPDLVKFGELLEQSTLDTVQIDG-IMTKDLALLIGQG 388

Query: 353 GKATTQQVVDDILSKI 368
             ATT+  +D + +++
Sbjct: 389 KYATTEGFIDAVTNRM 404

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 12/144 (8%)

Query: 160 GTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICK 219
           G  VA A+   +E +    A  + +++L+R +      L  T K+ +L + DG F++I +
Sbjct: 176 GGGVAMAMYNTTE-SIEGFAKASFELALERKQP-----LYSTTKNTILKKYDGKFKDIFE 229

Query: 220 DVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 276
            +YEK      E   + Y  +++D MV +M +    + ++   N  GD+ SD  A   GS
Sbjct: 230 AMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGS 288

Query: 277 LGVVPSANVGPE--IVIGEPCHGS 298
           LG++ S  V P+      E  HG+
Sbjct: 289 LGLMTSVLVTPDGKTFESEAAHGT 312

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYE---KNKDKYGEVKY 234
            A  + +++LQR        L  T K+ +L + DG F++I + +Y    K K +   + Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 308 EAAHGT 313

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 86/171 (50%), Gaps = 15/171 (8%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +++++ + K ++ E  ++Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAPDIAGK------G 306
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+      K       
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEET 342

Query: 307 ISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIK-GDVNTPDLGGKAT 356
            +NPIA+I +    +   G  +   D+ +   AN+++   +NT    GK T
Sbjct: 343 STNPIASIFAWTRGIAKRGELDGTPDVVRF--ANILESATLNTVQEDGKMT 391

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L    K+ +L + DGLF++I + +Y+ + K K+ E  + +  +++D MV +M +    F 
Sbjct: 210 LFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITFEHRLIDDMVAQMLKSNGGF- 268

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+  +   E  HG+
Sbjct: 269 ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFESEAAHGT 314

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 25/211 (11%)

Query: 160 GTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICK 219
           G  VA A+    E + R  A  +  ++L +        L ++ K+ +L + DG F++I +
Sbjct: 187 GAGVALAMYNTDE-SIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFKDIFQ 240

Query: 220 DVYE---KNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 276
           ++++   K + +   + Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 241 EIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 277 LGVVPSANVGPE--IVIGEPCHGS----------APDIAGKGISNPIATIRSTALMLEFL 324
           LG++ S  V P+      E  HG+            + +   I++  A  R  A   E  
Sbjct: 300 LGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 359

Query: 325 GHPEPAQ--DIYKAVDANLIKGD-VNTPDLG 352
           G PE  +  ++ ++   N ++ D + T DL 
Sbjct: 360 GTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE---KNKDKYGEVKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I + VYE   K+K +   + Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 171 SEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYG 230
           +E + R  A  +  ++L +        L ++ K+ +L + DG F++I +++Y+    K  
Sbjct: 195 TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQF 249

Query: 231 E---VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
           E   + Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 250 EAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 308

Query: 288 E--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 309 DGKTFESEAAHGT 321

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGEV--KYNEQIVDSMVYRMFREPECFD 254
           L +  K+ +L + DG F+ I  D+Y+   K+K+ ++   Y  +++D MV +M +    F 
Sbjct: 210 LFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF- 268

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGT 314

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 79/179 (44%), Gaps = 13/179 (7%)

Query: 189 RLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYR 245
           RL       L ++ K+ +L Q DG F+++ +++Y+       E   + Y  +++D MV +
Sbjct: 215 RLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQ 274

Query: 246 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP--- 300
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+     
Sbjct: 275 MVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHF 333

Query: 301 --DIAGKGIS-NPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKAT 356
               AGK  S N IA+I +    L   G  +   D+     A L     NT  L G  T
Sbjct: 334 RQHQAGKETSTNSIASIFAWTRGLAKRGELDNTPDVVNFAHA-LEAATTNTVQLDGIMT 391

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGE--VKY 234
            A  + +++L+R        L  T K+ +L   D  F++I   ++ EK ++K+    +KY
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQALGIKY 246

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 12/141 (8%)

Query: 163 VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY 222
           VA A+   SE +    A  + +++LQR        L  T K+ +L + DG F+++ + +Y
Sbjct: 178 VALAMYNTSE-SIAGFARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMY 231

Query: 223 E-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGV 279
             + + ++ E  + Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG+
Sbjct: 232 AAEYQSRFEELGIWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGL 290

Query: 280 VPSANVGPE--IVIGEPCHGS 298
           + S  V P+      E  HG+
Sbjct: 291 MTSVLVTPDGKTFESEAAHGT 311

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 98/211 (46%), Gaps = 25/211 (11%)

Query: 160 GTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICK 219
           G+ VA A+    E + R  A  +  ++L +        L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 220 DVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 276
           ++++ + K K+    + Y  +++D MV +M +    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 277 LGVVPSANVGPE--IVIGEPCHGSAP----------DIAGKGISNPIATIRSTALMLEFL 324
           LG++ S  V P+      E  HG+            + +   I++  A  R  A   E  
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 325 GHPEPAQ--DIYKAVDANLIKGD-VNTPDLG 352
           G P+  +  ++ +A   N ++ D + T DL 
Sbjct: 363 GTPDVVRFANLLEAATLNTVQQDGIMTKDLA 393

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 174 ATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVK 233
           + R  A  + +++L+         L  T K+ +L + DG F++  + +YE    +  E K
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 234 ---YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE-- 288
              Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 289 IVIGEPCHGS 298
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGE--VKY 234
            A  + +++L+R        L  T K+ +L + DG F+++ + +Y ++ + ++ E  + Y
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELGIWY 245

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 246 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFES 304

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 305 EAAHGT 310

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 12/141 (8%)

Query: 163 VAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY 222
           VA A+   +E  T   A  + +++L+R        L  T K+ +L + DG F++I + +Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 223 EKN-KDKYG--EVKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGV 279
             + +DK+    + Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 280 VPSANVGPE--IVIGEPCHGS 298
           + S  V P+      E  HG+
Sbjct: 291 MSSVLVTPDGKTFESEAAHGT 311

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 71/150 (47%), Gaps = 12/150 (8%)

Query: 154 YVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGL 213
           +V +  G  VA A+    E + R  A  +  ++L +        L +  K+ +L Q DG 
Sbjct: 178 HVHDFEGAGVALAMYNTDE-SIRGFAHASFRLALSK-----QLNLFLATKNTILKQYDGR 231

Query: 214 FREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGA 270
           F+++ + +Y+    +  E   + Y  +++D MV +M +    F V+   N  GD+ SD  
Sbjct: 232 FKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIV 290

Query: 271 AALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           A   GSLG++ S  + P+      E  HG+
Sbjct: 291 AQGFGSLGLMSSVLITPDGNAFESEAAHGT 320

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 6/109 (5%)

Query: 195 HATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPE 251
           +  L +  K+ +L + DG F++I +++YE    K  E   + Y  +++D MV +M +   
Sbjct: 219 NMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKG 278

Query: 252 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
            + ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 GY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 72/147 (48%), Gaps = 12/147 (8%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L +  K+ +L + DG F++I + +Y  + K K+ +  + Y  +++D MV +M +    F 
Sbjct: 219 LFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKSKGGF- 277

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP------DIAGKG 306
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+         +  + 
Sbjct: 278 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQMGEET 337

Query: 307 ISNPIATIRSTALMLEFLGHPEPAQDI 333
            +N IA+I + +  L   G  +  +D+
Sbjct: 338 STNSIASIFAWSRGLAKRGELDGTKDV 364

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVK---YNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++ + +YE       E K   Y  +++D MV +M +    + 
Sbjct: 210 LYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY- 268

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 269 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGT 314

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++I +++Y+       E   + Y  +++D MV +M +    F 
Sbjct: 225 LYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGT 329

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++ + +Y +N K+K+    + Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFESEAAHGT 311

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++ + +Y E  K+K+    + Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 311

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKY 234
            A  + +++L+R        L  T K+ +L   D  F+EI   +++ + K+K+    + Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F +V   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKN-KDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++ + +Y ++ K+K+    + Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 311

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYG--EVKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++I + +Y E+ ++K+    + Y  +++D MV +M +    F 
Sbjct: 218 LYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWYEHRLIDDMVAQMLKSKGGF- 276

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 277 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFESEAAHGT 322

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 16/126 (12%)

Query: 188 QRLKSRGHAT----------LTVTHKSNVLSQSDGLFREICKDVYE---KNKDKYGEVKY 234
           + ++  GHA+          L ++ K+ +L + DG F++I +++Y+   K + +   + Y
Sbjct: 198 ESIRGFGHASFKLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFY 257

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 258 EHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 316

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 317 EAAHGT 322

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVY-EKNKDKYGE--VKY 234
            A  + +++L+R        L  T K+ +L + DG F+++ + +Y E  K+K+    + Y
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIG 292
             +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE---KNKDKYGEVKYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L   DG F++I +++Y+   K + +   + Y  +++D MV +M +    F 
Sbjct: 220 LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHGIYYEHRLIDDMVAQMIKSKGGF- 278

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 79/171 (46%), Gaps = 15/171 (8%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYE-KNKDKYGE--VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L   D  F++I   +++ + K+++    + Y  +++D MV +M +    F 
Sbjct: 207 LFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITYEHRLIDDMVAQMLKSKGGF- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGSAP------DIAGKG 306
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+            K 
Sbjct: 266 IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHFRLHQRGEKT 325

Query: 307 ISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLI-KGDVNTPDLGGKAT 356
            +N IA+I +    +   G  +   D+ K    NL+ K  ++T  + GK T
Sbjct: 326 STNSIASIFAWTRAIIQRGKLDNTNDVIKF--GNLLEKVTLDTVQIDGKMT 374

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGE---VKYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++I +++YE+   +  E   + Y  +++D MV +M +    F 
Sbjct: 215 LYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRLIDDMVAQMLKSKGGF- 273

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPE--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 274 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAHGT 319

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 36.6 bits (83), Expect = 0.005,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 319 LMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368
           LML  LG  E A  I KAV   + +G   T D+GG ++T    ++I++K+
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 118 ANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRK 177
           A +R V  VE   D    + +VR + E LY    KT  D+   TR+   IKR+S+     
Sbjct: 703 AKLRLVNRVEV-EDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNLIKRMSQDTLEN 761

Query: 178 IATIALDISLQRLKSRGHATLTVTH 202
             T++ D  ++ ++SRG   L + +
Sbjct: 762 RGTLSYDTIVKTVRSRGFTMLQLNN 786

>KLLA0C17380g Chr3 (1524716..1528075) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P23201 Saccharomyces cerevisiae
           YLL021W SPA2 Component of the polarisome which functions
           in actin cytoskeletal organization during polarized
           growth acts as a scaffold for Mkk1p and Mpk1p cell wall
           integrity signaling components potential Cdc28p
           substrate
          Length = 1119

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 49/94 (52%), Gaps = 14/94 (14%)

Query: 105 SPIVALRKELGLYANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKT---EKT----YVDE 157
           SP  + + ++G  +     +SVE+  DR+++++++  N  D  I T   EK+     +DE
Sbjct: 308 SPFTSNKNKMGSLS-----QSVERNKDRDIELLVLEGNKLDSTITTLEREKSELLNQLDE 362

Query: 158 --ATGTRVAEAIKRISEVATRKIATIALDISLQR 189
                 R+ E ++++ + A +   T ALD + Q+
Sbjct: 363 LKTNNQRLTEEVQQLKQNADQSSTTKALDSNFQK 396

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON}
           Anc_3.455 YPR122W
          Length = 1201

 Score = 31.6 bits (70), Expect = 4.0,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 195 HATLTVT--HKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPEC 252
           H TL     ++ N++ Q   L+R + KD  E+  D  G ++ N Q++D + Y     P  
Sbjct: 412 HTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLD-IKYLFKGSPSI 470

Query: 253 FDVVVAPNLYGDILSDG 269
             +    N Y + ++DG
Sbjct: 471 TQLYSGKNQYSESMTDG 487

>KNAG0F00220 Chr6 complement(21846..22952) [1107 bp, 368 aa] {ON}
           Anc_1.32 YDR517W
          Length = 368

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 194 GHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQ--IVDSMVYRMFR 248
           GHA    T K NV S   G FR++  D+  ++ D   +V  ++   + D+  +  FR
Sbjct: 120 GHAAEGTTLKLNVWSAKGGQFRDVYVDLQPRDADSMDDVPVSDDPGVADTRQHATFR 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,164,671
Number of extensions: 1479824
Number of successful extensions: 4515
Number of sequences better than 10.0: 146
Number of HSP's gapped: 4314
Number of HSP's successfully gapped: 146
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)