Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01892g2.286ON46546523940.0
NDAI0G006602.286ON49649716900.0
TDEL0G021702.286ON48448616850.0
TPHA0C034002.286ON49449416370.0
KLLA0E08361g2.286ON49149315860.0
NCAS0G037902.286ON49249415810.0
Kpol_1003.382.286ON49649715790.0
SAKL0E07678g2.286ON47748015570.0
KAFR0H033102.286ON48848915560.0
KLTH0G10362g2.286ON52948715370.0
Ecym_33252.286ON49648815310.0
KNAG0H020002.286ON49849615260.0
YNL022C2.286ON49049115220.0
CAGL0M06941g2.286ON49249115220.0
Skud_14.3072.286ON49049115080.0
TBLA0B069602.286ON50851015090.0
Suva_14.3252.286ON49049115050.0
Kwal_27.115322.286ON47948314880.0
ADL215W2.286ON48449014810.0
Smik_14.3092.286ON49049114660.0
Kpol_1003.152.247ON6331851741e-12
SAKL0E08624g2.247ON6112601732e-12
ADL254W2.247ON6031841713e-12
TBLA0E038502.247ON6322601688e-12
TPHA0H001508.171ON6492851689e-12
TPHA0C031502.247ON6082601661e-11
KLLA0F03399g2.247ON6191851661e-11
CAGL0J10032g2.247ON6192601661e-11
Ecym_32842.247ON6061851652e-11
KLTH0G09460g2.247ON6371851652e-11
Kwal_23.48412.247ON6271851633e-11
NCAS0G030302.247ON4902601623e-11
Suva_14.2802.247ON6202601633e-11
ZYRO0A01562g2.247ON6171851633e-11
KAFR0J009702.247ON6102951624e-11
KNAG0I018702.247ON6292951624e-11
NCAS0B043908.171ON6712801625e-11
YNL061W (NOP2)2.247ON6182601615e-11
TDEL0C041502.247ON6141851608e-11
TDEL0B043908.171ON6732821599e-11
Kpol_1002.1098.171ON6702811599e-11
NDAI0D010502.247ON6251851581e-10
Skud_14.2712.247ON6191851581e-10
AFR179C8.171ON7002781572e-10
KNAG0G015108.171ON6662791562e-10
Smik_14.2662.247ON6181851562e-10
NDAI0B018308.171ON6862801562e-10
SAKL0H19448g8.171ON6912781518e-10
KLTH0H08096g8.171ON6882781519e-10
Smik_2.928.171ON6742821511e-09
KAFR0B022208.171ON6862811501e-09
Suva_2.978.171ON6702811501e-09
CAGL0K01991g8.171ON6722751491e-09
ZYRO0G08998g8.171ON6832821492e-09
YBL024W (NCL1)8.171ON6842811492e-09
TBLA0A087408.171ON6862801492e-09
KNAG0D020508.171ON6822811482e-09
Ecym_23538.171ON6902761446e-09
Skud_2.818.171ON6812841438e-09
TPHA0C028708.171ON6742821421e-08
NCAS0B056408.171ON6592821411e-08
NDAI0B029808.171ON6792831295e-07
KLLA0F12562g8.171ON7041991232e-06
Kwal_14.20818.171ON272132860.047
Skud_5.3108.237ON77547741.8
Suva_5.3058.237ON77747741.8
YER171W (RAD3)8.237ON77847741.8
Smik_5.3438.237ON77547741.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01892g
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   926   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   655   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   653   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   635   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   615   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   613   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   612   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   604   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   603   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   596   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   594   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   592   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   590   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   590   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   585   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   585   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   584   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   577   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   575   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   569   0.0  
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    72   1e-12
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    71   2e-12
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    70   3e-12
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    69   8e-12
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    69   9e-12
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    69   1e-11
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    69   1e-11
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    69   1e-11
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    68   2e-11
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    68   2e-11
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    67   3e-11
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    67   3e-11
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    67   3e-11
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    67   3e-11
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    67   4e-11
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    67   4e-11
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    67   5e-11
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    67   5e-11
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    66   8e-11
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    66   9e-11
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    66   9e-11
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    65   1e-10
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    65   1e-10
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    65   2e-10
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    65   2e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    65   2e-10
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    65   2e-10
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    63   8e-10
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    63   9e-10
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    63   1e-09
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    62   1e-09
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    62   1e-09
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    62   1e-09
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    62   2e-09
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    62   2e-09
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    62   2e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    62   2e-09
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    60   6e-09
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    60   8e-09
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    59   1e-08
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    59   1e-08
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    54   5e-07
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    52   2e-06
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    38   0.047
Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W ...    33   1.8  
Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W ...    33   1.8  
YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to ...    33   1.8  
Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W ...    33   1.8  

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/465 (96%), Positives = 447/465 (96%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKCDIPVVVEQLNKKFPHRVD 180
           LHA                  DQDDGDDATPVRWIRINPLKCDIPVVVEQLNKKFPHRVD
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKCDIPVVVEQLNKKFPHRVD 180

Query: 181 HWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKEDV 240
           HWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKEDV
Sbjct: 181 HWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKEDV 240

Query: 241 VMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVK 300
           VMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVK
Sbjct: 241 VMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVK 300

Query: 301 IHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQ 360
           IHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQ
Sbjct: 301 IHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQ 360

Query: 361 FQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPR 420
           FQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPR
Sbjct: 361 FQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPR 420

Query: 421 RGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           RGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR
Sbjct: 421 RGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/497 (61%), Positives = 386/497 (77%), Gaps = 33/497 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LEY+E +E KG++SGSLQ+ VL++CTKYK+K NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M KSGIL  IP+KKGKP +SRLT+MLLCHDLL SK KRIQMGKHPIK+YVLK+K+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDG-DDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           LH+                  D +D  +D TPVRWIRINPL+C    D+  V+E+L KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
           P RV++W+ + PGSIYYDEY+P+L+GIHP +KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
            K+D+++DACAAPGNKTTH+A+++   A   +    QI+AFEK+P RAK+L+KM   AGC
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDP-HVQIYAFEKDPERAKILEKMIKVAGC 299

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLES-----SNDSQD---- 346
              +++ VGDFT+ A PD+F+DVT  +VDPSCSGSGIFGRK ++S     +ND+ D    
Sbjct: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKK 359

Query: 347 ------------------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEEN 388
                             + L+ RL+KLSSFQFQV+KHAMS P A+KIVYSTCS+HAEEN
Sbjct: 360 STEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419

Query: 389 ERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRA 448
           ERVV+DLLLDSKVK+WGW+++ +  V+PTWPRRG  EEFEEVFRDD  KCQ LA+ CIRA
Sbjct: 420 ERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479

Query: 449 LPREDGGIGFFAVCFQR 465
           LPR+DGGIGFFAVCF+R
Sbjct: 480 LPRDDGGIGFFAVCFER 496

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/486 (63%), Positives = 387/486 (79%), Gaps = 23/486 (4%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LEY+E E++KG+LSGS+Q+ VLK+C +YK+K++PKH+YAVV SCW+Y+  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE+IM +S I   IP+KKGKP +SRLT++L+CHDLLISKQKRIQMGK PIK+YVLK+KTR
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDG-DDATPVRWIRINPLKC---DIPVVVEQLNKKFP 176
           L++                  D++D  +D TPVRWIRINPL+C   D+  V+++L KKFP
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKFP 180

Query: 177 HRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPG 236
            RV HW  ++ G++YYDE+VPNLFG+HP +KITSH+LY+QGK+IIQDR+SC PAHILNPG
Sbjct: 181 QRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNPG 240

Query: 237 KEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCG 296
           K DVV+DACAAPGNKTTH+AAHI+     +     +I+AFEK+PARA +L+KMTS AGCG
Sbjct: 241 KNDVVIDACAAPGNKTTHVAAHILPEY--TREQTPKIYAFEKDPARANILKKMTSVAGCG 298

Query: 297 SLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN-------------D 343
             V+IHVGDFT+LAVP  F+DVT  +VDPSCSGSGIFGRKS++S N             D
Sbjct: 299 QTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPD 358

Query: 344 SQDQKLQD----RLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDS 399
            +++ + D    RLSKL+SFQFQVVKHAMSMPNA+KIVYSTCS+HAEENERVVIDLLLD 
Sbjct: 359 EEEKMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLLDR 418

Query: 400 KVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFF 459
            +KEWGW+++ R EV+P WPRRG  +EFE+VFRDD  KC  LA+ CIRALP+EDGGIGFF
Sbjct: 419 NIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQEDGGIGFF 478

Query: 460 AVCFQR 465
           AVCF+R
Sbjct: 479 AVCFKR 484

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/494 (60%), Positives = 375/494 (75%), Gaps = 31/494 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE+LE E+ KGK+SGS+QS VLK+C  YKV++NPKHIYAV+ASCWKY+ Y
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE IM KSGIL  IP+K GKP F RLTI+LLCHDLL SK KRIQMGKHP+K+YVLKYKT 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHAXXXXXXXXXXXXX-XXXXXDQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           L +                    QDD +D TPVRW RINP++      +  ++E+L KKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
           P RVDHW ++  G+IY+DE++PNLFG+H  +KITSH+LYKQGK+IIQDRASC PAH+LNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           GK+D+V+D+CAAPGNKTTH AA+I+   G S   + QIHAFEK+P RAKVLQKM   AGC
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYIL--GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSND------------ 343
              ++++VGDFT++A P++F++VT  +VDPSCSGSGIFGRK +++ N             
Sbjct: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358

Query: 344 ------------SQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV 391
                       S+   L+ RLSKL+SFQFQVVKHAM+ P ARK+VYSTCS+HAEENERV
Sbjct: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418

Query: 392 VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPR 451
           VIDLLLD  +K+ GW+++ R +V+PTWPRRG  +EF+EVFRDD+ KC+ +A  CIRALP+
Sbjct: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPK 478

Query: 452 EDGGIGFFAVCFQR 465
           EDGGIGFFAVCF+R
Sbjct: 479 EDGGIGFFAVCFER 492

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 368/493 (74%), Gaps = 31/493 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGK-LSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59
           M+FYRD+TW+LE++E E  K K ++GSLQ+ VL +C +YK+K NP+HIYA+V+S W+YR 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119
           YL++I+ KSGIL+ +P+KKGKP F++ TI LL HDLL+SK KRIQMGKHPIK ++LK++T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPL--KCDIPVVVEQLNKKFPH 177
           RL A                    DDG+D TPVRWIRINP+  K     V+ +LNKKFP 
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 178 RVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGK 237
           RV+ W Q+ PGSIYYDEY+PNLFGIHP +KITSH+ YK+GK+IIQDRASC PAHILNP  
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 238 EDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGS 297
            DVV+DACAAPGNKTTH+AAHI     D+     +IHAFEK+P RAK LQ M + AGC  
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDV-DTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299

Query: 298 LVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLE--------SSNDSQDQK- 348
            VKIHVGDFT+L  P+ F++VT  +VDPSCSGSGIFGRK+++        SSN  +DQ  
Sbjct: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359

Query: 349 ----------------LQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVV 392
                           L++RL+KLSSFQ+Q+VKHAMS P+A+KI YSTCS+HAEENERVV
Sbjct: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419

Query: 393 IDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPRE 452
           IDLLLDSKVKEWGW++  R+ V+PTWPRRG   EFEEVF   K + + LAE CIRALP+E
Sbjct: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF--PKEEAKELAEGCIRALPKE 477

Query: 453 DGGIGFFAVCFQR 465
           DGGIGFFAVCF+R
Sbjct: 478 DGGIGFFAVCFER 490

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/494 (60%), Positives = 375/494 (75%), Gaps = 31/494 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE++E E+ KG++SGSLQ+ V ++C +YK+K NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M KSGIL  IP++KGKP +SRLT+ML+CHDLL SK KRIQMGK PIK YVLK+K+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHAXXXXXXXXXXXXXXXX-XXDQDDGDDATPVRWIRINPLKCDIPVVVEQLNKKFPHRV 179
           LH+                   + D  +D TPVRWIRINPL+CD+     ++ KKFP RV
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCDVEATKLEIQKKFPTRV 180

Query: 180 DHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKED 239
           ++W  + PGSIYYDEY+PNLFGIHP +KITSH+LYKQGK+IIQDRASC PAHIL+P + D
Sbjct: 181 ENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPDEND 240

Query: 240 VVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLV 299
           VV+D CAAPGNKTTH A+++I     S   + QI+AFEK P RAK+L KM   AGC   +
Sbjct: 241 VVIDGCAAPGNKTTHTASYMIKEP--SKDPKIQIYAFEKNPERAKILDKMIKVAGCSKNI 298

Query: 300 KIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQK----------- 348
           KI+VGDFT++A+P++++DVT  +VDPSCSGSGIFGRK ++S N  +  K           
Sbjct: 299 KINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDEE 358

Query: 349 ---------------LQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVI 393
                          L+ RLSKLSSFQFQVVKHAMS PNA+KIVYSTCS+HAEENERVVI
Sbjct: 359 EEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVVI 418

Query: 394 DLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRALPR 451
           DL+LDSKVK+WGW+++PRS+V+PTWPRRG  EEFEEVFR+D    KC+ LA  CIRALPR
Sbjct: 419 DLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALPR 478

Query: 452 EDGGIGFFAVCFQR 465
            DGGIGFFAVCF+R
Sbjct: 479 SDGGIGFFAVCFER 492

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/497 (60%), Positives = 373/497 (75%), Gaps = 34/497 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           MDFYRDSTW+LEYLE E  K K+SGSLQ  VLK+C KYKVK+NP+H+YA V+SCWK + Y
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M +SGIL  IP KKGKP F RLT++LLCHDLL+SK KRIQMGKHPIK Y+LKYKTR
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXX-XDQDDGDDATPVRWIRINPLKCD----IPVVVEQLNKKF 175
           LH+                   D++  DD TPVRWIRINP++      +  ++ +LNKKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
           P RV+HW  + PG+IY+D+Y+PNLFG+H  +KITSH+LYK GKVIIQDRASC PAHILNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           GK D+V+DACAAPGNKTTH A++I+   G       QI+AFEK+P RAK+LQ M   AGC
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYIL--GGPKKDQTTQIYAFEKDPERAKILQHMIKVAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342
            + ++++VGDFT++A P++F +VT  +VDPSCSGSGIFGRK ++S N             
Sbjct: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358

Query: 343 -------DSQDQK-------LQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEEN 388
                  D Q+++       L+ RLSKL+SFQFQVVKHAMS P A+KIVYSTCS+HAEEN
Sbjct: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418

Query: 389 ERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRA 448
           E VVIDLLLD KV+EWGW+++PRSEV+PTWPRRG   EF +VFRD+  KCQ LA+ CIR 
Sbjct: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRV 478

Query: 449 LPREDGGIGFFAVCFQR 465
           LP+EDGGIGFFAVCF+R
Sbjct: 479 LPKEDGGIGFFAVCFER 495

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 372/480 (77%), Gaps = 19/480 (3%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+ YRD+TW+ EY+E EE KGK++GSLQ+ VL +C +YK+K NPKH+YA+V SCWKY+ +
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE+I+ KSGILK IP+KKG+PAFS  TI+LL HDLL+SK KRIQMGKHPIK++VLK+K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPHR 178
           L A                   +DD +D TPVRWIRINP++C+  V  V  +L KKFP +
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV-KDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTK 179

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           V +W ++ PG+IY+DE++PNLFG+HP++KITSH+LYK+GK+IIQDRASC PAHILNP  E
Sbjct: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           DV++D+C+APGNKTTH+AAH+     +    Q QIHAFEK+P RAK LQKM   AGC   
Sbjct: 240 DVIIDSCSAPGNKTTHVAAHMFDP--EFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ------------- 345
           +++HVGDFT+LA PD+F  VT  +VDPSCSGSGIFGRK ++ +N+               
Sbjct: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNEVLPEEEQEKEEM 357

Query: 346 DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVKEWG 405
           DQ L+ RL+KLSSFQFQ++KHAMS PNA+K+VYSTCS+HAEENERVVIDLLLD KV++WG
Sbjct: 358 DQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDKVQQWG 417

Query: 406 WQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           W++  R+ V+PTW RRG  EEF++V++ DK + Q LA+ CIRALP+EDGGIGFFAVCF+R
Sbjct: 418 WRVRKRAGVIPTWSRRGFVEEFQQVYQ-DKQQAQELADGCIRALPKEDGGIGFFAVCFER 476

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 372/489 (76%), Gaps = 27/489 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LEY+E ++ KG++SGSLQS VLK+C KYK+K NPKHIYAV+ SCWKY+ +
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M KSGILK IP+KKGKP ++RLT++LL HDLL+SKQKRIQMGKHPIK +VL+YK+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQ-DDGDDATPVRWIRINPLKC-DIPVVVEQLNKKFPHR 178
           LH+                  D  D  +D TPVRW RINPL+C D   V+++L KKFP R
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDASAVMKELEKKFPQR 180

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           V+ W+ + PGSIY+DE++P LFGIHP +KITSH+LYKQG++IIQDRASC PAHILNP  E
Sbjct: 181 VESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPTLE 240

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           D ++DAC+APGNKTTH+A+++    G+      +I AFEK+P RAKVLQKM   AGC   
Sbjct: 241 DKIIDACSAPGNKTTHVASYMF---GNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQ 297

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN--------------DS 344
           + ++VGDFT+LA P +F DVT  +VDPSCSGSGIFGRK ++S N              D 
Sbjct: 298 ISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDE 357

Query: 345 QDQ-------KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLL 397
           Q++        LQ+RLSKLSSFQFQVVKHAMS P A++IVYSTCS+HAEENERV +DLLL
Sbjct: 358 QEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLL 417

Query: 398 DSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDGGI 456
           D KVK+WGW+++ R  V+P WPRRG   EF+E+FRD    +CQ +A+ CIRALPREDGGI
Sbjct: 418 DEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGI 477

Query: 457 GFFAVCFQR 465
           GFFA+CF+R
Sbjct: 478 GFFAICFER 486

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/487 (57%), Positives = 362/487 (74%), Gaps = 27/487 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LEY+E+ EK G+++GSLQ+ VL +C KY++K NPKHIYA V SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           L++++ +SGILK IP+KKGK  F+  TI LL HDLL SK KRIQMGKHP+K++VLKYK R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPHR 178
           L +                   +DD +D TPVRW R+NP++C      ++++L+KKFP R
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL-KDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPTR 225

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           V+ W  ++PG IY+DEY+P LFG+HP++KITSH+LYK GKVIIQDRASC PAHILN   E
Sbjct: 226 VNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASSE 285

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           D+++DACAAPGNKTTH+AAHI     D      +IHAFEK+P RAK L+ M + AGC   
Sbjct: 286 DLIIDACAAPGNKTTHVAAHIFQ---DQAVESVRIHAFEKDPERAKTLRTMINTAGCTKG 342

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ------------- 345
           +++HVGDFT+LA P +F DVT  ++DPSCSGSGIFGRK ++  N S+             
Sbjct: 343 IEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKE 402

Query: 346 -------DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLD 398
                  D+ L++RL KL+SFQF++VKHAMS P+A+K+VYSTCSVHAEENER+V+DLLLD
Sbjct: 403 EEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLLD 462

Query: 399 SKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGF 458
           SKVKEWGW++  R+ V+PTW RRG  +EFEEVFRD+    + LAE+CIR  P+EDGGIGF
Sbjct: 463 SKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT-AKELAEACIRVAPKEDGGIGF 521

Query: 459 FAVCFQR 465
           FAVCF+R
Sbjct: 522 FAVCFER 528

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/488 (57%), Positives = 363/488 (74%), Gaps = 29/488 (5%)

Query: 1   MDFYRDSTWILEYLEAE-EKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59
           M+FYRDS+W+LEY+E E  K  ++SGSLQ+ VL++C +YK+K NPKHIYA+V+SCWKY+M
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119
           YLE+I+  SG+L  +P KKG+P FS+ TIMLL HDLL+SK KRI MGKHPIK +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPH 177
           RL                    + +D D  +PVRWIRINP +C   V  V+++L KKFP 
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDAD-MSPVRWIRINPFRCQGKVDDVLKELRKKFPK 192

Query: 178 RVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGK 237
           +VD W Q+ PGSIY DEY+PNL+G+HPS+KITSH+LYK+GK+IIQDRASC PA+ILNP  
Sbjct: 193 QVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTP 252

Query: 238 EDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGS 297
            DVV+DAC+APGNKTTH+AAHI     D N    +I+AFE++  RA++L+KM + AGC S
Sbjct: 253 HDVVIDACSAPGNKTTHIAAHIFP---DGNASDVKIYAFERDAKRAEILEKMVTSAGCES 309

Query: 298 LVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDS------------- 344
            ++I VGDFT+LA P  F+DVT  ++DPSCSGSGIFGR+S++ +N S             
Sbjct: 310 CIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEE 369

Query: 345 -------QDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLL 397
                  Q++  + RL+KLSSFQFQ+VKHAMS PNA+K+VYSTCS+HAEENERVVIDLLL
Sbjct: 370 QDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 429

Query: 398 DSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIG 457
           D  +K++GW+++ R  V+P W RRGI  EFEEVF  +  + Q LA+ CIRALP+EDGGIG
Sbjct: 430 DQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE--QAQELADGCIRALPKEDGGIG 487

Query: 458 FFAVCFQR 465
           FFAVCF+R
Sbjct: 488 FFAVCFER 495

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/496 (59%), Positives = 365/496 (73%), Gaps = 31/496 (6%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           MDFYRD+TW+LE +E ++ KGKLSGSLQ+ VL +C ++KVK NPKHIYAVV+SCW+Y+ +
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M KS IL  +PQKKG P F RLT++LLCHDLL+SK KRIQMGKHPIK +VLKYKTR
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDD-GDDATPVRWIRINPLKC--DIPV--VVEQLNKKF 175
           L+A                  D DD  +D TPVRW R+NPL+C  + PV  VV +L KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
             +VD W  + PGSIYYDEY+PNLF +HP +KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
             +D+V+DACAAPGNKTTHLAAH+          + QI+AFEK+P RA+VL KM   AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQ---------- 345
              +++ VGDFT+LA P    +V   +VDPSCSGSGIFGRK ++S N  +          
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 346 --------------DQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV 391
                         D  L+ RLSKLSSFQFQ+VK+A+S P A K+VYSTCS+HAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 392 VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD--KPKCQLLAESCIRAL 449
           VIDLLLD KVKE GW+++PRS+V+PTW RRG+ +EF++VFR+D     CQ +A+ CIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 450 PREDGGIGFFAVCFQR 465
           PREDGGIGFFAVCF+R
Sbjct: 481 PREDGGIGFFAVCFER 496

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/491 (60%), Positives = 371/491 (75%), Gaps = 28/491 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M K+ IL+ IP+KKGKP FSRLT++LLCHDLL+SKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHAXXXX-XXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           LH+                    +D  +D  PVRWIRINPLKC    +   V+ +L KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
             +VD W +L PGSIYYDE++PNLFGIHPS+KIT+H+LYK GK+IIQDRASC PAHILNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           G  D+V+D+C+APGNKTTH A++I       N    +I+AFEK+P RAKVLQKM   AGC
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNN--TRIYAFEKDPERAKVLQKMIKIAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342
              + ++VGDFT+LA P++++DVT  +VDPSCSGSGIFGRK  +S N             
Sbjct: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGI 358

Query: 343 --DSQD-----QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
             D Q+     ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 359 VPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454
           LLD  V+EWGW+++P+ EV+P+WPRRG  EEFEEVFRD      Q LAE CIRALP+ DG
Sbjct: 419 LLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDG 478

Query: 455 GIGFFAVCFQR 465
           GIGFFAVCF+R
Sbjct: 479 GIGFFAVCFER 489

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/491 (60%), Positives = 373/491 (75%), Gaps = 26/491 (5%)

Query: 1   MDFYRDSTWILEYLEAE-EKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59
           M+FYRDSTW+LEYLE + EK G++SGSLQ+ VL+ C +Y++K NPKHIYA+V+SCWKY+ 
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119
           YL++IM KSG+L  IP+KKGKPAFS+LT++LLCHDLL+SK KRIQMGKHPIK+YVLKYK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHAXXXXXXXXXXXX-XXXXXXDQDDGDDATPVRWIRINPLKC---DIPVVVEQLNKKF 175
            L+A                     D  DD TPVRWIRINPL+    D   V+ +L KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
           P RV+ W  + PGSIYYDE++PNL+GIH S+KITSH+LYKQGK+IIQDRASC PAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
             +DVV+DAC+APGNKTTH+AAHI     +      QI+AFEK+P RA++LQKM   AGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSL----------------- 338
              + ++VGDFT++A P ++ DVT  ++DPSCSGSGIFGRKS+                 
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360

Query: 339 ---ESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
              E + DS++++L++RLSKL+SFQFQ+V+HAMS PNA+KIVYSTCS+HAEENERVVIDL
Sbjct: 361 NDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVIDL 420

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRD-DKPKCQLLAESCIRALPREDG 454
           LLD KV+ WGW+++ +  V+PTW RRG  EEF+EVF D  + +CQ LA+ C+RALP+EDG
Sbjct: 421 LLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKEDG 480

Query: 455 GIGFFAVCFQR 465
           GIGFFAVCF R
Sbjct: 481 GIGFFAVCFVR 491

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/491 (60%), Positives = 370/491 (75%), Gaps = 28/491 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VL++C KYK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M K+ IL+ IP+KKGKP FSRLT++LLCHDLL+SKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHAXXXXXXXXXXXX-XXXXXXDQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           LH+                    +D  +D  PVRWIRINPLKC    D   V+ +L KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
             +V+ W  L PGSIYYDEY+PNLFGIHP++KIT+H+LYK GK+IIQDRASC PAHIL+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           G +D+V+DAC+APGNKTTH A++I S  G       +I+AFEK+P RAK+LQKM   AGC
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICS--GPPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN----DSQD----- 346
            S + + VGDFT+LA PD+ +  T  +VDPSCSGSGIFGRK  +S N    D +D     
Sbjct: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDV 358

Query: 347 -----------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
                      ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 359 IPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDL 418

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454
           LLD  V+EWGW+++PR+EV+P+WPRRG  EEF EVFRD      + LAE CIRALP+EDG
Sbjct: 419 LLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKEDG 478

Query: 455 GIGFFAVCFQR 465
           GIGFFAVCF+R
Sbjct: 479 GIGFFAVCFER 489

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/510 (56%), Positives = 372/510 (72%), Gaps = 49/510 (9%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE+LEA++KKG++SGSL S V+K+C ++K+++NPKH+YAVV S WK++ +
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           +ERIM KSGIL  IP+KKGKP + RLT++LL HDL+ SK +RIQMGKHPIK +VL YKTR
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXD-----QDDGDDATPVRWIRINPLKCDIPV------VVE 169
           LH+                  +      D  DD TPVRWIRINP++  IP       ++ 
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIR--IPKQKSSDDIIL 178

Query: 170 QLNKKFPHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLP 229
           +L KKF  +VDHW ++ PG IYYDEY+PNLFGI P++KITSH+LYK GK+IIQDRASC P
Sbjct: 179 ELRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFP 238

Query: 230 AHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDS--NGGQAQIHAFEKEPARAKVLQ 287
           AHILN   +D ++DACAAPGNKTTH+A++I+S   D+  N  + ++ AFEK+P R+K+L 
Sbjct: 239 AHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILD 298

Query: 288 KMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN----- 342
           KM   AGC  LV+I+ GDFT++A P+++ +VT  +VDPSCSGSGIFGRK +++ N     
Sbjct: 299 KMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKL 358

Query: 343 ----------DSQD--------------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVY 378
                     D QD                L+ RLSKLSSFQFQVVKHAMS P+A+KIVY
Sbjct: 359 TEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418

Query: 379 STCSVHAEENERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD---K 435
           STCS+HAEENERVVIDLLLD KVKEWGW+++PRS  +PTW RRG+  EFE+VF++D    
Sbjct: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMD 478

Query: 436 PKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           PK   LAE CIR LP+EDGGIGFFAVCF+R
Sbjct: 479 PK--QLAEGCIRTLPKEDGGIGFFAVCFER 506

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/491 (60%), Positives = 372/491 (75%), Gaps = 28/491 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKHIYAV+ SCWKY+ Y
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M K+ IL+ IP+KKGKP F+RLT++LLCHDLL+SKQKRIQMGKHPIK+YVLK+K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHAXXXXXXXXXXXX-XXXXXXDQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           LH+                    +D  +D  PVRWIRINPLKC    +   V+ +L KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
             +VD+W +L PGSIY+DEY+PNLFGIHP++KIT+H+LYK GK+IIQDRASC PAHIL+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           G  D+V+DAC+APGNKTTH A++I S        + QI+AFEK+P RAK+LQKM   AGC
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDK--KIQIYAFEKDPERAKILQKMIKVAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342
            + + ++VGDFT+LA P++ + VT  +VDPSCSGSGIFGRK  +S N             
Sbjct: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDA 358

Query: 343 --DSQD-----QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
             D Q+     ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 359 VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDL 418

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454
           LLD  V+EWGW+++ R+EVVP+WPRRG  EEFEEVFRD      Q LAE CIRALP+EDG
Sbjct: 419 LLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDG 478

Query: 455 GIGFFAVCFQR 465
           GIGFFAVCF R
Sbjct: 479 GIGFFAVCFVR 489

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/483 (56%), Positives = 354/483 (73%), Gaps = 23/483 (4%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LEY+E  E  G+++GSLQ+ VL +C KY +K NPKH+YA V SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE+++ KS ILK +P+KKGK  F+  TI LL HDLL +K KRIQMGKHP+K++VLK+KTR
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKC--DIPVVVEQLNKKFPHR 178
           L++                   +DD +D TPVRW RINP++C      V+ +L KKFP R
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL-KDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTR 179

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           VD W  + PGSIY+DEY+PNLFG+HP +KITSH+LYK GK+IIQDRASC PAHILNP   
Sbjct: 180 VDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPS 239

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           DV++DACAAPGNKTTH+AAH+     +    +  IHAFEK+P RAK L+ M   AGC   
Sbjct: 240 DVIIDACAAPGNKTTHVAAHMFL---NDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKG 296

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQ----------- 347
           + IHVGDFT+LA P  F +V+  +VDPSCSGSGIFGR+ ++  N S+++           
Sbjct: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPTQEEERQ 356

Query: 348 -----KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLLDSKVK 402
                 +++RL+KL+SFQF++VK+A+S P+A+K+VYSTCS+HAEENER+VIDLLLDSKVK
Sbjct: 357 EIEGKDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKVK 416

Query: 403 EWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVC 462
           EWGW++  R+  +PTWPRRG   EFE+VFR+     + LAE+CIR  P+EDGGIGFFAVC
Sbjct: 417 EWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGD-TAKELAEACIRVAPKEDGGIGFFAVC 475

Query: 463 FQR 465
           F+R
Sbjct: 476 FER 478

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 366/490 (74%), Gaps = 32/490 (6%)

Query: 1   MDFYRDSTWILEYLEAE-EKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59
           M+FYRD++W+LEY+E E  +K K++GSL S VL++  KYK+K++ +H+YA+VAS WKY+ 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119
           YL+RI+ KSG+LK +P+KKG+PAF R T+ L+ HDLL+SK+KRI MGKHP+K +VLK++T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHAXXXXXXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKC--DIPVVVEQLNKKFPH 177
           RL                     QD+ +DATPVRWIR+NP +       V+++L KKFP 
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLV-QDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPR 179

Query: 178 RVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGK 237
           RV  W +L+PGSIY DEYV  L+G+HP++KITSH+LYK+GK+IIQDRASC PA IL PG+
Sbjct: 180 RVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGR 239

Query: 238 EDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGS 297
            DV++DACAAPGNKTTH+AAHI    G      AQIHAFE++P RAK L+KM + AGC +
Sbjct: 240 SDVIIDACAAPGNKTTHVAAHIFPEGG---ADHAQIHAFERDPQRAKTLRKMIATAGCDN 296

Query: 298 LVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDSQDQ---------- 347
            +++HVGDFTR A P+ F++VT  +VDPSCSGSGIFGR+ ++++ ++Q            
Sbjct: 297 AIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVP 356

Query: 348 ------------KLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
                       +L++RL+KLSSFQFQ+VKHAMS P+A+K++YSTCSVHAEENERVVIDL
Sbjct: 357 EEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDL 416

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGG 455
           LLDSKV++ GW+++ RS+V+P WPRRG   EFEEVF D   + + LA  CIR LP+EDGG
Sbjct: 417 LLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD---QAEELAGGCIRVLPKEDGG 473

Query: 456 IGFFAVCFQR 465
           IGFFAVCF+R
Sbjct: 474 IGFFAVCFER 483

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/491 (60%), Positives = 370/491 (75%), Gaps = 28/491 (5%)

Query: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60
           M+FYRD+TW+LE +E E  K ++SGS+Q+ VLK+C +YK+K+NPKH+YAV+ SCWKY+ Y
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120
           LE++M K+ IL+ IP+KKGKP FSRLT++LLCHDLLISKQKRIQMGKHPIKDYVLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHAXXXX-XXXXXXXXXXXXXXDQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175
           LH+                    +D  +D  PVRWIRINPLKC        V+ +L KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235
             +V+ W +L P SIYYDEY+PNLFGIHPS+KIT+H+LYK GK+IIQDRASC PAHILNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295
           G  D+V+DAC+APGNKTTH A++I S        + +I+AFEK+P RAK+LQKM   AGC
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEP--PKDSRTRIYAFEKDPERAKILQKMIKIAGC 298

Query: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN------------- 342
            S + + VGDFT+LA P++F+D T  +VDPSCSGSGIFGRK  +S N             
Sbjct: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDI 358

Query: 343 --DSQD-----QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDL 395
             D Q+     ++LQ RL+KLSSFQFQ+VKHAMS P A+KIVYSTCS+HAEENERVVIDL
Sbjct: 359 VPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDL 418

Query: 396 LLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKP-KCQLLAESCIRALPREDG 454
           LLD  V+EWGW+++PRSEV+P WPRRG  EEFEEVFR+      Q LAE CIRALP++DG
Sbjct: 419 LLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDG 478

Query: 455 GIGFFAVCFQR 465
           GIGFFAVCF+R
Sbjct: 479 GIGFFAVCFER 489

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 91/185 (49%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G+ I+Q  +S LP   L+P + + V+D  AAPG KTT+++A +       N G   +
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM------KNTG--CV 388

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 389 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 445

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++SS   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 446 GKDQSVKSSRTEKD------FIQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEE 499

Query: 388 NERVV 392
           +E VV
Sbjct: 500 DEAVV 504

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 113/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KNTG--CV 367

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 368 FANDANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 424

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 425 GKDQSVKVSRTEKD------FMQIPHLQKQLILSAIDSVDAHSKTGGVIVYSTCSVAVEE 478

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           NE VV           +  +  P  ++V T     I +E    +R  K  P  +L     
Sbjct: 479 NEAVV----------NYALRKRPNVKLVETG--LAIGKEGFTSYRGKKFHPSVKLTR--- 523

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GFF   FQ+
Sbjct: 524 -RYYPHTYNVDGFFVAKFQK 542

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 86/184 (46%), Gaps = 21/184 (11%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 360

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 361 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 417

Query: 334 GRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEEN 388
           G+      N ++   +Q     +   Q Q++  A+   ++       IVYSTCSV  EEN
Sbjct: 418 GKDQSVKVNRTEKDFMQ-----IPHLQKQLILSAIDSVDSNSKHGGVIVYSTCSVAVEEN 472

Query: 389 ERVV 392
           E VV
Sbjct: 473 EAVV 476

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 114/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + V+D  +APG KTT+++A +       N G   I
Sbjct: 336 YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM------KNTG--CI 387

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 388 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 444

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAM-----SMPNARKIVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+     +  N   +VYSTCSV  EE
Sbjct: 445 GKDQSVKVSRTEKD------FIQIPHLQKQLILSAIDSLDSNSKNGGVLVYSTCSVAVEE 498

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E VV          ++  +  P  ++V T     I +E    +R  K  P  +L     
Sbjct: 499 DEAVV----------DYALRKRPNVKLVETG--LAIGKEGFTSYRGKKFHPSVKL----T 542

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GFF   FQ+
Sbjct: 543 RRYYPHTYNVDGFFVAKFQK 562

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 124/285 (43%), Gaps = 53/285 (18%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL--AAHIISAAGDSNGGQAQIH 274
           G +  Q+  S LP  +L+      V+D CAAPG+KT  L  + HI     DS+     + 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHI-----DSDEPSGFVI 194

Query: 275 AFEKEPARAKVL-QKMTSQAGCGSLVKIHVGDF-------TRLAVPDQFEDVTAALVDPS 326
           A + +  R+ +L  ++   +    L+  H   F       T+ A   +       L D  
Sbjct: 195 ANDADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVP 254

Query: 327 CSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHA 385
           CSG G   RK++   N  ++   Q+ L  L + QF ++   ++ +    K+VYSTCS++ 
Sbjct: 255 CSGDGTM-RKNV---NVWKNWNTQNALG-LHNVQFNILDRGLTLLKETGKLVYSTCSLNP 309

Query: 386 EENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWPRRGIAEEFEEVFR-- 432
            ENE VV  +L     ++WG ++             RS+ + TWP   I  + EEV R  
Sbjct: 310 IENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLIRSKGLTTWPV--INRDMEEVPRNR 362

Query: 433 -DDKPK-----------CQLLAESCIRALPREDGGIGFFAVCFQR 465
            DDK              +   + C+R  P +    GFF   F++
Sbjct: 363 SDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 113/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G+ I+Q  +S LP   L+P   + V+D  AAPG KTT+++A +       N G   +
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALM------KNTG--CV 368

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 369 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 425

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 426 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDANSKTGGFIVYSTCSVAVEE 479

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E VV          ++  +  P   +V T     I +E    FR  K  P  +L     
Sbjct: 480 DEAVV----------DYALRKRPNVRLVDTG--LAIGKEGFTSFRGKKFHPSVKL----T 523

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GF+   FQ+
Sbjct: 524 RRYYPHTYNVDGFYVAKFQK 543

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 89/185 (48%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMM------KNTG--CV 370

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 371 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 427

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   ++       IVYSTCSV  +E
Sbjct: 428 GKDQSVKVSRTEKD------FMQIPHLQKQLLLSAIDSVDSNSKTGGVIVYSTCSVAVDE 481

Query: 388 NERVV 392
           NE VV
Sbjct: 482 NEAVV 486

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 114/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + V+D  +APG KTT+++A +       N G   +
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM------KNTG--CV 376

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +    R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 377 FANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSGTGVI 433

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 434 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVAVEE 487

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E VV          ++  +  P  ++V T  +  I +E    FR  K  P  +L     
Sbjct: 488 DEAVV----------DYALRKRPNVKLVDTGLQ--IGKEGFVSFRGKKFHPSLKLTR--- 532

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GFF   FQ+
Sbjct: 533 -RYYPHTYNVDGFFVAKFQK 551

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 88/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KNTG--CV 362

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 363 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 419

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
            + +S++ S   +D        ++   Q Q++  A+   ++       IVYSTCSV  EE
Sbjct: 420 AKDQSVKVSRTEKD------FMQIPHLQKQLILSAIDSVDSNSKTGGIIVYSTCSVAVEE 473

Query: 388 NERVV 392
           NE VV
Sbjct: 474 NEAVV 478

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 88/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 384

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 385 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 441

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
            + +S++ S   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 442 AKDQSVKVSRTDKD------FMQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEE 495

Query: 388 NERVV 392
           NE VV
Sbjct: 496 NEAVV 500

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 88/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 382

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 383 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 439

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
            + +S++ S   +D        ++   Q Q++  A+   +A       IVYSTCSV  EE
Sbjct: 440 AKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEE 493

Query: 388 NERVV 392
           NE V+
Sbjct: 494 NEAVI 498

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 112/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 245

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +    R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 246 FANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 302

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 303 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEE 356

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E VV          ++  +  P  ++V T     I +E    FR  K  P  +L     
Sbjct: 357 DEAVV----------DYALRKRPNVKLVDTG--LAIGKEGFTSFRGKKFHPSIKLTR--- 401

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GF+   FQ+
Sbjct: 402 -RYYPHTYNVDGFYVAKFQK 420

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 113/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 375

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   +R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 376 FANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 432

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 433 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEE 486

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E VV          ++  +  P  ++V T     I +E    FR  K  P  +L     
Sbjct: 487 DEAVV----------DYALRKRPNVKLVETG--LAIGKEGFTSFRGKKFHPSVKL----A 530

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GFF   FQ+
Sbjct: 531 RRYYPHTYNVDGFFVAKFQK 550

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 90/185 (48%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALM------KNTG--CV 374

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   +R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 375 FANDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVI 431

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   ++       IVYSTCSV  EE
Sbjct: 432 GKDQSVKVSRTEKD------FMQIPHLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEE 485

Query: 388 NERVV 392
           +E+VV
Sbjct: 486 DEQVV 490

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 126/295 (42%), Gaps = 53/295 (17%)

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           + +W ++  G   +D  VP   G  P         Y  G+ I+Q  +S LP   L+P + 
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           + ++D  +APG KTT+++A +       N G   + A +    R K L     + GC + 
Sbjct: 342 ERILDMASAPGGKTTYISALM------KNTG--CVFANDANKNRTKSLIANIHRLGCTNT 393

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGR-KSLESSNDSQDQKLQDRLSKLS 357
           +   V ++     P         L+D  CSG+G+ G+ +S++ S   +D        ++ 
Sbjct: 394 I---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------FIQIP 444

Query: 358 SFQFQVVKHAMSMPNARK-----IVYSTCSVHAEENERVVIDLLLDSKVKEWGWQLSPRS 412
             Q Q++  A+   +A       IVYSTCSV  EE+E VV          ++  +  P  
Sbjct: 445 HLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDEAVV----------DYALRKRPNV 494

Query: 413 EVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           ++V T     I +E    FR  K  P  +L      R  P      GF+   FQ+
Sbjct: 495 KLVET--NLAIGKEGFTSFRGKKFHPSLKLTR----RYYPHTYNVDGFYVAKFQK 543

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 127/295 (43%), Gaps = 53/295 (17%)

Query: 179 VDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGKE 238
           + +W ++  G   +D  VP   G  P         Y  G  I+Q  +S LP   L+P + 
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 239 DVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSL 298
           + ++D  AAPG KTT+++A +       N G   + A +    R K L     + GC + 
Sbjct: 359 ERILDMAAAPGGKTTYISAMM------KNTG--CVFANDANKNRTKSLIANIHRLGCTNT 410

Query: 299 VKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGR-KSLESSNDSQDQKLQDRLSKLS 357
           +   V ++     P         L+D  CSG+G+ G+ +S++ S   +D        ++ 
Sbjct: 411 I---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKD------FIQIP 461

Query: 358 SFQFQVVKHAMSM--PNARK---IVYSTCSVHAEENERVVIDLLLDSKVKEWGWQLSPRS 412
             Q Q++  A+     N++K   IVYSTCSV  EE+E VV          ++  +  P  
Sbjct: 462 HLQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDEAVV----------DYALRKRPNV 511

Query: 413 EVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           ++V T     I +E    FR  K  P  ++      R  P      GFF   FQ+
Sbjct: 512 KLVETGLL--IGKEGFTSFRGKKFHPSVKM----TRRYYPHTYNVDGFFVAKFQK 560

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 121/280 (43%), Gaps = 45/280 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L    +  V+D CAAPG+KT  L   I +   D++     + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQL---IEALHKDTDEPTGFVVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFE------DVTAALVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+ + D  E           L D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPCS 261

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSM--PNARKIVYSTCSVHAE 386
           G G   RK++   N  +D   Q  L  L + Q+ ++   + +  PN R +VYSTCS++  
Sbjct: 262 GDGTM-RKNV---NVWKDWNAQGALG-LHTVQWNILNRGLHLLKPNGR-LVYSTCSLNPI 315

Query: 387 ENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP--RRGIAEE------- 426
           ENE VV   L     ++WG ++             RS+ +  WP   R +  +       
Sbjct: 316 ENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQWPVLNRDLETKNKNDEGV 370

Query: 427 FEEVFRDDKPKCQLLA-ESCIRALPREDGGIGFFAVCFQR 465
            E  F   + +  L   ++CIR  P +    GFF   F++
Sbjct: 371 LESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 113/260 (43%), Gaps = 41/260 (15%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 373

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   +R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 374 FANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 430

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 431 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEE 484

Query: 388 NERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDK--PKCQLLAESC 445
           +E V+          ++  +  P  ++V T     I +E    +R  K  P  +L     
Sbjct: 485 DEAVI----------DYALRKRPNVKLVDTG--LAIGKEAFTSYRGKKFHPSVKL----A 528

Query: 446 IRALPREDGGIGFFAVCFQR 465
            R  P      GFF   FQ+
Sbjct: 529 RRYYPHTYNVDGFFVAKFQK 548

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 89/185 (48%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KNTG--CV 370

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   AR K L     + GC + +   V ++     P         L+D  C+G+G+ 
Sbjct: 371 FANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGVI 427

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   ++       IVYSTCSV  EE
Sbjct: 428 GKDQSVKVSRTEKD------FIQVPHLQKQLLLSAIDSVDSNSKTGGIIVYSTCSVAVEE 481

Query: 388 NERVV 392
           +E VV
Sbjct: 482 DEMVV 486

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 119/282 (42%), Gaps = 48/282 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL-----------AAHIISAAGD 265
           G +  Q+  S +P  +L       V+D CAAPG+KT  +              +++   D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 266 SNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDP 325
           S      +H  ++    +  L  +   A     +K    D +  A   +F+ V   L D 
Sbjct: 203 SKRSHMLVHQLKR--LNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDV 257

Query: 326 SCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVH 384
            CSG G   RK++   N  +D   Q  L  L + QF ++   +  + N  ++VYSTCS++
Sbjct: 258 PCSGDGTM-RKNV---NVWRDWTPQGGLG-LHTVQFNILNRGLHLLKNKGRLVYSTCSMN 312

Query: 385 AEENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP--RRGIA--EEFEE 429
             ENE VV + L     ++WG ++             RS+ V  WP   R +   E+ +E
Sbjct: 313 PIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLVRSKGVSQWPVIDRNMTPREKGDE 367

Query: 430 VFRD------DKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
              D      ++   +   E+CIR  P +    GFF   F++
Sbjct: 368 GTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 120/281 (42%), Gaps = 47/281 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL--AAHI-------ISAAGDSN 267
           G +  Q+  S +P  +L       V+D CAAPG+KT  L  A H+          A D++
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 268 GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSC 327
             ++ +   + +   +  L  +   A     +K+H  D T+     +F+ V   L D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLH-EDATQKKDVLRFDRV---LCDVPC 260

Query: 328 SGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSM--PNARKIVYSTCSVHA 385
           SG G   RK++   N  +D   Q  L  L + Q  ++   + +  P  R +VYSTCS++ 
Sbjct: 261 SGDGTM-RKNV---NVWRDWNTQSGLG-LHTVQLNILNRGLHLLKPKGR-LVYSTCSMNP 314

Query: 386 EENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP---------RRGIAE 425
            ENE VV      + +++WG ++             RS+ + TWP         ++G   
Sbjct: 315 IENEAVVA-----AALRKWGDKIRLVNCDDKLPGLVRSKGISTWPVVDRNMEEKKKGDEN 369

Query: 426 EFEEVFRDDKPKCQLL-AESCIRALPREDGGIGFFAVCFQR 465
             E  F     + +     SCIR  P +    GFF   F++
Sbjct: 370 TVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFEK 410

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 87/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM------KNTG--TV 380

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +    R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 381 FANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 437

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 438 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGIIVYSTCSVAVEE 491

Query: 388 NERVV 392
           +E VV
Sbjct: 492 DEAVV 496

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 88/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 374

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   +R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 375 FANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 431

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 432 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEE 485

Query: 388 NERVV 392
           +E VV
Sbjct: 486 DEAVV 490

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 119/278 (42%), Gaps = 44/278 (15%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P ++L       V+D CAAPG+KT  L   + +   + +G    + A 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGF---VVAN 202

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFEDVTA---ALVDPSCSGSG 331
           + +  R+ +L     +    +L+ ++     F R+   +  +D       L D  CSG G
Sbjct: 203 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDG 262

Query: 332 IFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEENER 390
              RK++   N  +D      L  L + Q  ++   ++ + N  ++VYSTCS++  ENE 
Sbjct: 263 TM-RKNI---NVWKDWGTGSGLG-LHTVQLNILNRGLTLLKNGGRLVYSTCSLNPIENEA 317

Query: 391 VVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWPRRGIAEEFEEVFRDDKPKC- 438
           VV   L     ++WG ++             RS  + +WP   + + +EE  + D     
Sbjct: 318 VVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGISSWPV--LDKNYEEKNKGDDGTIA 370

Query: 439 -----------QLLAESCIRALPREDGGIGFFAVCFQR 465
                      +   E+CIR  P +    GFF   F++
Sbjct: 371 TWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 115/279 (41%), Gaps = 45/279 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   +     D++     I A 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQL---HKDTDEPTGIIVAN 215

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFEDVTAA----LVDPSCSGS 330
           + +  R+ +L     +    +++ ++     F  +       ++T      L D  CSG 
Sbjct: 216 DSDMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGD 275

Query: 331 GIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEENE 389
           G   RK++   N   D + Q+ L  L   Q  ++   +  + N  ++VYSTCS++  ENE
Sbjct: 276 GTL-RKNINIWN---DWRFQNALG-LHRLQNNILNRGLQLLRNGGRLVYSTCSMNPIENE 330

Query: 390 RVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP---------RRGIAEEFEE 429
            V+ + L     + W  ++S            RS  + +WP          RG  E  + 
Sbjct: 331 AVIANAL-----RNWAGEVSLVNFDDELPGLIRSRGISSWPVIDRNGEMRERGDPETLDS 385

Query: 430 VF---RDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
            F    D++    L  E CIR  P +     FF   F++
Sbjct: 386 WFPPTADEQKTFNL--EKCIRVYPHQQDTGAFFIAVFEK 422

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 88/185 (47%), Gaps = 23/185 (12%)

Query: 214 YKQGKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQI 273
           Y  G  I+Q  +S LP   L+P + + ++D  AAPG KTT+++A +       N G   +
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM------KNTG--CV 373

Query: 274 HAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIF 333
            A +   +R K L     + GC + +   V ++     P         L+D  CSG+G+ 
Sbjct: 374 FANDANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVI 430

Query: 334 GR-KSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARK-----IVYSTCSVHAEE 387
           G+ +S++ S   +D        ++   Q Q++  A+   +        IVYSTCSV  EE
Sbjct: 431 GKDQSVKVSRTEKD------FIQIPHLQKQLLLSAIDSVDCNSKHGGVIVYSTCSVAVEE 484

Query: 388 NERVV 392
           +E V+
Sbjct: 485 DEAVI 489

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 119/280 (42%), Gaps = 45/280 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHI---------ISAAGDSN 267
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   +            A D++
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 268 GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSC 327
             ++ +   + +   +  L  +   A     +K+H  D  +     +F+ +   L D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHT-DAEKKKEMLKFDRI---LCDVPC 260

Query: 328 SGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAE 386
           SG G   RK++   N  +D   Q  L  L + Q  ++   ++ + +  ++VYSTCS++  
Sbjct: 261 SGDGTM-RKNV---NVWKDWNTQGGLG-LHTVQLNILNRGLNLLKSGGRLVYSTCSMNPI 315

Query: 387 ENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP---------RRGIAEE 426
           ENE VV + L     ++WG ++             RS+ +  WP          +G    
Sbjct: 316 ENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLVRSKGISNWPVLDRNMAVKNKGDEGT 370

Query: 427 FEEVFRDDKPKCQLL-AESCIRALPREDGGIGFFAVCFQR 465
            E  F   + + ++   +SCIR  P +    GFF   F++
Sbjct: 371 IESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 119/278 (42%), Gaps = 44/278 (15%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   + +   +  G    + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGF---VVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRL-AVPD--QFEDVTAALVDPSCSGSG 331
           + +  R+ +L     +    +L+ ++     F R+ + PD  +F      L D  CSG G
Sbjct: 202 DADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDG 261

Query: 332 IFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEENER 390
              RK++   N  +D      L  L + Q  ++   ++ + +  ++VYSTCS++  ENE 
Sbjct: 262 TM-RKNV---NVWRDWGTASGLG-LHTVQLNILNRGLNLLKDGGRLVYSTCSLNPIENES 316

Query: 391 VVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RRGIAEEF 427
           V+   L     ++WG ++             RS+ +  WP              G+ E +
Sbjct: 317 VIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQWPVYDKNFALKEKGDEGVIETW 371

Query: 428 EEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
                ++  +  L  E+CIR  P +    GFF   F++
Sbjct: 372 FPPTEEEATRFHL--ENCIRVYPHQQNTGGFFITVFEK 407

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 119/278 (42%), Gaps = 44/278 (15%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  +   + S+  +  G    + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGF---VVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV---PDQFEDVTAALVDPSCSGSG 331
           + +  R+ +L     +    +LV ++     F R+      +QF      L D  CSG G
Sbjct: 202 DADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDG 261

Query: 332 IFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEENER 390
              RK++   N  +D      L  L + Q  ++K  ++ +    ++VYSTCS++  ENE 
Sbjct: 262 TM-RKNV---NVWKDWGTASGLG-LHTVQLNILKRGLNLLKKGGRLVYSTCSMNPIENEA 316

Query: 391 VVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWPRRGIAEEFEEVFRDDK---- 435
           VV   L     ++WG ++             RS+ +  WP   I + FE+  + D+    
Sbjct: 317 VVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPV--IDKAFEKKEKGDEGTTE 369

Query: 436 ----PKCQLLA----ESCIRALPREDGGIGFFAVCFQR 465
               P  +  A    + CIR  P +    GFF    ++
Sbjct: 370 SWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 120/282 (42%), Gaps = 49/282 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL-----------AAHIISAAGD 265
           G +  Q+  S +P  +L       V+D CAAPG+KT  L           +  +++   D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 266 SNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDP 325
           +      +H  ++    +  L  +   A     +++H G+ +      +F+ +   L D 
Sbjct: 205 ARRSHMLVHQLKR--LNSANLMVVNHDAQFFPRIRLH-GNSSNKNDVLKFDRI---LCDV 258

Query: 326 SCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVH 384
            CSG G   RK++   N  +D   Q  L  L + Q  ++   +  + N  ++VYSTCS++
Sbjct: 259 PCSGDGTM-RKNV---NVWKDWNTQAGLG-LHTVQLNILNRGLHLLKNNGRLVYSTCSLN 313

Query: 385 AEENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP--RRGIAEE----- 426
             ENE VV + L     ++WG ++             RS+ V  WP   R + E+     
Sbjct: 314 PIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRNLTEKTKGDE 368

Query: 427 --FEEVFR-DDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
              E  F   ++   +   ++C+R  P +    GFF   F++
Sbjct: 369 GTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 122/281 (43%), Gaps = 47/281 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL--AAHIISAAGDSNGGQAQIH 274
           G +  Q+  S +P  +L    +  V+D CAAPG+KT  L  A H+     D++     + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHM-----DTDEPTGFVV 200

Query: 275 AFEKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV---PDQFEDVTA---ALVDPS 326
           A + +  R+ +L     +    +L+ ++     F R+ +    D+ +D+      L D  
Sbjct: 201 ANDADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVP 260

Query: 327 CSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHA 385
           CSG G   RK++   N  +D   Q  L  L + Q+ ++   ++ + +  ++VYSTCS++ 
Sbjct: 261 CSGDGTM-RKNV---NVWKDWNTQSGLG-LHTVQYNILNRGLNLLKSGGRLVYSTCSLNP 315

Query: 386 EENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP---------RRGIAE 425
            ENE VV   L     + WG ++             RS+ +  WP          +G   
Sbjct: 316 IENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRSQGISQWPVIDRNMTEKNKGDEG 370

Query: 426 EFEEVFRDDKPKCQLL-AESCIRALPREDGGIGFFAVCFQR 465
             E  F   + + +    E+CIR  P +    GFF    ++
Sbjct: 371 TIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 120/281 (42%), Gaps = 47/281 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   I +   D++     + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQL---IEALHKDTDEPSGFVVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV---PDQFEDVTA---ALVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+ +    ++  DV      L D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCS 261

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEE 387
           G G   RK++   N  +D   Q  L  L + Q  ++   +  + +  ++VYSTCS++  E
Sbjct: 262 GDGTM-RKNV---NVWKDWNTQAGLG-LHTVQLNILNRGLHLLKDGGRLVYSTCSLNPIE 316

Query: 388 NERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RRGIA 424
           NE V+ + L     ++WG ++             RS+ V  WP              G  
Sbjct: 317 NEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRSKGVSKWPVYDRNLTEKTKGDEGTL 371

Query: 425 EEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           E F     ++  K  L  ++C+R  P +    GFF   F++
Sbjct: 372 ESFFAPSEEEASKFNL--QNCMRVYPHQQNTGGFFITVFEK 410

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 119/275 (43%), Gaps = 47/275 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KTT +   I +   D++     + A 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQM---IEALHKDTDEPTGFVVAN 199

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFEDVTAA------LVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+ + D+     A       L D  CS
Sbjct: 200 DADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCS 259

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEE 387
           G G   RK++   N  +D   Q  L  L + Q  ++   +  + N  ++VYSTCS++  E
Sbjct: 260 GDGTM-RKNV---NVWKDWNTQGALG-LHTVQLNILDRGLHLLQNNGRLVYSTCSMNPIE 314

Query: 388 NERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWPRRGIAEEFEEVFRDDK- 435
           NE VV + L     + WG ++             RS+ +  WP   I    EE  ++D+ 
Sbjct: 315 NEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRSQGITQWP--VIDRNMEERKKEDEG 367

Query: 436 -------PKCQLLA----ESCIRALPREDGGIGFF 459
                  P  + ++    E C+R  P +    GFF
Sbjct: 368 MINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 122/282 (43%), Gaps = 49/282 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L+      V+D CAAPG+KT  +  ++     D++     + A 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHR---DNDEPSGFVVAN 198

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRL-AVPD--------QFEDVTAALVDP 325
           + +  R+ +L     +    +L+ ++     F R+ A PD        +F+ V   L D 
Sbjct: 199 DADAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRV---LCDV 255

Query: 326 SCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVH 384
            CSG G   RK++   N  +D   Q+ L+ L + Q  ++   +  + +  ++VYSTCS++
Sbjct: 256 PCSGDGTM-RKNV---NVWRDWTTQNGLA-LHNVQLNILNRGLHLLKSGGRLVYSTCSMN 310

Query: 385 AEENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWPRRGIAEEFEEVFRD 433
             ENE VV + L     ++WG ++             RS  +  WP      E +E   D
Sbjct: 311 PIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGINQWPVLNRNMETKEKGED 365

Query: 434 ----------DKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
                     D+   +   + C+R  P +    GFF    ++
Sbjct: 366 GTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 119/281 (42%), Gaps = 47/281 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   I +   D++     + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQL---IEALHKDTDEPSGFVVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV---PDQFEDVTA---ALVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+ +    +   DV      L D  CS
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCS 261

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEE 387
           G G   RK++   N  +D   Q  L  L + Q  ++   +  + N  ++VYSTCS++  E
Sbjct: 262 GDGTM-RKNV---NVWKDWNTQAGLG-LHAVQLNILNRGLHLLKNNGRLVYSTCSLNPIE 316

Query: 388 NERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RRGIA 424
           NE VV + L     ++WG ++             RS+ V  WP              G  
Sbjct: 317 NEAVVAEAL-----RKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDRNLTEKTKGDEGTL 371

Query: 425 EEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           + F     ++  K  L  ++C+R  P +    GFF   F++
Sbjct: 372 DSFFSPSEEEASKFNL--QNCMRVYPHQQNTGGFFITVFEK 410

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 117/280 (41%), Gaps = 45/280 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL--AAHIISA-------AGDSN 267
           G +  Q+  S +P  +L       V+D CAAPG+KT  +  A H+ +A       A DS+
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 268 GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSC 327
             ++ +   + +   +  +  +   A     +K+ VGD  +     +F+ +   L D  C
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDVPC 260

Query: 328 SGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAE 386
           SG G   RK++   N  +D   Q  L  L + Q+ ++   +  +    ++VYSTCS++  
Sbjct: 261 SGDGTM-RKNV---NVWKDWNTQAGLG-LHTIQYNILNRGLHLLKTGGRLVYSTCSLNPI 315

Query: 387 ENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP---------RRGIAEE 426
           ENE VV   L     + WG ++             RS  V  WP          +G    
Sbjct: 316 ENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRSNGVTQWPVFDRNMESKNKGDEGT 370

Query: 427 FEEVF-RDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
            E  F   D+       ++C+R  P +    GFF    ++
Sbjct: 371 LESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFITVIEK 410

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 119/281 (42%), Gaps = 47/281 (16%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L    +  V+D CAAPG+KT  L   + +   D++     + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQL---LEALHRDTDEPTGFVVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFEDVT------AALVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+      E  +        L D  CS
Sbjct: 202 DADNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCS 261

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEE 387
           G G   RK++   N  +D   Q+ L  L   Q  ++   +  +    ++VYSTCS++  E
Sbjct: 262 GDGTM-RKNV---NVWRDWNTQNALG-LHQVQANILNRGLHLLKKGGRLVYSTCSMNPIE 316

Query: 388 NERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RRGIA 424
           NE VV   L     ++WG ++             R++ +  WP            + G  
Sbjct: 317 NEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRNKGISKWPTLNRNMEEMEKGQEGAN 371

Query: 425 EEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           + + +   ++  K QL  E+CIR  P +    GFF   F++
Sbjct: 372 DSWFQPTEEEAEKFQL--ENCIRVYPHQQNTGGFFITVFEK 410

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 122/276 (44%), Gaps = 40/276 (14%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L    +  V+D CAAPG+KT  L   + +   + +G    + A 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGF---VVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPDQFEDVT---AALVDPSCSGSG 331
           + +  R+ +L     +    +L+ ++     F R+   +  +D       L D  CSG G
Sbjct: 202 DADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDG 261

Query: 332 IFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAEENER 390
              RK++   N  +D      L  L + Q  ++   ++ + +  ++VYSTCS++  ENE 
Sbjct: 262 TM-RKNI---NVWKDWATASGLG-LHTVQVNILNRGLNLLKDGGRLVYSTCSLNPIENEA 316

Query: 391 VVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP--RRGI-AEEFEEVFRD--- 433
           VV      + +++WG ++             RS+ +  WP   +G  A++  +   D   
Sbjct: 317 VVA-----AALRKWGDKIKLVECGDKLPGLIRSQGISQWPVYDKGFNAKQRSDEGVDASW 371

Query: 434 ----DKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
               D+   +   ESC+R  P +    GFF   F++
Sbjct: 372 FPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 118/284 (41%), Gaps = 53/284 (18%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL-----------AAHIISAAGD 265
           G +  Q+  S +P  +L       V+D CAAPG+KT  L           +  +++   D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 266 SNGGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDP 325
           +      +H  ++    +  L  +   A     +++H G+  +     +F+ +   L D 
Sbjct: 205 ARRSHMLVHQLKR--LNSANLMVVNHDAQFFPRIRLH-GNSNKKNDILKFDRI---LCDV 258

Query: 326 SCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNAR-KIVYSTCSVH 384
            CSG G   RK++   N  +D   Q  L  L + Q  ++   + +  +  ++VYSTCS++
Sbjct: 259 PCSGDGTM-RKNV---NVWKDWNTQAGLG-LHTVQLNILNRGLHLLKSNGRLVYSTCSLN 313

Query: 385 AEENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RR 421
             ENE V+ + L     ++WG ++             RS+ V  WP              
Sbjct: 314 PIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLIRSKGVSKWPVYDRNLTEKNKGDE 368

Query: 422 GIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           G  E F     ++  K  L  ++C+R  P +    GFF   F++
Sbjct: 369 GTLESFFPPSEEEASKFNL--KNCMRVYPHQQNTGGFFISVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 120/282 (42%), Gaps = 49/282 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   + +   +  G    + A 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTG---IVVAN 200

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV------PDQFEDVTAALVDPSCS 328
           + +  R+ +L     +    +L+ ++     F R+A+       + F      L D  CS
Sbjct: 201 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCS 260

Query: 329 GSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSM--PNARKIVYSTCSVHAE 386
           G G   RK++   N  +D   Q  L  L + Q  ++   + +  P  R +VYSTCS++  
Sbjct: 261 GDGTM-RKNV---NVWRDWTSQGGLG-LHNIQLNILNRGLHLLKPKGR-LVYSTCSMNPI 314

Query: 387 ENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP------------RRGI 423
           ENE V+      + +++WG ++             RS+ + +WP             +G+
Sbjct: 315 ENEAVIA-----AALRKWGSKIRVINCDEKLPGLVRSKGIDSWPVFNRDMEIRQKGDQGV 369

Query: 424 AEEFEEVFRDDKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
           +  +     ++K +  L  ++CIR  P +     FF    ++
Sbjct: 370 SNTWFPPSEEEKSQFNL--QNCIRVYPHQQNTGAFFITVIEK 409

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 116/282 (41%), Gaps = 49/282 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  L   + +   DSN     + A 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQL---LEALHRDSNEPTGFVVAN 195

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH-----------VGDFTRLAVPDQFEDVTAALVDP 325
           + +  RA +L     +    +L+ ++             D T  +   +++ +   L D 
Sbjct: 196 DSDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRI---LCDV 252

Query: 326 SCSGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVH 384
            CSG G   RK++   N  +D   Q+ L  L + Q  ++   +  + +  ++VYSTCS++
Sbjct: 253 PCSGDGTM-RKNV---NVWKDWNTQNALG-LHNVQLNILNRGLQLLKDNGRLVYSTCSLN 307

Query: 385 AEENERVVIDLLLDSKVKEWGWQLS-----------PRSEVVPTWP-----RRGIAEEFE 428
             ENE VV      + +++WG ++             RS  +  W         I ++ E
Sbjct: 308 PIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRSNGISHWSVYDREMNAITKDSE 362

Query: 429 EVFRD-----DKPKCQLLAESCIRALPREDGGIGFFAVCFQR 465
                     D  K     E C+R  P +    GFF   F++
Sbjct: 363 STKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 112/283 (39%), Gaps = 50/283 (17%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHL--AAHI-------ISAAGDSN 267
           G +  Q+  S +P  +L+      V+D CAAPG+KT  L  A H+          A DS+
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSD 198

Query: 268 GGQAQIHAFEKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSC 327
             ++  H    +  R      M          KI + D  +     ++      L D  C
Sbjct: 199 SKRS--HMLVHQLKRLNSANLMVVNHDAQFFPKIQL-DSNKGRHNKEYLKFDRILCDVPC 255

Query: 328 SGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAE 386
           SG G   RK++   N  +D   Q+ L  L + Q  ++   +  + +  ++VYSTCS+   
Sbjct: 256 SGDGTI-RKNV---NIWKDWNTQNSLG-LHNVQLNILNRGIQLLKSGGRLVYSTCSLSPI 310

Query: 387 ENERVVIDLLLDSKVKEWG-----------------------WQLSPRSEVVPTWPRRGI 423
           ENE V+      + +++WG                       W++  R+  + +   +G 
Sbjct: 311 ENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGISKWEVYDRTMSIVS---KGA 362

Query: 424 AEEFEEVFRDDKPKCQLLAES-CIRALPREDGGIGFFAVCFQR 465
            +  +  F+  + +      S CIR  P +    GFF    ++
Sbjct: 363 EKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 89/199 (44%), Gaps = 23/199 (11%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L+      V+D CAAPG+KT  L   + + + + +G    + A 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGF---VIAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAVPD-------QFEDVTAALVDPSC 327
           + +  R+ +L     +    +L+ ++     F R+ V         QF      L D  C
Sbjct: 202 DADYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPC 261

Query: 328 SGSGIFGRKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMS-MPNARKIVYSTCSVHAE 386
           SG G   RK++   N  +D      L  L   Q  +++  ++ +    K+VYSTCS++  
Sbjct: 262 SGDGTM-RKNV---NVWKDWNTGSGLG-LHIVQLNILERGLNLLKEGGKLVYSTCSLNPI 316

Query: 387 ENERVVIDLLLDSKVKEWG 405
           ENE V+   L     + WG
Sbjct: 317 ENEAVIAAAL-----RRWG 330

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 9/132 (6%)

Query: 217 GKVIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF 276
           G +  Q+  S +P  +L       V+D CAAPG+KT  +   + +   +  G    + A 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGF---VVAN 201

Query: 277 EKEPARAKVLQKMTSQAGCGSLVKIH--VGDFTRLAV---PDQFEDVTAALVDPSCSGSG 331
           + +  R+ +L     +    +L+ ++     F R+ +    +QF      L D  CSG G
Sbjct: 202 DADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDG 261

Query: 332 IFGRKSLESSND 343
              RK++    D
Sbjct: 262 TM-RKNVNVWRD 272

>Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 363 VVKHAMSMPNARKIVYSTCSVHAEENERVVIDL--LLDSKVKEWGWQ 407
            + + M  P  RKI+Y  CS    E E+ +++L  L+D + KE G+Q
Sbjct: 56  TIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQ 100

>Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W
           (REAL)
          Length = 777

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 363 VVKHAMSMPNARKIVYSTCSVHAEENERVVIDL--LLDSKVKEWGWQ 407
            + + M  P  RKI+Y  CS    E E+ +++L  L+D + KE G+Q
Sbjct: 56  TIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQ 100

>YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to 3'
           DNA helicase, involved in nucleotide excision repair and
           transcription; subunit of RNA polII initiation factor
           TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3);
           homolog of human XPD protein; mutant has aneuploidy
           tolerance
          Length = 778

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 363 VVKHAMSMPNARKIVYSTCSVHAEENERVVIDL--LLDSKVKEWGWQ 407
            + + M  P  RKI+Y  CS    E E+ +++L  L+D + KE G+Q
Sbjct: 56  TIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQ 100

>Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 363 VVKHAMSMPNARKIVYSTCSVHAEENERVVIDL--LLDSKVKEWGWQ 407
            + + M  P  RKI+Y  CS    E E+ +++L  L+D + KE G+Q
Sbjct: 56  TIAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQ 100

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,820,680
Number of extensions: 2065293
Number of successful extensions: 4948
Number of sequences better than 10.0: 69
Number of HSP's gapped: 4894
Number of HSP's successfully gapped: 69
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)