Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01848g2.284ON70470435490.0
TDEL0G021502.284ON66172514410.0
YIL095W (PRK1)2.284ON81051313581e-177
NCAS0B062602.284ON72346913391e-175
Suva_9.1042.284ON80550013441e-175
Skud_9.782.284ON80948613391e-174
Smik_9.842.284ON80851413321e-173
SAKL0E07722g2.284ON79149213181e-171
Kpol_1003.352.284ON71331813071e-171
Kwal_27.115422.284ON79131513111e-170
TBLA0B059302.284ON71731312711e-165
KLTH0G10318g2.284ON79031512721e-164
KAFR0J013702.284ON78050312701e-164
KLLA0E08405g2.284ON77752712681e-164
TPHA0C033802.284ON69732212581e-163
NDAI0B035602.284ON75643712591e-163
CAGL0G02607g2.284ON68836312521e-163
KAFR0H033302.284ON36931712081e-161
NCAS0G038102.284ON66163412321e-160
Ecym_33232.284ON74848612221e-157
ADL217W2.284ON75049512121e-156
NDAI0G006402.284ON62131511921e-155
Kpol_1039.332.284ON70138011971e-154
Suva_14.3272.284ON63230811901e-154
KNAG0H020202.284ON59233611791e-153
YNL020C (ARK1)2.284ON63831411791e-152
Skud_14.3092.284ON63930611771e-152
Smik_14.3112.284ON63731411661e-150
TBLA0B069402.284ON144333311881e-145
CAGL0J03432g2.284ON62231110951e-140
KNAG0A054302.284ON78849511021e-139
TPHA0D015402.284ON70730910091e-126
Kpol_251.43.273ON8383208115e-96
KAFR0A010403.273ON9123238015e-94
KNAG0H012203.273ON9133307939e-93
SAKL0D03234g3.273ON8583157802e-91
TPHA0M011203.273ON7883167752e-91
KNAG0J008203.273ON10913227913e-91
NCAS0A105903.273ON10953197895e-91
KLTH0C07260g3.273ON9013187762e-90
TBLA0E025903.273ON10613187823e-90
Suva_4.2973.273ON11073197825e-90
ZYRO0E06864g3.273ON11153187826e-90
Kpol_1052.223.273ON11013077809e-90
Ecym_26503.273ON8943097656e-89
Skud_2.1793.273ON10903197746e-89
NDAI0A057003.273ON11573267758e-89
Smik_2.1913.273ON11083197738e-89
Kwal_27.109453.273ON9353127669e-89
TDEL0D035203.273ON10493167701e-88
YBR059C (AKL1)3.273ON11083217676e-88
KLLA0F18612g3.273ON8143137474e-87
CAGL0H10208g3.273ON10273227498e-86
KAFR0C004303.273ON9493227432e-85
AGR027C3.273ON9613157344e-84
CAGL0K11990g3.273ON9913217172e-81
TPHA0A040303.273ON10543217122e-80
TBLA0I019303.273ON13613187164e-80
KAFR0A050906.31ON6682952601e-22
Skud_16.426.262ON3643332238e-19
KLTH0G05214g5.591ON6532842271e-18
SAKL0H06754g8.668ON8842992281e-18
KLTH0F16676g5.406ON8782812281e-18
SAKL0A03344g6.262ON3643542193e-18
Suva_16.1608.668ON9182972253e-18
KLLA0E03587g5.591ON6472832234e-18
Suva_16.706.262ON3643392174e-18
KNAG0F001701.24ON5432832216e-18
KAFR0G012001.24ON5072722181e-17
CAGL0M02299g8.668ON8932962192e-17
KLTH0D11044g8.668ON8492822173e-17
TPHA0E038501.24ON4821932134e-17
SAKL0C00946g1.24ON5642762136e-17
NCAS0A002801.24ON5352922118e-17
Kwal_55.215455.406ON8652812121e-16
Kpol_1023.266.31ON7392712111e-16
YPL236C (ENV7)6.262ON3643312052e-16
NDAI0K021002.496ON9092382102e-16
NCAS0C016708.668ON8962962102e-16
Kpol_1072.198.668ON8962882102e-16
ZYRO0C06776g5.591ON8902742093e-16
Skud_16.1328.668ON9242972093e-16
Kwal_33.131121.24ON5052972063e-16
Smik_6.3478.668ON9172972083e-16
Smik_6.4416.262ON3643332033e-16
ZYRO0F18062g1.24ON4711932053e-16
YPL150W8.668ON9012972083e-16
ZYRO0B01166g2.496ON9633172084e-16
TDEL0C067801.24ON4682842045e-16
CAGL0I07513g3.92ON10762692075e-16
Kwal_26.87518.668ON8483042065e-16
TDEL0D053203.92ON10572722066e-16
NDAI0C026806.31ON7502842057e-16
NCAS0C041008.141ON9053312057e-16
TDEL0A027202.496ON9152872058e-16
KNAG0B053502.496ON8362842049e-16
KAFR0C014403.92ON10952462051e-15
Kpol_2002.241.24ON4871862002e-15
Kwal_56.242746.262ON3463361972e-15
CAGL0J11638g6.31ON7463182022e-15
TBLA0A074601.24ON5162682002e-15
TPHA0P010503.92ON11212982004e-15
KLTH0C09548g3.92ON9932921994e-15
NCAS0D021006.31ON7263221984e-15
ZYRO0F07194g8.668ON9382981985e-15
NDAI0E012908.654ON7292411976e-15
ZYRO0D05500g7.86ON12621831986e-15
KNAG0F029006.31ON6492621967e-15
Kwal_47.183075.591ON6212781968e-15
KLLA0F11319g8.668ON8432781969e-15
Ecym_10301.24ON4402831939e-15
KNAG0D048107.86ON14401871979e-15
TDEL0A067506.262ON3723511911e-14
TBLA0E027905.591ON8082231951e-14
Skud_4.7643.92ON7562991941e-14
YDR523C (SPS1)1.24ON4901961921e-14
KLTH0F00946g1.24ON5122401931e-14
NDAI0F045201.24ON4892731921e-14
Skud_8.392.496ON9232901941e-14
CAGL0H01639g1.24ON5212711931e-14
Kwal_26.78612.496ON9552881942e-14
KLLA0E21693g5.406ON10162271932e-14
ACR133C8.668ON8513001932e-14
Skud_4.7971.24ON4851951912e-14
Kwal_27.100041.507ON7352341922e-14
Sklu_YGOB_Anc_2.4962.496ON6192801913e-14
TBLA0B082503.92ON13472171933e-14
Suva_2.7031.24ON4851951903e-14
KLLA0F14190g1.271ON13382271933e-14
YHL007C (STE20)2.496ON9392921913e-14
Smik_4.7673.92ON7582981913e-14
AFR724C1.24ON4402811883e-14
SAKL0G01848g5.406ON8852731913e-14
TDEL0G043806.31ON7223221914e-14
Kpol_1037.206.31ON7042891914e-14
KLTH0H03080g6.262ON3463341864e-14
TBLA0B039708.654ON12082621914e-14
KNAG0A030408.654ON6442531904e-14
KAFR0B028008.279ON10952041914e-14
ABL034W2.479ON14251991914e-14
CAGL0G04609g3.92ON9652931914e-14
Smik_8.422.496ON9392901914e-14
KLLA0C12485g3.92ON9252841904e-14
Smik_4.8031.24ON4901961885e-14
TBLA0A047207.86ON12621811915e-14
TPHA0G032902.496ON9732971905e-14
KNAG0E008506.31ON7112841886e-14
ZYRO0D06776g8.279ON12042071897e-14
KAFR0D012207.86ON10551951897e-14
Suva_15.2975.406ON10742221897e-14
NDAI0A038702.496ON8952351888e-14
TDEL0A045805.591ON6942241888e-14
TDEL0F040608.279ON11262071889e-14
KLTH0D06006g2.496ON9542881889e-14
Suva_8.472.496ON9803151889e-14
TPHA0J004206.31ON7072801879e-14
TDEL0A061408.668ON8612911889e-14
Kpol_1065.36.222ON3762741831e-13
SAKL0H07084g8.654ON9192671871e-13
Skud_10.1191.271ON14812271871e-13
TBLA0B038608.668ON9882781871e-13
CAGL0L11550g5.406ON10721941871e-13
Skud_15.3998.654ON8072471861e-13
KLTH0D10714g8.654ON8722751861e-13
Kpol_1054.23.92ON10962941871e-13
Ecym_24342.496ON11222831871e-13
NDAI0G042903.92ON11132961861e-13
Suva_6.1691.271ON14842271872e-13
Kpol_463.81.271ON14472341862e-13
Kwal_26.73551.271ON14462821862e-13
ZYRO0C07480g6.31ON7742891852e-13
Kpol_1055.242.496ON9372821862e-13
Suva_13.1636.31ON7052801852e-13
ZYRO0B06512g3.92ON11112501862e-13
CAGL0K02673g2.496ON9152371852e-13
ABR014W2.496ON9713231852e-13
ZYRO0E07876g6.262ON3693361812e-13
NCAS0A050502.496ON8932871852e-13
Suva_8.2848.654ON8082471852e-13
TBLA0C046008.279ON13152121852e-13
Skud_8.1635.406ON10762221852e-13
Suva_2.6663.92ON7642941842e-13
CAGL0B01925g8.279ON9442251852e-13
Skud_13.1546.31ON7052801842e-13
Kwal_56.226933.92ON9842851852e-13
CAGL0M11396g8.279ON11922081852e-13
KLLA0B13607g2.496ON9892881842e-13
NCAS0B050908.279ON12102081843e-13
YMR001C (CDC5)6.31ON7052801833e-13
SAKL0D12628g1.507ON8181791833e-13
CAGL0F00913g7.86ON12062041843e-13
ZYRO0A06446g5.406ON9432731833e-13
KAFR0G026906.31ON7132801833e-13
Smik_13.1596.31ON7052801833e-13
TBLA0H016605.406ON9962731833e-13
YJL095W (BCK1)1.271ON14782271834e-13
TBLA0F008203.167ON7452531824e-13
Skud_16.3403.338ON3882501794e-13
KLTH0G13288g8.279ON11422071824e-13
KLLA0C00979g1.24ON4832891804e-13
YHR102W (KIC1)5.406ON10802221825e-13
Smik_8.1805.406ON10732221825e-13
Kpol_1031.105.406ON11272221825e-13
KNAG0G021108.279ON11921961825e-13
NCAS0C049403.92ON11162901816e-13
KAFR0D049505.406ON10082301817e-13
NDAI0H024707.86ON14112011817e-13
Suva_16.3823.338ON3982521778e-13
TDEL0A060008.654ON7902741808e-13
TPHA0D011408.654ON6223111798e-13
Kpol_431.92.479ON15522331808e-13
TPHA0H016305.406ON10362221809e-13
Kpol_1000.144.384ON6652691799e-13
Smik_10.1471.271ON14782271809e-13
Kwal_56.237178.279ON8582031791e-12
KNAG0D002106.371ON8332541791e-12
SAKL0C09174g3.92ON10712951791e-12
YDR490C (PKH1)3.92ON7662941791e-12
TPHA0F024306.31ON7982741791e-12
KAFR0F039704.192ON3842341751e-12
TBLA0A035705.406ON9751951791e-12
YLR096W (KIN2)8.279ON11471981791e-12
YOR233W (KIN4)8.654ON8002391791e-12
KNAG0J016708.668ON10092811791e-12
Ecym_42918.279ON11452071791e-12
Ecym_73922.479ON14341991791e-12
NDAI0J012508.279ON11761981791e-12
Kpol_1072.298.654ON8932381781e-12
NCAS0B044906.222ON3491981741e-12
Kpol_1044.37.86ON9321791781e-12
NDAI0E023908.668ON8832021781e-12
KAFR0A017602.496ON8852811781e-12
NDAI0A019707.335ON6382281772e-12
NCAS0A094701.271ON15152271782e-12
CAGL0L03520g1.271ON14472861782e-12
Smik_15.4178.654ON8062481772e-12
TPHA0G016308.668ON8713001772e-12
Kwal_26.71547.86ON12133061772e-12
YPL141C (FRK1)8.654ON8652441762e-12
Kpol_1012.68.654ON6282331762e-12
NCAS0B037408.279ON10492171772e-12
ZYRO0F06842g8.654ON8432201762e-12
Smik_6.3398.654ON8652911762e-12
ACL104C5.406ON9473121762e-12
Ecym_35863.92ON10771991762e-12
AFR335C3.92ON10331951762e-12
AGR058W8.279ON10712071763e-12
TDEL0H036407.86ON12371861763e-12
SAKL0H16632g8.279ON10622111753e-12
TBLA0I011502.479ON17452521763e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01848g
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...  1371   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   559   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   527   e-177
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   520   e-175
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   522   e-175
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   520   e-174
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   517   e-173
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   512   e-171
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   508   e-171
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   509   e-170
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   494   e-165
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   494   e-164
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   493   e-164
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   493   e-164
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   489   e-163
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   489   e-163
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   486   e-163
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   469   e-161
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   479   e-160
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   475   e-157
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   471   e-156
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    463   e-155
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   465   e-154
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   462   e-154
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   458   e-153
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   458   e-152
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   457   e-152
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   453   e-150
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   462   e-145
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   426   e-140
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   429   e-139
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   393   e-126
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   317   5e-96
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   313   5e-94
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   310   9e-93
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   305   2e-91
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   303   2e-91
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   309   3e-91
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   308   5e-91
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   303   2e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   305   3e-90
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   305   5e-90
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   305   6e-90
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   305   9e-90
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   299   6e-89
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   302   6e-89
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   303   8e-89
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   302   8e-89
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   299   9e-89
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   301   1e-88
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   300   6e-88
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   292   4e-87
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   293   8e-86
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   290   2e-85
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   287   4e-84
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   280   2e-81
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   278   2e-80
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   280   4e-80
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            104   1e-22
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    91   8e-19
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    92   1e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    92   1e-18
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    92   1e-18
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    89   3e-18
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    91   3e-18
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    91   4e-18
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    88   4e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    90   6e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    89   1e-17
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    89   2e-17
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    88   3e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    87   4e-17
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    87   6e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        86   8e-17
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   1e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    86   1e-16
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    84   2e-16
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    86   2e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    86   2e-16
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    86   2e-16
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    85   3e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    85   3e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    84   3e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    85   3e-16
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    83   3e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    84   3e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    85   3e-16
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    85   4e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    83   5e-16
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    84   5e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    84   5e-16
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    84   6e-16
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    84   7e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     84   7e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    84   8e-16
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    83   9e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    84   1e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    82   2e-15
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    80   2e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    82   2e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    82   2e-15
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    82   4e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    81   4e-15
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      81   4e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    81   5e-15
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    80   6e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    81   6e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               80   7e-15
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    80   8e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    80   9e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    79   9e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    80   9e-15
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    78   1e-14
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    80   1e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    79   1e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   1e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    79   1e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    79   1e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    79   1e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    79   1e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    79   2e-14
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    79   2e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    79   2e-14
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    78   2e-14
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    79   2e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    78   3e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   3e-14
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    78   3e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    79   3e-14
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    78   3e-14
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    78   3e-14
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    77   3e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    78   3e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    78   4e-14
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    78   4e-14
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    76   4e-14
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    78   4e-14
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    78   4e-14
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    78   4e-14
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    78   4e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    78   4e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    78   4e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    78   4e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    77   5e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    78   5e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    78   5e-14
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    77   6e-14
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    77   7e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    77   7e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    77   7e-14
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     77   8e-14
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    77   8e-14
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    77   9e-14
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    77   9e-14
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    77   9e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    77   9e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    77   9e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    75   1e-13
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    77   1e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    77   1e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    77   1e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    77   1e-13
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    76   1e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    76   1e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    77   1e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    77   1e-13
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    76   1e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    77   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    76   2e-13
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    76   2e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   2e-13
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    76   2e-13
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    76   2e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    76   2e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    76   2e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    76   2e-13
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    74   2e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    76   2e-13
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    76   2e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    76   2e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    76   2e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    75   2e-13
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    76   2e-13
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    75   2e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    76   2e-13
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    76   2e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    75   2e-13
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              75   3e-13
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    75   3e-13
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    75   3e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    75   3e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    75   3e-13
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    75   3e-13
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    75   3e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    75   3e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    75   4e-13
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    75   4e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    74   4e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    75   4e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    74   4e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   5e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    75   5e-13
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    75   5e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    75   5e-13
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    74   6e-13
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    74   7e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    74   7e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    73   8e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    74   8e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   8e-13
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    74   8e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   9e-13
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    74   9e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    74   9e-13
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    74   1e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    74   1e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    74   1e-12
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    74   1e-12
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    74   1e-12
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    72   1e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    74   1e-12
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    74   1e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    74   1e-12
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    74   1e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    74   1e-12
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    74   1e-12
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    74   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    73   1e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     72   1e-12
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    73   1e-12
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    73   1e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    73   1e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     73   2e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    73   2e-12
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    73   2e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    73   2e-12
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    73   2e-12
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    73   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    72   2e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    72   2e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    73   2e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    72   2e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   2e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    72   2e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    72   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    72   2e-12
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    72   3e-12
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    72   3e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    72   3e-12
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    72   3e-12
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    72   3e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    72   3e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    72   3e-12
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    70   3e-12
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    72   3e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    72   3e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    72   3e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    72   3e-12
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    72   4e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    72   4e-12
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    72   4e-12
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    72   4e-12
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    72   4e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    72   4e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    72   4e-12
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    71   4e-12
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    72   4e-12
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    72   4e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    71   5e-12
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    71   5e-12
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    72   5e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    71   5e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    72   5e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    70   5e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    71   6e-12
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    71   6e-12
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              71   6e-12
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    71   6e-12
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    71   7e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    70   7e-12
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    71   7e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    70   7e-12
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    71   8e-12
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    71   8e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    71   8e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    70   8e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    70   8e-12
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    71   8e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    70   8e-12
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    70   9e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    70   9e-12
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    70   9e-12
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    70   9e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    70   9e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    70   9e-12
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    70   1e-11
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    70   1e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    70   1e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    70   1e-11
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    70   1e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    70   1e-11
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    70   1e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    70   1e-11
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    70   1e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    70   1e-11
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    70   1e-11
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    70   1e-11
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    70   1e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    70   1e-11
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    70   1e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    70   1e-11
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    70   1e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    70   2e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    70   2e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   2e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    70   2e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    70   2e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    68   2e-11
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    69   2e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    69   2e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    70   2e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    69   2e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   2e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    68   2e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    68   3e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   3e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   3e-11
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    69   3e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   3e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    69   3e-11
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    69   3e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    69   3e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   3e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    69   3e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    69   3e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   3e-11
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    69   3e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    68   3e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   3e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    68   4e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    69   4e-11
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    67   4e-11
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    69   4e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    68   5e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    68   5e-11
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    68   5e-11
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    68   5e-11
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    68   5e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    68   5e-11
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    68   5e-11
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    68   5e-11
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    68   5e-11
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    68   5e-11
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    68   6e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    68   6e-11
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    68   6e-11
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    68   6e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    67   6e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    68   6e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    67   6e-11
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    68   6e-11
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    68   6e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    67   7e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    67   7e-11
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    67   7e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               67   8e-11
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    68   8e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    67   8e-11
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    67   8e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    67   8e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    67   9e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    67   9e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     67   9e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    67   9e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    67   9e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    67   9e-11
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    67   9e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    67   9e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    67   1e-10
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    67   1e-10
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    67   1e-10
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    67   1e-10
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    67   1e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    67   1e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    67   1e-10
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    66   1e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    67   1e-10
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    67   1e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    66   1e-10
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    67   1e-10
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    67   1e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    67   1e-10
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    67   1e-10
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    67   1e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    67   1e-10
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    66   1e-10
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    67   1e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    66   1e-10
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    67   2e-10
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    67   2e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    67   2e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   2e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    66   2e-10
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    66   2e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     66   2e-10
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    67   2e-10
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    67   2e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    66   2e-10
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    67   2e-10
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    66   2e-10
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    67   2e-10
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    67   2e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    66   2e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    66   2e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    65   2e-10
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    66   2e-10
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    65   2e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       66   2e-10
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    65   2e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    66   2e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    65   2e-10
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    66   2e-10
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    66   2e-10
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    66   2e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    65   2e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    66   2e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    66   2e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    66   2e-10
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     66   2e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    66   2e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    65   2e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   2e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    66   3e-10
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    65   3e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   3e-10
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    65   3e-10
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    65   3e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    66   3e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    65   3e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    65   3e-10
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    66   3e-10
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    65   3e-10
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    65   3e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    64   3e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   3e-10
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    64   3e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    65   3e-10
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    65   3e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    64   4e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     64   4e-10
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    65   4e-10
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    64   4e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    65   4e-10
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    65   4e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    65   4e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    65   4e-10
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    64   4e-10
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    64   4e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   4e-10
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    65   4e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    65   4e-10
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    65   4e-10
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    64   4e-10
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    64   4e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    65   4e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    65   4e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    64   5e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    64   5e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    64   5e-10
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    64   5e-10
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    65   5e-10
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    64   5e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    65   5e-10
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    64   5e-10
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    63   5e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    64   6e-10
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    65   6e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    65   6e-10
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    65   6e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    65   6e-10
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    64   6e-10
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    64   6e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    64   7e-10
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              64   7e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    64   7e-10
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    64   7e-10
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    65   7e-10
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              64   7e-10
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    62   7e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    64   7e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    64   8e-10
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              62   8e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    64   8e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    64   8e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     64   8e-10
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    64   8e-10
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    64   8e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    64   8e-10
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    64   8e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    63   8e-10
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    64   8e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    64   9e-10
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    64   9e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    64   9e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    64   9e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    63   1e-09
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    64   1e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    64   1e-09
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    64   1e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   1e-09
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    64   1e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    64   1e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    64   1e-09
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    63   1e-09
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    63   1e-09
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    62   1e-09
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    63   1e-09
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    63   1e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    64   1e-09
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    64   1e-09
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    62   1e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    64   1e-09
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    64   1e-09
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    63   1e-09
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   1e-09
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    64   1e-09
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    62   2e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    63   2e-09
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    63   2e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    62   2e-09
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    64   2e-09
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    63   2e-09
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    63   2e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    62   2e-09
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    63   2e-09
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    63   2e-09
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    63   2e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    63   2e-09
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    62   2e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    63   2e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    63   2e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    63   2e-09
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    63   2e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    63   2e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    63   2e-09
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    62   2e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    62   2e-09
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    62   2e-09
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    62   2e-09
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    63   2e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    63   2e-09
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    62   2e-09
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    62   2e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    62   2e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    63   2e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    62   2e-09
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    62   2e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    63   2e-09
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    60   3e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    62   3e-09
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    63   3e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   3e-09
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    62   3e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    62   3e-09
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    62   3e-09
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    62   3e-09
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    62   3e-09
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    62   3e-09
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    62   3e-09
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    62   3e-09
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    62   3e-09
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    62   3e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    62   3e-09
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    62   3e-09
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    62   3e-09
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    62   4e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    62   4e-09
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    62   4e-09
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    62   4e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    62   4e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    62   4e-09
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    62   4e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    61   4e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   4e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    62   4e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     61   4e-09
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    62   4e-09
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    62   4e-09
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    62   4e-09
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    62   4e-09
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    61   4e-09
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    62   4e-09
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    60   4e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    62   5e-09
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    61   5e-09
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    62   5e-09
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    61   5e-09
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    62   5e-09
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    62   5e-09
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    62   5e-09
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    62   5e-09
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    61   5e-09
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   5e-09
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    62   5e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    60   5e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    62   5e-09
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    62   5e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    61   6e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    61   6e-09
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    61   6e-09
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    62   6e-09
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    61   7e-09
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    61   7e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    61   7e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    60   7e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    61   8e-09
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    59   8e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    61   8e-09
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     61   8e-09
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    59   8e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    61   8e-09
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   8e-09
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    61   8e-09
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    61   8e-09
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               60   9e-09
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    61   9e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   9e-09
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    61   9e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    61   9e-09
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    61   9e-09
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    60   9e-09
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    60   9e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   9e-09
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    61   1e-08
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    60   1e-08
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    59   1e-08
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    60   1e-08
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    60   1e-08
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    60   1e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    60   1e-08
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    60   1e-08
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    60   1e-08
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    60   1e-08
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    60   1e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    60   1e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    60   1e-08
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    59   1e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    60   1e-08
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    60   1e-08
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    60   1e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    60   1e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    60   1e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   1e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    60   1e-08
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    60   1e-08
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    60   1e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   1e-08
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    60   1e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    60   1e-08
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    60   2e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    60   2e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    60   2e-08
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    60   2e-08
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    60   2e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   2e-08
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    59   2e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    60   2e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   2e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    60   2e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    60   2e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    60   2e-08
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    60   2e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    60   2e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    60   2e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   2e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    60   2e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    59   2e-08
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    59   2e-08
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    60   2e-08
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    59   2e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   2e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    60   2e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    60   2e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    59   2e-08
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    60   2e-08
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    59   2e-08
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    59   2e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    59   2e-08
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    59   2e-08
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    59   2e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    59   2e-08
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    59   2e-08
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    59   2e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    60   2e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    59   2e-08
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    59   2e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    59   2e-08
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    60   2e-08
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    59   2e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   2e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    59   2e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   2e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    59   2e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   2e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    59   2e-08
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    59   2e-08
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    59   2e-08
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    59   2e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    59   3e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    59   3e-08
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               59   3e-08
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    58   3e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    58   3e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    59   3e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    59   3e-08
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    59   3e-08
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    59   3e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   3e-08
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    58   3e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    59   3e-08
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    59   3e-08
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    58   3e-08
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    59   3e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    59   3e-08
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    59   3e-08
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    59   3e-08
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    59   3e-08
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    59   3e-08
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    59   4e-08
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    59   4e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    59   4e-08
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    59   4e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    59   4e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    59   4e-08
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    59   4e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   4e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    59   4e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    57   4e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    59   4e-08
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    58   4e-08
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    59   5e-08
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    57   5e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    59   5e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    57   5e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    58   5e-08
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    58   5e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    58   5e-08
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    58   6e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    58   6e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    57   6e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    58   6e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   6e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    59   6e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    58   6e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    58   6e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               58   6e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    58   6e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    58   6e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    58   6e-08
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    58   6e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   6e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    57   6e-08
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    58   6e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    57   6e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    57   7e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    58   7e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              58   7e-08
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    58   7e-08
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    58   7e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    57   7e-08
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    58   7e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    58   7e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    58   7e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    57   7e-08
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    58   7e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    58   8e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    57   8e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   8e-08
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    57   8e-08
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    57   8e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    58   8e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       58   8e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    57   8e-08
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    57   8e-08
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    57   9e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    57   9e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   9e-08
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    57   9e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    57   9e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    57   9e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    58   9e-08
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    56   9e-08
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    57   9e-08
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    57   9e-08
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    57   9e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    57   9e-08
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    57   1e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    57   1e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    57   1e-07
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    57   1e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    56   1e-07
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    57   1e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    57   1e-07
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    57   1e-07
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    57   1e-07
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     57   1e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     56   1e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    57   1e-07
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    57   1e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    57   1e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              57   1e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    57   1e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    56   1e-07
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    57   1e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    57   1e-07
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    57   1e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    57   1e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    57   1e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   1e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    57   1e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    56   1e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   1e-07
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    57   1e-07
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    57   1e-07
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    57   1e-07
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    56   1e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    56   1e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    57   1e-07
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    57   1e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    57   1e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    57   1e-07
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    57   1e-07
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    57   2e-07
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    57   2e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    57   2e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    57   2e-07
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    56   2e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    57   2e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    57   2e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    56   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    56   2e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    56   2e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    56   2e-07
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    56   2e-07
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    56   2e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    56   2e-07
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    57   2e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    57   2e-07
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    57   2e-07
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    56   2e-07
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    56   2e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    56   2e-07
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     56   2e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    56   2e-07
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    56   2e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    56   2e-07
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    56   2e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    56   2e-07
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    56   2e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    55   2e-07
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    56   2e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    56   3e-07
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    56   3e-07
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    56   3e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    56   3e-07
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    56   3e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    55   3e-07
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    56   3e-07
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    56   3e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    55   3e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    55   3e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    55   3e-07
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    56   3e-07
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    56   3e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    56   3e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    55   3e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    56   3e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    55   3e-07
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    55   3e-07
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    54   3e-07
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    55   3e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   3e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    55   3e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    55   4e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    55   4e-07
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    54   4e-07
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    55   4e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    55   4e-07
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    56   4e-07
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    55   4e-07
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    55   4e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    55   4e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    55   4e-07
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    55   4e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   4e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    55   4e-07
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    54   4e-07
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    55   4e-07
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    55   4e-07
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    55   4e-07
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       55   4e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    55   4e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    55   5e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    55   5e-07
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    55   5e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   5e-07
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    55   5e-07
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    55   5e-07
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    54   5e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    55   5e-07
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    55   5e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    54   5e-07
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    54   5e-07
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    55   5e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    55   6e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   6e-07
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    55   6e-07
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    55   6e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    55   6e-07
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    55   6e-07
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    55   6e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    55   6e-07
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    54   6e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    55   6e-07
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    54   6e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   6e-07
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    55   6e-07
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    54   6e-07
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    55   7e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    54   7e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    55   7e-07
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    55   7e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    55   7e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     54   7e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    54   7e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    54   7e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    55   7e-07
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    54   8e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   8e-07
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    54   8e-07
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    54   8e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    54   8e-07
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    55   8e-07
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    54   9e-07
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    54   9e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    54   9e-07
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    54   9e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    54   9e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               54   9e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    54   9e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    54   9e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    54   9e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    54   9e-07
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    54   9e-07
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    54   9e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    54   1e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    54   1e-06
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    54   1e-06
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    54   1e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    54   1e-06
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    53   1e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    54   1e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    53   1e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    53   1e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    54   1e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    54   1e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    54   1e-06
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    54   1e-06
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    54   1e-06
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    54   1e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    54   1e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    54   1e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    53   1e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    54   1e-06
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    53   1e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    54   1e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    54   1e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   1e-06
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    53   1e-06
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    54   1e-06
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    53   1e-06
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    52   1e-06
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    54   1e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    53   1e-06
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    54   1e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   1e-06
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    54   2e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    52   2e-06
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    54   2e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    54   2e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    53   2e-06
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    53   2e-06
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    53   2e-06
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    53   2e-06
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    53   2e-06
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    53   2e-06
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    53   2e-06
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    53   2e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    53   2e-06
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    54   2e-06
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    54   2e-06
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    54   2e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    53   2e-06
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    54   2e-06
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    52   2e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    53   2e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    54   2e-06
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    53   2e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    53   2e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    53   2e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    53   2e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   2e-06
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    53   2e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    53   2e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    53   2e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    53   2e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    53   2e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    53   2e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    53   2e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    53   2e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    53   2e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    53   2e-06
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    53   2e-06
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    53   2e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    53   2e-06
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    53   3e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    53   3e-06
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    52   3e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    53   3e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    53   3e-06
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    53   3e-06
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    52   3e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   3e-06
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    53   3e-06
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    52   3e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    52   3e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    53   3e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    53   3e-06
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    52   3e-06
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    52   3e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    53   3e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     52   3e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    52   3e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    52   3e-06
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    53   3e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    52   3e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    52   3e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   3e-06
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    52   3e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    52   3e-06
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      53   3e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   3e-06
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    52   3e-06
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    52   3e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    52   3e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    53   3e-06
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    52   3e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    52   3e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   3e-06
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    52   4e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    52   4e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   4e-06
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    51   4e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    52   4e-06
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    52   4e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   4e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    52   4e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    52   4e-06
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    52   4e-06
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    52   4e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    52   4e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    52   4e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    52   4e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    51   4e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    52   4e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    51   4e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    52   5e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    52   5e-06
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    51   5e-06
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    52   5e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              52   5e-06
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    52   5e-06
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    51   5e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    52   5e-06
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    52   5e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    51   5e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   5e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    52   5e-06
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    51   5e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    52   5e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    51   5e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    51   6e-06
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    51   6e-06
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               52   6e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    52   6e-06
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    51   6e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               52   6e-06
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    52   6e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    52   6e-06
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    50   6e-06
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    52   6e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     52   6e-06
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    51   6e-06
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    51   7e-06
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    52   7e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    51   7e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    52   7e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    51   7e-06
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    51   7e-06
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    52   7e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    51   7e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    51   7e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    52   7e-06
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    51   7e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   7e-06
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    51   7e-06
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    51   7e-06
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    51   7e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    50   8e-06
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    51   8e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    50   8e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    51   8e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    51   8e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    51   8e-06
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    50   8e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    50   8e-06
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    51   8e-06
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    50   8e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    51   9e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              51   9e-06
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    50   9e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    50   9e-06
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    50   9e-06
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    51   9e-06
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    51   9e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    51   9e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    51   1e-05
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    50   1e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    51   1e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    51   1e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    51   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    51   1e-05
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    51   1e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    50   1e-05
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    51   1e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   1e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    50   1e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    50   1e-05
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    50   1e-05
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              50   1e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    51   1e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    50   1e-05
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    51   1e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    51   1e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    50   1e-05
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    50   1e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    50   1e-05
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    50   1e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    50   1e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    50   1e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    50   1e-05
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    50   1e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    50   1e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    50   1e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   1e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    50   1e-05
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    50   1e-05
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    50   1e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             50   1e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    50   1e-05
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    50   1e-05
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    50   1e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    50   1e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   1e-05
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    50   1e-05
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    50   1e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       50   1e-05
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    50   1e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   1e-05
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    50   1e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    50   1e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    50   1e-05
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    50   2e-05
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    50   2e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    50   2e-05
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    50   2e-05
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    50   2e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    50   2e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    50   2e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    50   2e-05
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    49   2e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    50   2e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    50   2e-05
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    50   2e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    50   2e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    50   2e-05
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    50   2e-05
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    50   2e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    50   2e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    50   2e-05
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    50   2e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    50   2e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    50   2e-05
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    49   2e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    50   2e-05
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    50   2e-05
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    49   2e-05
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    49   2e-05
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    50   2e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    50   2e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    50   2e-05
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    50   2e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    50   2e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    50   2e-05
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     49   2e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    49   2e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    50   2e-05
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    49   2e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   2e-05
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    49   2e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    50   2e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    50   2e-05
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    50   2e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    50   2e-05
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    49   2e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    49   2e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    50   3e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    49   3e-05
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    49   3e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    50   3e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   3e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   3e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    49   3e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    49   3e-05
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    49   3e-05
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               49   3e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   3e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    50   3e-05
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               49   3e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    49   3e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    49   3e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    49   3e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   3e-05
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    49   3e-05
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    49   3e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    49   3e-05
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    49   3e-05
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    49   3e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    49   3e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    49   3e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    49   3e-05
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    49   3e-05
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    49   3e-05
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    49   3e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    49   3e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    49   3e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    49   3e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    49   3e-05
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    49   3e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    49   3e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    49   3e-05
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    49   3e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    48   3e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    48   3e-05
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    49   3e-05
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    49   3e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    49   3e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    49   3e-05
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    49   3e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   3e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    49   3e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    49   3e-05
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    49   4e-05
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    49   4e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    49   4e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   4e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    49   4e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              49   4e-05
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    48   4e-05
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    49   4e-05
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    49   4e-05
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    49   4e-05
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    49   4e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    49   4e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   4e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    49   4e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    49   4e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    49   4e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    49   4e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               49   4e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    48   4e-05
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    49   4e-05
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    49   4e-05
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    48   4e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    49   4e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    48   5e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    48   5e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    49   5e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    49   5e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     48   5e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    49   5e-05
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    49   5e-05
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    48   5e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    49   5e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    48   5e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    48   5e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   5e-05
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    48   5e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    49   5e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   5e-05
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    48   5e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    49   5e-05
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    48   5e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    48   5e-05
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    48   6e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    48   6e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    48   6e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               49   6e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    49   6e-05
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    49   6e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    47   6e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    48   6e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    47   6e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    48   6e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    48   6e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    49   6e-05
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    48   6e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    49   6e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   6e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    48   6e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    48   6e-05
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    48   6e-05
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    48   7e-05
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    48   7e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    48   7e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    48   7e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    48   7e-05
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    48   7e-05
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    48   7e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    48   7e-05
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    47   7e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    48   7e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    48   7e-05
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    48   7e-05
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    48   7e-05
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    48   7e-05
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    47   7e-05
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    48   7e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    48   7e-05
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    48   7e-05
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    48   8e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    47   8e-05
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    48   8e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    48   8e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    48   8e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    48   8e-05
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    48   8e-05
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    48   8e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    48   8e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    47   8e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    48   8e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    47   8e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    48   9e-05
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    48   9e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    48   9e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    48   9e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    48   9e-05
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    48   9e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    48   9e-05
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    47   9e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    48   9e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    48   9e-05
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    47   9e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   9e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   1e-04
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    48   1e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    47   1e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    48   1e-04
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    47   1e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    48   1e-04
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    47   1e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    47   1e-04
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    47   1e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   1e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    47   1e-04
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    47   1e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    47   1e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    48   1e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    47   1e-04
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    47   1e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    48   1e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    47   1e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    47   1e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    47   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    47   1e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    47   1e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    47   1e-04
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    47   1e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    47   1e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   1e-04
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    47   1e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    47   1e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    47   1e-04
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    47   1e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    47   1e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    47   1e-04
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     47   1e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   1e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    47   1e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    47   1e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    47   2e-04
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    47   2e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    47   2e-04
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    47   2e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    47   2e-04
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    47   2e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    47   2e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   2e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    47   2e-04
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    47   2e-04
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    47   2e-04
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    47   2e-04
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    47   2e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    47   2e-04
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    47   2e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    47   2e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    47   2e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    47   2e-04
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    47   2e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    47   2e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    47   2e-04
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    44   2e-04
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    46   2e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    47   2e-04
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    47   2e-04
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    46   2e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    47   2e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    46   2e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   2e-04
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    47   2e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   2e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    46   2e-04
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    46   2e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    46   2e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    46   2e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    47   2e-04
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    46   2e-04
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    46   2e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    46   3e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    46   3e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    46   3e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    46   3e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    46   3e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    46   3e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    46   3e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   3e-04
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    46   3e-04
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    46   3e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    46   3e-04
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    46   3e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    46   3e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     46   3e-04
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    46   3e-04
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    46   3e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    46   3e-04
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               46   3e-04
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    46   3e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    46   3e-04
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    46   3e-04
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    45   4e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    46   4e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    46   4e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    46   4e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    45   4e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    45   4e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    45   4e-04
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    45   4e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    45   4e-04
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    46   4e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    46   4e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    46   4e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    45   4e-04
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    45   4e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    45   4e-04
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    45   4e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    45   4e-04
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    45   4e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    45   4e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    45   4e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    45   4e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    45   5e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    46   5e-04
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    45   5e-04
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    45   5e-04
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    45   5e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    45   5e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    45   5e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    45   5e-04
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    45   5e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    45   5e-04
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    45   5e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    45   5e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    45   6e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    45   6e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    45   6e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    45   6e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   6e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   6e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    45   6e-04
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    45   6e-04
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    45   7e-04
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    45   7e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    45   7e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    45   7e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    44   7e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    45   7e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    45   7e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    45   7e-04
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    45   7e-04
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    45   8e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    45   8e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    45   8e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    44   8e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    44   8e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    45   8e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   8e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    45   9e-04
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    44   9e-04
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    44   9e-04
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    44   9e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    45   0.001
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    45   0.001
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    44   0.001
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    44   0.001
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    44   0.001
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     44   0.001
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    44   0.001
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    44   0.001
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    44   0.001
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    44   0.001
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    44   0.001
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    44   0.001
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    44   0.001
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    44   0.001
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    44   0.001
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    44   0.001
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    44   0.001
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    44   0.001
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    43   0.001
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    44   0.001
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    44   0.001
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    44   0.002
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    44   0.002
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    44   0.002
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    44   0.002
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    44   0.002
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    44   0.002
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    44   0.002
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    44   0.002
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     43   0.002
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.002
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    43   0.002
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    43   0.002
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.002
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    44   0.002
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    43   0.002
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    44   0.002
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    43   0.002
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    43   0.002
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    44   0.002
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    43   0.002
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    43   0.002
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    43   0.002
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    43   0.002
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    43   0.002
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      43   0.003
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    43   0.003
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    43   0.003
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    43   0.003
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    43   0.003
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    42   0.003
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    43   0.003
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    42   0.003
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    43   0.003
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    43   0.003
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.003
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.003
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    43   0.003
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    43   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    42   0.004
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    42   0.004
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    42   0.004
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    42   0.004
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    42   0.004
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    42   0.004
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    42   0.004
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    42   0.004
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    42   0.004
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    42   0.005
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    42   0.005
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    42   0.005
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.005
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    42   0.005
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    41   0.005
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    42   0.005
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    42   0.005
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    42   0.005
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      42   0.005
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    42   0.005
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    42   0.006
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    42   0.006
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.006
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    42   0.006
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    42   0.006
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    42   0.006
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    42   0.006
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    42   0.006
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    42   0.006
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    42   0.006
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    41   0.006
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    42   0.006
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    41   0.007
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    41   0.007
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    42   0.007
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    42   0.007
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    41   0.007
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    42   0.007
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.007
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    42   0.007
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.007
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    41   0.007
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.007
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    41   0.007
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    41   0.007
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    41   0.008
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.008
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    41   0.008
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    41   0.008
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    41   0.008
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    41   0.009
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    41   0.009
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    41   0.009
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    41   0.009
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    41   0.009
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    41   0.009
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    41   0.009
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    41   0.009
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    41   0.010
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    41   0.010
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    41   0.010
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    41   0.011
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.011
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    41   0.011
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    41   0.012
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    41   0.013
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    40   0.013
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    40   0.014
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.014
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.014
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    41   0.015
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    40   0.016
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    40   0.016
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    40   0.017
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    40   0.017
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    40   0.017
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    40   0.018
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    40   0.019
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    40   0.020
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    40   0.020
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    40   0.021
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    40   0.021
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    40   0.022
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    40   0.022
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    40   0.022
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.023
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    40   0.024
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    39   0.027
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    40   0.027
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    40   0.029
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    40   0.029
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    39   0.030
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    39   0.030
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    39   0.032
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    39   0.032
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    39   0.032
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    39   0.034
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.034
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    39   0.035
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    39   0.037
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    39   0.040
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    39   0.040
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.040
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    39   0.042
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    39   0.042
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    39   0.042
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    39   0.043
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    39   0.043
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    39   0.044
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.047
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    39   0.050
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    39   0.050
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    39   0.051
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    39   0.052
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    39   0.053
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    39   0.054
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    39   0.055
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.058
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    38   0.066
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    38   0.069
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    38   0.071
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    38   0.071
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    38   0.072
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    38   0.072
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    38   0.073
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    39   0.074
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    38   0.089
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    38   0.089
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    38   0.090
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    38   0.094
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    38   0.094
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    38   0.095
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    37   0.10 
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    38   0.10 
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    37   0.11 
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    38   0.11 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    38   0.11 
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    37   0.11 
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    37   0.12 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    37   0.12 
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    37   0.13 
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    37   0.13 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    37   0.13 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    37   0.13 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    37   0.14 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.14 
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    37   0.14 
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    37   0.14 
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    37   0.15 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    37   0.15 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    37   0.15 
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    37   0.15 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    37   0.16 
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    37   0.16 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    37   0.17 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    37   0.17 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.17 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    37   0.18 
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    37   0.18 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    37   0.18 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    37   0.20 
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    37   0.20 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    37   0.24 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    36   0.26 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    36   0.27 
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    36   0.28 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    36   0.29 
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    36   0.30 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    36   0.31 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    36   0.31 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.34 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    36   0.35 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    36   0.35 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    35   0.38 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    35   0.38 
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    36   0.38 
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    35   0.39 
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    36   0.39 
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    36   0.41 
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    36   0.42 
Ecym_4638 Chr4 complement(1244596..1247985) [3390 bp, 1129 aa] {...    36   0.42 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    36   0.42 
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               35   0.43 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    36   0.45 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    35   0.46 
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    35   0.47 
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    35   0.55 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    35   0.56 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    35   0.60 
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    35   0.64 
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    35   0.68 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               35   0.71 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    35   0.72 
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    35   0.74 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    35   0.76 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    35   0.80 
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    35   0.84 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    35   0.95 
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    35   0.97 
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    34   1.0  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    34   1.0  
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    34   1.1  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    34   1.1  
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    34   1.1  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    34   1.2  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             34   1.2  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    34   1.2  
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    34   1.4  
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    34   1.4  
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    34   1.6  
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    33   1.8  
KAFR0D04790 Chr4 (941767..942261) [495 bp, 164 aa] {ON} Anc_5.37...    32   1.9  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   1.9  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   2.0  
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    33   2.2  
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    33   2.4  
Kwal_56.23939 s56 (788304..790319) [2016 bp, 671 aa] {ON} YGL083...    33   2.5  
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    33   2.5  
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    33   2.8  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    33   2.9  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    33   3.1  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    33   3.4  
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    33   3.8  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    32   3.9  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    32   4.2  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   4.6  
KLLA0D13398g Chr4 (1153371..1157345) [3975 bp, 1324 aa] {ON} som...    32   5.7  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    32   6.9  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    32   7.6  
KLTH0G03894g Chr7 (310030..311811) [1782 bp, 593 aa] {ON} simila...    32   7.6  
NDAI0G03520 Chr7 complement(844269..848915) [4647 bp, 1548 aa] {...    32   7.7  
KLLA0F18194g Chr6 (1668282..1670981) [2700 bp, 899 aa] {ON} high...    32   7.9  
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    32   8.5  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    31   9.5  

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score = 1371 bits (3549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/704 (95%), Positives = 669/704 (95%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
           GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV
Sbjct: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360

Query: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP 420
           GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP
Sbjct: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP 420

Query: 421 FNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSETQTSDAGSITTSKPY 480
           FNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSETQTSDAGSITTSKPY
Sbjct: 421 FNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSETQTSDAGSITTSKPY 480

Query: 481 LHPSAVSSTRSLPAQNADHDSRPRSSSLDFKSAARKKPADEEILENLIALSNRRDDPNKR 540
           LHPSAVSSTRSLPAQNADHDSRPRSSSLDFKSAARKKPADEEILENLIALSNRRDDPNKR
Sbjct: 481 LHPSAVSSTRSLPAQNADHDSRPRSSSLDFKSAARKKPADEEILENLIALSNRRDDPNKR 540

Query: 541 XXXXXXXXXPIGQRSPTGGANVPTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNK 600
                    PIGQRSPTGGANVPTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNK
Sbjct: 541 NSFNSFNSSPIGQRSPTGGANVPTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNK 600

Query: 601 STSEIVNIRTTTSSFSENGLRKTTSNVENGKSTTRSIKTPSSVNGXXXXXXXXXXXXXXX 660
           STSEIVNIRTTTSSFSENGLRKTTSNVENGKSTTRSIKTPSSVNG               
Sbjct: 601 STSEIVNIRTTTSSFSENGLRKTTSNVENGKSTTRSIKTPSSVNGKSESKSKPPPPPPKP 660

Query: 661 XXXXXXXXXXXAFLSGKRKEPEVLLNEVKDAVMDSNVDTIETDV 704
                      AFLSGKRKEPEVLLNEVKDAVMDSNVDTIETDV
Sbjct: 661 EHLRPKKPPKPAFLSGKRKEPEVLLNEVKDAVMDSNVDTIETDV 704

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/725 (47%), Positives = 429/725 (59%), Gaps = 93/725 (12%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN PEIP Y PGTVL+VG+HHAK++ Y+ SGGFAQVYSAE+ PAD    +N  CLKRVI+
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +KHVV YIDSHAA+S   NG+YEVFLLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL+E+EILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLIS  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP+NPQEFA+VQHD+LKNTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGG+ AILHSR+QF A PIYSDRLK LI  ML + P QRPN+CQVLE+VSRMQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
           G+  P+RNFYLLRAM+    ST                    + +   P  ++     PV
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQL----------------RYSRTQPVLNVPIISQPV 344

Query: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILPP 420
           G    PM  ++    G ST            +VP+   P   A P   GS         P
Sbjct: 345 GF---PMHQISGAPLGSSTS----------HIVPSNSVPILAARPRSAGSNGTGRSFQTP 391

Query: 421 ------------FNRASTLP--TDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSET 466
                       F+RA++    +   ST P + G    S +     T  DRP  YVDS T
Sbjct: 392 STSSLSAKSSQTFHRAASRSPVSTHLSTSPVRHGRGNISQIVESNRTSFDRP-RYVDSVT 450

Query: 467 QTSDAGSITTSKPYLHPSAVSSTRSLPAQN----ADHDSRPRSSSLDFKSAARKKPADEE 522
           QTSD    T  +P     A  S+ SLPA+     AD  S  RSSSL  KS + ++PA   
Sbjct: 451 QTSD----TEEEPL--KVASKSSVSLPARESHAVADKSSVVRSSSLRSKSTSSERPA--- 501

Query: 523 ILENLIALSNRRDDPNKRXXXXXXXXXPIGQRSPTGGANVPTTPDSLARIKSNPDTKESI 582
                +A   +   P+ +         P G++S    + +      L  ++S  + KESI
Sbjct: 502 -----VAPKQQVAVPHTKLEHIYAAKIPTGRQSLRQESEIEI---PLTSVRSR-EAKESI 552

Query: 583 QKKVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKTTSNVENGKSTTRSIKTPSS 642
           Q++V+ LL ++ED P +KS  +    +    S + +  + +       K   R+   P+ 
Sbjct: 553 QRRVRDLLNSSEDLPLSKSEPKKDEPKRGQLSKTHHDEKPSVKEKSKQKVRPRAPPKPAH 612

Query: 643 VNGXXXXXXXXXXXXXXXXXXXXXXXXXXAFLSGKR---KEPEVLLNEVKDAVMDSNVDT 699
           +                            AFLSGK+    EP    +E   AV+D+ V++
Sbjct: 613 LR--------------------PKPPPKPAFLSGKKMVDTEP----SEAGKAVIDAKVES 648

Query: 700 IETDV 704
           +E D+
Sbjct: 649 LERDL 653

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  527 bits (1358), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 283/513 (55%), Positives = 340/513 (66%), Gaps = 32/513 (6%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I  Y PGT+L+VG+HHAKI+KY+ SGGFAQVY+AE+ P D  +  N  CLKRVI+
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNG-TYEVFLLMEFCTAGGLID 119
           P K GLN LRAEV+AMKLL+ +KHVV YIDSHAARS+  NG  YEVF+LMEFC  GGLID
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           FMNTRLQNRL+E EIL IMSQ  QGI AMHALQPPLIHRDIKIENVLIS DG YKVCDFG
Sbjct: 119 FMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
           SVSG IRPPRN QEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           CYYTTPFEK G+  ILH+RYQ+ + P YSDRLKNLI  ML + P QRPNICQVLEEVSR+
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGA--NG 357
           Q    P+RNFYLLRAM   N +T     P S     T   P  +  P+   QS+    N 
Sbjct: 299 QNKPCPIRNFYLLRAMNQ-NANTQLAGEPSS-----TTYVPTQKFIPVQSLQSINQPPNM 352

Query: 358 MP---VGVTPQ----PMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGS 410
           MP   V  TP     P+ I    ++ ++    +  G+ + +       P      VP+  
Sbjct: 353 MPVTHVSTTPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLT-----SPLMKTKSVPLSD 407

Query: 411 Q--DMSSGILPPFNRASTLPTDGFSTGPGKDGG---VITSAVNTGPETIK--DRPFNYVD 463
           +   +    L PF ++ T  +      P +       +T   N   + +   +RP NYVD
Sbjct: 408 EFASLYYKELHPFQKSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRVSAINRPNNYVD 467

Query: 464 SETQTSDAGSITTSK--PYLHPSAVSSTRSLPA 494
           SETQT D  ++   K  P +   ++SST+ + A
Sbjct: 468 SETQTIDNMAVPNLKLSPTITSKSLSSTKEIAA 500

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 11/145 (7%)

Query: 566 PDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTS---EIVNIRTTTSSFSENGLRK 622
           PD+   +  N + KESIQ++V +LLK+++D    KS S   +  +I T TS+   + +R 
Sbjct: 661 PDN-GNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSN-RHSSVRI 718

Query: 623 TTSNVENGKSTTR----SIKTPSSVNGXXXXXXXXXXXXXXXXXXXXXXXXXXAFLSGKR 678
           T    E  K T +     IKT S  NG                          + L  K+
Sbjct: 719 TPITEEKFKKTLKDGVLDIKTKS--NGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKK 776

Query: 679 KEPEVLLNEVKDAVMDSNVDTIETD 703
              E + +E  + ++D NVD +E D
Sbjct: 777 LPIERISSEATETIVDVNVDDLEAD 801

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/469 (55%), Positives = 325/469 (69%), Gaps = 34/469 (7%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P IPTY PGT+L+VG+H+ KI+KY+ SGGFAQ+Y+ E+ P +    +   CLKRVI+
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+KAGLN LRAEV+AMKLLK ++HVV YIDSHAARS +  G YEVFLLME+C  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E EILNI+SQ  QG++AMHALQP LIHRDIKIENVLISA GE+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V   IRPPRNPQE A+VQHD+LKNTTAQYR+PEM+DLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGG+ AILHSRYQ+ A PIY+D+LKNLI   L + P +RPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
           G+  P+ NFYL R +   N   S + P ++          P Q   L  +QS        
Sbjct: 301 GIPCPINNFYLSRTI---NVQASLMNPIIT----------PTQQTALKHSQSSAT----- 342

Query: 361 GVTPQPMPI-MAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSGILP 419
            ++ Q   + +A +RS  +TG         P+++ T++        +  GS D+ S I  
Sbjct: 343 -ISDQSYAVPLASSRSSTTTGN-------KPILIETEI------PDMSQGSDDVYSRI-H 387

Query: 420 PFNRASTLPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDSETQT 468
           PF ++ TL T   S+ P K  G +     +          +YVDSETQT
Sbjct: 388 PFQKSQTLRTPSRSSSPIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQT 436

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  522 bits (1344), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 285/500 (57%), Positives = 337/500 (67%), Gaps = 40/500 (8%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I  Y PGT+L+VG+HHAKI+KY+ SGGFAQVYSAE+ P D  +  N  CLKRVI+
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT-YEVFLLMEFCTAGGLID 119
           P+K GLN LRAEV+AMKLLK +KHVV YIDSHAA+S+  NG  YEVF+LME+C  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEYCERGGLID 118

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           FMNTRL+NRL+E EIL+IM Q  QGIAAMHALQPPLIHRDIKIENVLIS +G YKVCDFG
Sbjct: 119 FMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFG 178

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
           SVSG IRPP+NPQEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           CYYTTPFEK G+ AILH+RYQ+ + P YSDRLKNLI  ML + P QRPNICQVLEEVSR+
Sbjct: 239 CYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRL 298

Query: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMP 359
           Q    P+RNFYLLRAM   N +  F +   SM  T      PAQ   L   QS       
Sbjct: 299 QNRPCPIRNFYLLRAM---NQNAQFGSESTSMTYT------PAQ--QLVSPQSF----QN 343

Query: 360 VGVTPQPMPIM-AKTRSGISTGGNIFPGAANPMVVPTQLGPAQV-AGP-----------V 406
           +   P  +P+   KT   + +  N F    N M    QL   ++  GP           V
Sbjct: 344 IQAMPNIVPLSNIKTTPNLDSASN-FVNNNNKMEAMLQLRTQKLETGPNFSIPLTKTKSV 402

Query: 407 PMGSQDMSSGI---LPPFNRASTLPTDGFSTGPGKDGGVIT----SAVNTGPETIKDRPF 459
           P+ S D +S     L PF +  T  +   S  P +     +    ++ N    +  +RP 
Sbjct: 403 PL-SDDFTSLYYKELHPFQKPHTFKSVEGSQSPQRKSIPFSPTPVNSNNYDRVSTINRPN 461

Query: 460 NYVDSETQTSDAGSITTSKP 479
           NYVDSETQT D+ +    KP
Sbjct: 462 NYVDSETQTLDSIATLKLKP 481

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  520 bits (1339), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 282/486 (58%), Positives = 328/486 (67%), Gaps = 28/486 (5%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I  Y PGTVL+VG+HHAKI+KY+ SGGFAQVY+AE+ P D  +  N  CLKRVI+
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNG-TYEVFLLMEFCTAGGLID 119
           P+K GLN LRAEV+AMKLLK +KHVV YIDSHAA+S+  NG  YEVF+LMEFC  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           FMNTRLQ+RL+E EIL IMSQ  QGIAAMH LQPPLIHRDIKIENVLIS DG YKVCDFG
Sbjct: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
           SVSG IRPPRN QEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238

Query: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           CYYTTPFEK G+ AILHSRYQ+ + P YSDRLK LI  ML + P QRPNICQVLEEVSR+
Sbjct: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298

Query: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQ-VAPLTPAQSLGANGM 358
           Q    P+RNFYLLRAM   N   +   P V+ V+    +  PAQ +  +   QS+    +
Sbjct: 299 QNEPCPIRNFYLLRAMGQ-NAQLASEPPSVTYVSAQQLL--PAQTLQGIKHLQSM----V 351

Query: 359 PVG---VTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSS 415
           PV     TP  +  + K  +  +   +I P    P        P      VP+ S D +S
Sbjct: 352 PVTHVRTTPN-LGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPL-SDDFAS 409

Query: 416 GI---LPPFNRASTL--------PTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYVDS 464
                L PF ++ T         P    ST P     V +   +    +  DRP NYVDS
Sbjct: 410 LYYRELHPFQKSQTFKSVESFQSPQRKLST-PSSSSPVNSKNNDRASTSTVDRPNNYVDS 468

Query: 465 ETQTSD 470
            TQT D
Sbjct: 469 VTQTID 474

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  517 bits (1332), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 291/514 (56%), Positives = 346/514 (67%), Gaps = 36/514 (7%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I  Y PGT+L+VG+HHAKI+KY+ SGGFAQVY+AE+ P D  T  N  CLKRVI+
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT-YEVFLLMEFCTAGGLID 119
           P+K GLN LRAEV+AMKLLK +KHVV YIDSHAA+S+  NG  YEVF+LMEFC  GGLID
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGVAYEVFVLMEFCERGGLID 118

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           FMNTRLQNRL+E EIL IMSQ  QGIAAMHALQPPLIHRDIKIENVLIS +G YKVCDFG
Sbjct: 119 FMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFG 178

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
           SVSG IRPPRN QEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALGIFLYK+
Sbjct: 179 SVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKI 238

Query: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           CYYTTPFEK G+  ILH+RYQ+   P YSDRLKNLI  ML + P +RPNICQVLEEVSR+
Sbjct: 239 CYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRL 298

Query: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQ-VAPLTPAQSLGANGM 358
           Q    P+RNFYLLRAM  T    S   P +  V T  F+  PAQ +  + P     +N +
Sbjct: 299 QIKPCPIRNFYLLRAMSQTAQLASE-PPSMKYVPTQKFL--PAQGLQSMKPI----SNMI 351

Query: 359 PVG---VTPQ----PMPIMAKTRSGISTGGNI-FPGAANPMVVPTQLGPAQVAGPVPMGS 410
           PV     TP     P  I     + ++   ++ F G +N   V T   P +    VP+ S
Sbjct: 352 PVSHVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSN---VDT---PLKKTKSVPL-S 404

Query: 411 QDMSSGI---LPPFNRASTLPTDGFSTGPGKDGGVITS-----AVNTGPETIKDRPFNYV 462
            D +S     L PF ++ T  +      P +     +S     ++        +RP NYV
Sbjct: 405 DDFASLYYRELHPFQKSQTFKSVENFQSPQRRSMPPSSLPPANSIILDKTPTMNRPNNYV 464

Query: 463 DSETQTSDAGSITTSK--PYLHPSAVSSTRSLPA 494
           DSETQT+D  +++ SK  P L    V+S +   A
Sbjct: 465 DSETQTTDIITMSGSKLSPALTNKPVNSQKEFIA 498

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 563 PTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTS 603
           P T   +  I  N + KESIQ++V +LLK++ED    KS S
Sbjct: 655 PITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSAS 695

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  512 bits (1318), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 272/492 (55%), Positives = 338/492 (68%), Gaps = 47/492 (9%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           M+ P + TY  GTVL+VG+H A+I+KY+ SGGFA +YSAE+ P D P  ++  CLKRV++
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPD-PNSSSIACLKRVLV 59

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN+LRAEV+AMKLLK  K VV YIDSHAA+S L NG+YEVFLLME+C  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRLKE+E+L IMSQV+QG+AAMHALQPPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP+NPQE  +VQHDILKNTTAQYRSPEMIDLYR   +DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILHS++QF A+P YSD+LKNLIS +L + PMQRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQS---LGANG 357
           GV  P++NFYL R M                           Q+ PL  + S   + A  
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQ-----------------QQQLQPLRHSVSQPQMEAIT 342

Query: 358 MPVGVTPQPMPIMAKTR-SGISTGGNIFPGAANPMVVP-TQLGPAQVAGPVPMGSQDMSS 415
           +P+ + P P  ++A  + S  +TG    P A   ++   +Q  PA+     P  + D  S
Sbjct: 343 LPITLQPHPQKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARND---PFLNLD-KS 398

Query: 416 GILPP----------FNRA------STLP--TDGFSTGPGKDG-GVITSAVNTGPETIKD 456
            +LPP          +N+       +T P  T   S  P ++G G I+  + + P ++ D
Sbjct: 399 NLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSV-D 457

Query: 457 RPFNYVDSETQT 468
           R  +YVDSETQT
Sbjct: 458 RLSSYVDSETQT 469

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 23/31 (74%)

Query: 571 RIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601
           ++ +N +++ SIQK+V  LLK ++DSP  K+
Sbjct: 635 KMSANRESRNSIQKRVHDLLKNSQDSPVRKT 665

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  508 bits (1307), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/318 (72%), Positives = 267/318 (83%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+IPTY  G  L VG HHA ILKY+ SGG+AQVY A++ P D+ TG++ VCLKR+I+
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+KA LN  RAEV+AMKLL+   HVV YIDS+AA+S L NG YEV LLMEFC  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL+E+EILNIMSQVTQG+AAMH+L+PPL+HRDIKIENVLIS  GEYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP + QEF FVQHDILKNTTAQYR+PEMIDL R   IDEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILHSRY++LA+P YSD LKNLI  ML+ QP QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GVSSPMRNFYLLRAMQHT 318
           G+  P++NFYL RA+  +
Sbjct: 301 GIPCPIKNFYLERAIHRS 318

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  509 bits (1311), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 234/315 (74%), Positives = 268/315 (85%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P    YT GT L+VG+H A+I+KY+ SGGFA +YSAE+ PAD  +  N  CLKRV++
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+G+KHVV YIDSHAA+S  Q+G+YEVFLLME+C+AGGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E E+L IMS +TQGIAAMHAL PPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP+N QEF++VQ+DILKNTTAQYRSPEMIDLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK GD AILHSR+QF A+P YSDRLKNLIS MLS+ P QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GVSSPMRNFYLLRAM 315
            V  P+RNFYLLR+M
Sbjct: 301 NVPCPLRNFYLLRSM 315

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 24/31 (77%)

Query: 571 RIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601
           ++  + D + SIQK+VQ+LLK+++DSP  KS
Sbjct: 641 KLSGSSDARSSIQKRVQNLLKSSQDSPVKKS 671

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/313 (70%), Positives = 259/313 (82%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P I  Y PGT L+VG H   I+KY+ SGGFAQ+Y  ++ P +   G N  CLKRVI+
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           PEK+GLN LRAEV AM+LLKG  HVV YIDS+AARS+  +GTYEV  LMEFC  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRLKE+E+LNIM+QVTQGI AMH+L PPLIHRDIKIENVLIS++GEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSG IRPP+N +EF FVQ DI+KNTTAQYR PEM+DLYR Q I+EKSDIWALG+FLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFE GG++AILH+RYQ+  +P+YS RLKNLI  ML ++P QRPN+CQVLEEVS MQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GVSSPMRNFYLLR 313
           G+  P+ NFYL R
Sbjct: 301 GIPCPLPNFYLQR 313

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  494 bits (1272), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 265/315 (84%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN      Y PGT L+VG+H A+I+KY+ SGGFA +Y+AE+ PAD  +     CLKRV++
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+G++HVV YIDSHAA+S + +G+YEVFLLME+C+ GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL+E E+L I S +TQGIAAMHALQPPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP+NPQEF +VQHDILKNTTAQYR+PEMIDLYR   I+EKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILHSR+QF ++P YSD LK+LIS+MLS+ P QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GVSSPMRNFYLLRAM 315
           G   P+RNFY+ RAM
Sbjct: 301 GTPCPLRNFYVTRAM 315

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 553 QRSPTGGANVPTTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601
           Q+  TG  N   +  S  ++ +   ++ SIQK+VQ LLK ++DSP  K+
Sbjct: 619 QQDDTGAKNYYKS-HSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKT 666

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  493 bits (1270), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 260/503 (51%), Positives = 325/503 (64%), Gaps = 44/503 (8%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MNHP+I T+  G +L+VG+HHAK++KY+ SGG+AQVY  E+ P+D    +N  CLKRVI+
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLLK ++HVV YIDSHA++S + NG YEVF+LMEFC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MN+RLQ+RL E EIL IMS  +QGIAAMH LQP L+HRDIKIENVLIS + EYKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G +RPP+N QEF FV HDI+KNTTAQYRSPEM+DL +   I+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEK-GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           YYTTPFEK GG+ AIL +R+Q+ ++P+YSDRLKNLI  MLS+ P  RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPP------AQVAPLTPAQSL 353
           QG+  P+RNFYLLRAM++   +   I  PV  V   T ++ P      A +    P  +L
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRT---IEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAAL 357

Query: 354 GANGMPVGVTPQPMPIMAKTRS----------GIS-TGGNIFP--------------GAA 388
             N   +  T Q  P +  T++           IS     I P              G +
Sbjct: 358 KFNQTTIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTS 417

Query: 389 NPMVVPTQLGPAQVAGPVPMGSQ-DMSSG--ILPPFNRASTLPTDGFSTGPGKDGGVITS 445
           N  V+ T   P      +      D+S     +P  +    LP    S+ P K    I  
Sbjct: 418 NKNVIDTS-APDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSIND 476

Query: 446 AVNTGPETIKDRPFNYVDSETQT 468
             +     +  RP NYVD ETQT
Sbjct: 477 NYD-----VSKRPTNYVDEETQT 494

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  493 bits (1268), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 267/527 (50%), Positives = 332/527 (62%), Gaps = 61/527 (11%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I  Y  GT+L VG+H  K+LKY+ASGGFA VYS E+ P D     N  CLKRV++
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+KA LN LRAEV++MK L+G+K +V YIDSHA +S +  G YEV+LLME+C+ GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL+E+EILNIMSQV+QG+AAMHALQPPLIHRDIKIENVL+S + E+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSG IR PRN +EF +VQ+DI+KNTTAQYR PEMIDLYR   IDEKSDIWALG+FLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AIL S+++F A+P YSDR+KNLIS ML   P++RPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GVSSPMRNFYLLRAMQ-----------HTNTSTSFITPPVSMVNTNTFMAPPAQVAPL-T 348
           G+  P++NFYLLR M            H    T   T P S+   +T   PP  V+ + T
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSV---STQHLPPQVVSNVQT 357

Query: 349 PAQSLGANGMP-VGVTP-QPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPV 406
           P+++     +P + V+  QPM       S     G   P              +      
Sbjct: 358 PSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTV-----------SNYTSSD 406

Query: 407 PMGSQDMS-----SGILPPFNRASTLPTDGF----------------STGPGKDGGVITS 445
           P    D S     S  +    RA  +P   +                S  P ++G    S
Sbjct: 407 PFSKIDRSALLSTSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGAIS 466

Query: 446 AVNTGPETIKDRPFNYVDSETQTSDAGSITTSKPYLHPSAVSSTRSL 492
           ++     T  DRP  YVDSETQTSD           HPS +  +RSL
Sbjct: 467 SILASNRTSLDRP-KYVDSETQTSD-----------HPSELGLSRSL 501

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  489 bits (1258), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 225/322 (69%), Positives = 262/322 (81%), Gaps = 4/322 (1%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN PEIP YTPG +L VG+H AKILKY+ SGGFAQVY  E+ P D  +G+N  CLKRVI+
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSL----LQNGTYEVFLLMEFCTAGG 116
           P+K  LN  RAEV AMKLL+ +K+VV YIDSHAA+S     + NG+YEVFLLME+C+  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176
           LIDFMNTRLQNRLKE+EILNIMS V+QG+AAMHALQPPL+HRDIKIENVLIS   E+K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236
           DFGSV G IRPP N  E  FVQHDILKNTTAQYRSPEM+ L +   I+EKSDIWALG+FL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
           YK+CYYTTPFEK G+ AILHSRYQ+ A+P YSD LKNLI  ML   P +RPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRMQGVSSPMRNFYLLRAMQHT 318
           SR+QGV  P++NFYL RA++ T
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQT 322

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  489 bits (1259), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 248/437 (56%), Positives = 302/437 (69%), Gaps = 36/437 (8%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P IP Y  GT+L+VGTH A I KY+ SGGFAQ+Y+ E+ P DT + +N  CLKRVI+
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P K+GLN LRAEV+AMKLLK ++HVV YIDS+A +S   NG+YEV LLME+C  GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MN+RLQNRL E EILNI+SQ  QG+A MHALQP L+HRDIKIENVL S +GE+K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPPRN QE ++VQHDILKNTTAQYR PEM+DLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILHS++Q+ A PIYSDRLKNLI  MLS+ P +RPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
           GV  P++NFYL+RA Q  N         + +    T      ++A   P Q L A     
Sbjct: 301 GVPCPIQNFYLIRAQQLANQ--------IQLQRQTTV----PKIATAQPIQQLNART--- 345

Query: 361 GVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVP-----TQLGPAQVAGPVPMGSQDMSS 415
               Q MPI       I+T  N       P+ VP     T+L   ++   VP  S  +  
Sbjct: 346 ----QTMPI-------INTKANT--SLVTPITVPVLSENTRLPALELDIKVPQFSPSLDK 392

Query: 416 GI---LPPFNRASTLPT 429
            +   L PF ++ TL T
Sbjct: 393 DMYMKLHPFQKSGTLLT 409

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  486 bits (1252), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 232/363 (63%), Positives = 267/363 (73%), Gaps = 5/363 (1%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN PE+     GT L+VGTH  KILKY+ SGGFAQ+Y+ E+       G+N  CLKRV +
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL  +KHVV YIDSHA RS   +GTYEVFLLME+C  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQ TQGIA MHAL PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSG IRPPRN QE  +VQHDI+KNTTAQYR PEM+DLYR   IDEK+DIWALG+FLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILH+R+QF + P YSDRLKNLI  ML + P  RPN+CQVLEEVSRMQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSM-----VNTNTFMAPPAQVAPLTPAQSLGA 355
            V  P+RNFYLLRAM+    ST    P + +        +    P  +  P+    +   
Sbjct: 301 NVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKLRNAQADNLSNPMIKPMPIAQRPTFSG 360

Query: 356 NGM 358
           NGM
Sbjct: 361 NGM 363

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  469 bits (1208), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/317 (68%), Positives = 258/317 (81%), Gaps = 1/317 (0%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I TY PGT+L VG+H  +I+KYI SGGFAQ+Y+ E+ P D+   +N  CLKRVI+
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +KHVV YIDSHA++S   NG+YEVFLLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E E+L+I SQV QGIAAMHALQPPL+HRDIKIENVLIS   +YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSG IRPP NPQE  +VQHD+LKNTTAQYRSPEMID YR   IDEKSDIWA+G+FLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEK-GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
           YYTTPFEK GG+ AIL +RY++   PIYS+RLK+LI  ML + P QRPNI QV+EE+S+M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGVSSPMRNFYLLRAMQ 316
           Q V  P+ NFYL+   Q
Sbjct: 301 QNVPCPIVNFYLVTQQQ 317

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  479 bits (1232), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/634 (44%), Positives = 370/634 (58%), Gaps = 48/634 (7%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+IP Y PGT+L+VG+H  +++KY+ SGGFAQ+Y+ ++ P D  T TN  CLKRVI+
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+ MKLL+ + HVV YIDSHAA+     G+YEVFLLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQ RL+E EILNIMSQVTQGIAAMHAL PPL+HRDIKIENVL+++ GEYKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP N QE ++VQHDI+KNTTAQYR+PEMIDLYR   IDEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILH+ +QF  +P YSDRLK LI++ML +QP QRPN  QVLEEVS MQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
            V  P+ NFYL+    + N +   +       N    MA P  + P  P  +   N  P 
Sbjct: 301 NVQCPIPNFYLM----NNNVTQGQMAMQTQPQNNGAMMASP-NMQPYVPNNNFVYNT-PN 354

Query: 361 GVTPQPMPIMAKTRSGISTGGN---IFPGAANPMVVPTQLGPAQVAGPVPMGS---QDMS 414
            V+   + +M      +++  N   I P  A  M     + P Q +  +P+ S      +
Sbjct: 355 AVSMNDIQMMNAINLKVNSTHNTGMIPPTMATNMARTIPMQPVQKSQTLPVSSIPTNLQN 414

Query: 415 SGILPPFNRAST---LPTDGFSTGPGKDGGVITSAVNTGPETIKDRPFNYV--------- 462
           +    PFN  ST   + ++  +  P +      S+   G   I ++  N V         
Sbjct: 415 TNKSSPFNLKSTTTYVDSETQTETPKQTLNKAISSNTEGFSLINEKNPNSVPMLSPSFST 474

Query: 463 -DSETQTSDAGSITTSKPYLHPSAVSSTRS-LPAQNADHDSRPRS-------------SS 507
             S + + +  S+      L   A S  R+ L +Q  D+D R +              +S
Sbjct: 475 SSSSSSSDENDSVD-----LRNKAYSPIRTPLKSQLQDNDERIKKVIQVAKEGLSRSRTS 529

Query: 508 LDFKSAARKKPADEEILENLIALSNRRDDPNKRXXXXXXXXXPIGQRSPTGGANVPTTPD 567
           L+ +   +K+  ++     L      R  P            PI  +S    A     P 
Sbjct: 530 LESEPTFKKEKKNKVYNATLEKAKKHRSLPVMETTIKPDSTKPIASKSEISFAE----PA 585

Query: 568 SLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKS 601
             +  KSN +TK  I++K+   L A+++  K KS
Sbjct: 586 VKSNSKSNEETKILIKQKMLEKLNASQNQFKKKS 619

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  475 bits (1222), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 251/486 (51%), Positives = 321/486 (66%), Gaps = 29/486 (5%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN     ++ PGTVL+VG+H  K++KY+ SGGFAQ+Y  E+   D+    +  CLKRV +
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+G+KH+V YIDSHA++S+L NG+YEV LLME+C+ GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQ+RLKE+E+L IM+QV QGI AMHALQPPLIHRDIKIENVLI+ +G+ KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP+N  E ++VQHDILKNTTAQYR+PEMIDLYR  ++DEKSDIWALG+FLYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AIL + +QF ++P YS+RLKNLI+ ML++ P+ RPN CQVLEEV R+Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPV 360
           G   P++NFYL R+++    S    +    M+  N   A    V P      L +N M +
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNM 359

Query: 361 GVT-------PQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQD- 412
           G          QP  +   T   +S             ++ T     +    VP  + + 
Sbjct: 360 GYVTGAFQPASQPNEVRGDTALRVSKAK----------LLSTACDWDKTQNFVPGSNYNS 409

Query: 413 ---MSSGILPPFNRASTLPTDGFSTGPGKDG-GVITSAVNTGPETIKDRPFNYVDSETQT 468
              + SG LP     S+LPT   S  P + G G I   +   P  IK RP  YVDSE QT
Sbjct: 410 KASVESGHLP----TSSLPTPRSSVSPVRSGRGNINKIIAANPINIK-RPV-YVDSEMQT 463

Query: 469 SDAGSI 474
           +D  S+
Sbjct: 464 TDLASL 469

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  471 bits (1212), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 257/495 (51%), Positives = 318/495 (64%), Gaps = 38/495 (7%)

Query: 11  PGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALR 70
           PG +L+VG+H  KI++Y+ SGGFAQ+YS E+  +  P   +  CLKRV +P+K  LN LR
Sbjct: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-SPGPIQGSLACLKRVHVPDKPSLNTLR 69

Query: 71  AEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLK 130
           AEV+AMK+LKG +HVV YIDSHAA+S   +GTYEV+LLME+C  GGLIDFMN+RLQ RL 
Sbjct: 70  AEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLS 129

Query: 131 EYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRN 190
           E+E+L IMS V QGI AMHAL PPLIHRDIKIENVLIS DG++KVCDFGSVSG IRPP+N
Sbjct: 130 EFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189

Query: 191 PQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             EF +VQHDILKNTTAQYR+PEMIDLYR   +DEKSDIWALG+FLYK+CY+TTPFEK G
Sbjct: 190 AYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVG 249

Query: 251 DQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFY 310
           + AIL +++QF ++P Y+DRLKNLIS MLS+ P+QRPNICQVLEEVSR+QGV  P+ NFY
Sbjct: 250 ENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPNFY 309

Query: 311 LLRAMQH---TNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPVGVTPQPM 367
           L R M+H   T    S   P + +       + P    P  PA  +         +P P 
Sbjct: 310 LER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQM---------SPLPH 359

Query: 368 PIMAKTRSGISTGGNIFPGAA-----NPMVVPTQLGPAQVAGPVPMG--SQDMSSGILPP 420
            I   T + +    N  P        NP     +     ++G   +   S DM       
Sbjct: 360 GIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMH------ 413

Query: 421 FNRASTLPTDGFS-TGPGKDGG-------VITSAVNTGPETIKDRPFNYVDSETQTSDAG 472
           FNR     +  FS  GP             I   ++  P T   +P  YVDSETQT D  
Sbjct: 414 FNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKP-TYVDSETQTGDI- 471

Query: 473 SITTSKPYLHPSAVS 487
            IT++K    P A+S
Sbjct: 472 -ITSNKSGSRPFAMS 485

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  463 bits (1192), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/315 (67%), Positives = 258/315 (81%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P++  Y PGT+LSVG+H A+I+KY+ SGGFAQVY+AE+ P D    ++ VCLKRVI+
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+ + HVV YIDSHAA+     G+YEVFLLME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E EIL+IMSQV+QG+AAMHALQPPL+HRDIKIENVL+++ G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPP NPQEF +VQHDI+KNTTAQYRSPEMI+L +   I+EKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+ AILH+ +QF   P YSDR+K+LI   L+ QP QRPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GVSSPMRNFYLLRAM 315
            V  P+ +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  465 bits (1197), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 289/380 (76%), Gaps = 15/380 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN  ++P Y P TV++VG+H AKI+KY+ASGG+AQVYSA + P D    TN  CLKRV++
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LNALRAEV+A+K+L+  K+VV YIDSHA++     G+YEVF+LME+C+ G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           +NTRL+NRL+E EIL+IM+QV  G+A MH LQP LIHRDIKIEN+LIS +GEYKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPPR+ +E  ++QHDI+KNTTAQYRSPEM+DL +   I+EKSDIWALG+FL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G++AIL S++Q+ A+P+YSD LKN+I  +LS  P +RPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMP- 359
           G+  PM+NFYL RA++    ++S + P    +  N++  P + +      Q      +P 
Sbjct: 301 GIVPPMKNFYLSRALE----TSSLMQP----LQNNSYKVPISDI------QDKHKRQIPN 346

Query: 360 VGVTPQPMPIMAKTRSGIST 379
           +  +P+ +P +  T +G++T
Sbjct: 347 IQSSPEKLPSIQSTSNGMTT 366

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  462 bits (1190), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/308 (67%), Positives = 255/308 (82%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYSA + P D  T +N  CLKRVI+
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+ +++VV YIDSHAA++ L NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E EIL IM QVTQG+AAMHALQPPLIHRDIKIENVLISA  EYK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPPRNPQE ++V+ D+LKNTTAQYRSPEM+D++R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGG+ AIL+ +++FL +P YS++L+NLI  +L Q P QRPN+ Q+L++++ MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GVSSPMRN 308
               P+R+
Sbjct: 301 NAPYPIRD 308

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  458 bits (1179), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 215/336 (63%), Positives = 264/336 (78%), Gaps = 2/336 (0%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P I TY  GT L+VG+H  +I+KY+ +GGFAQ+Y   + P D  +GTN  CLKRVI+
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AMKLL+ ++ VV YIDSHAA+S  QNGTYEVFLLME+C  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           +N+RLQNRLKE E++NIM  V+QG+AAMHALQPPL+HRDIKIENVL+S + E+K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSGPIRPP NPQE A VQ+DI++NTTAQYRSPEMID+ R   IDEKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEK G+  IL SRY+F A P YSDRL++LIS +L+ QP  RPNI  V++E+S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNT 336
            +S P+ NFYL   M  T+ S +       M NTNT
Sbjct: 301 NISCPIINFYLKPNM--TDASNNIQHLHSIMNNTNT 334

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  458 bits (1179), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 210/314 (66%), Positives = 256/314 (81%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYSA + P D  + ++  CLKRVI+
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AM+LLK +++VV YIDSHAA+++L NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E+EIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLISA+ EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPPRN QE ++VQ DILKNTTAQYRSPEMID +R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGGD AIL  +++F  +P YS++LK LI  +L Q P  RPN+ Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GVSSPMRNFYLLRA 314
            V  P+ +  +++A
Sbjct: 301 NVPCPINDIQVVQA 314

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/306 (67%), Positives = 253/306 (82%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYSA + P D  + +N  CLKRVI+
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AM+LL+ +++VV YIDSHAA+++L NG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E+EIL IMSQVTQG+AAMHALQPPLIHRDIKIENVLISA+ EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IRPPRNPQE ++VQ DI KNTTAQYRSPEM+D++R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGG+ AIL   ++F  +P YS++L++LI  +L Q P QRPN+ Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GVSSPM 306
            V  P+
Sbjct: 301 NVPCPI 306

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  453 bits (1166), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 255/314 (81%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P+I TY  GT L+VG+H  +I+KY+ SGGFAQVYS  + P D  T TN  CLKRVI+
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K  LN LRAEV+AM+LLK +++VV YIDSHAA+++LQNG+YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E+EIL I+SQVTQG+AAMHALQPPLIHRDIKIENVLIS + EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           V G IR PRN QE ++VQ DILKNTTAQYRSPEMID++R   IDEKSDIWALGIFLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFEKGG+ AIL  +++F  +P YS++LK+LI  +L Q P  RP++ Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GVSSPMRNFYLLRA 314
            V  P+ +   ++A
Sbjct: 301 NVPCPINDIQTVQA 314

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  462 bits (1188), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/333 (63%), Positives = 261/333 (78%), Gaps = 11/333 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV----CLK 56
           MN PEIP Y  G VL +GTH   I KY+A GGFAQVYS  +   D+    N++    CLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58

Query: 57  RVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGG 116
           RVI+P+K+GLN LRAEV+AMKLLKG+K++V YIDSHA RS L+ G YEVFLLME+C+ GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176
           +IDF+NTRL +RL+E+EIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS +G+YK+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236
           DFGS    +RPP+ PQE AF+ HDI+ NTTAQYRSPEMID Y    IDEKSDIWALG+FL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
           YKLCYYTTPFEK G+ AIL+ ++QF ++P YSD ++N+I+ ML++ P++RPNICQVLE+V
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SRMQGVSSPMRNFYLLR-----AMQHTNTSTSF 324
           S++QGV  P+ NF L R     +  ++N STS 
Sbjct: 299 SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSL 331

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  426 bits (1095), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 191/311 (61%), Positives = 247/311 (79%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P IP Y PGT ++VG+H   ILKY+ SGG+AQ+YSA++ PAD   GTN   LKRVI+
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P+K+ LN LRAEV+AMK LK  K++V YIDSHAA+S   +GTYEVFL+ME+C+ GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNTRLQNRL E EIL I   ++QG+AAMH LQPPLIHRDIKIENVLIS D +YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
           VSG IRPP+ P+E A+V+HDI+ +TTAQYR+PEM+DL +  ++++KSDIWALG+FLYKLC
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YYTTPFE+ G+  IL+   +F  +P YSD +K LI  ML++ P+ RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GVSSPMRNFYL 311
            V+ P+ N ++
Sbjct: 301 NVNCPIPNIHV 311

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  429 bits (1102), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/495 (47%), Positives = 308/495 (62%), Gaps = 38/495 (7%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           MN P IP Y PG V+ VG+H AKILKY+ SGGFAQ+YS E+ P D  T +N  CLKRVI+
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120
           P K+GLN LR EV+AMKLLK ++HVV YIDS+AA+S   NG+YEVFLLME+C  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           MNT+L+ RL+E E+LNIM+QV QGIAAMH L PPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS---DIWALGIFLY 237
           V G IRPPRNPQE  +VQHD++KNTTAQYRSPEMIDL +   I+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVS 297
            L +YT  F +  + AIL+ RYQ+ A+PIYSDRLKN++  +LS  P++RPNICQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPA----------QVAPL 347
           ++Q +  P+ NFYL R+      S   +    S  NT  F    A          +++PL
Sbjct: 298 KIQNIPCPIDNFYLERSRHQGAVSVMPVN--FSRANTTQFTDQSAKETTAIRVGKEISPL 355

Query: 348 TPAQSLGANGMPVGVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQ---VAG 404
            P  S      P+  +  P+ +M KT           P + N    P  +G      +A 
Sbjct: 356 KPQLS------PIKSSYGPVLVMTKTT----------PNSFNSHHTPPPIGIVSNKTIAK 399

Query: 405 PVPMGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSAVNT-GPETIKDRPFNYVD 463
           P+    +D ++G+   +  +S       +     D    T+ +N     +   +   YVD
Sbjct: 400 PLYNSLEDGNNGLENHYLSSSVPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVD 459

Query: 464 SETQTSDAGSITTSK 478
           SETQT +  S+  ++
Sbjct: 460 SETQTLEEPSLQHTR 474

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  393 bits (1009), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 231/309 (74%), Gaps = 4/309 (1%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           Y  GT L V +H   I  Y+ SGGFAQVY+A +            CLKRVI+P K  LN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNG--TYEVFLLMEFCTAGGLIDFMNTRLQ 126
           LRAEV+AMK+LK +K++V YIDSHA R  LQN   +Y V LLME+C+  GL+DFMN RL+
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANR--LQNSEDSYVVLLLMEYCSGAGLLDFMNLRLK 126

Query: 127 NRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIR 186
            RLKE EIL IM+ V+QG+  MH LQPPL+HRDIKIENVL+S DG +K+CDFGSVSG +R
Sbjct: 127 ERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186

Query: 187 PPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            P + +EF ++Q+DILKNTTAQYRSPEM++L     I+EKSDIWALGI LYKLCYYTTPF
Sbjct: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246

Query: 247 EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPM 306
           E+ G +AI+  ++ + A+P Y+D LKN+I  +LS  P+QRPNICQ+LEE+ R+Q  SSP+
Sbjct: 247 EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPL 306

Query: 307 RNFYLLRAM 315
            NFY+ RAM
Sbjct: 307 PNFYVQRAM 315

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  317 bits (811), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 210/320 (65%), Gaps = 14/320 (4%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSA---EMFPADTPTGT------NKVCLK 56
           + +Y PGT++ VG H  +++KY+A GGFA++Y     E      P G       +++CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGG 116
           RV++ +  GLN +R EV  M+ LKG+  VV Y DS+A+R +     YEV LLME C+   
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176
           L+D+MN RL  +L E EIL IM  VT  +A MH L  PLIHRDIKIENVL+ +   +K+C
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236
           DFGS S  +    + Q+ A +  +I  +TT QYRSPEMIDLYRC  ++EKSDIWALG+FL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPI--YSDRLKNLISWMLSQQPMQRPNICQVLE 294
           YKL +YTTPFE+ G  AILHS+Y+F   P+  YS +L NLI  ML++ P  RPNI QVL 
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEF---PLNNYSSKLINLIIVMLAENPNLRPNIYQVLN 322

Query: 295 EVSRMQGVSSPMRNFYLLRA 314
           ++  + G+ +PM + Y L A
Sbjct: 323 QICYISGIKNPMDDAYGLGA 342

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  313 bits (801), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 160/323 (49%), Positives = 205/323 (63%), Gaps = 22/323 (6%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP-----ADTPTGT------------- 50
           + PG V++VG H  +I+KY+A GGFAQ+YS          ++ P  T             
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 51  ---NKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFL 107
              N  CLKRV++P++ GLN LR EVN M+ LKG+ ++V Y DS+A+R    N  +EV L
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLI 167
           LME C    L+D+MN RL  +L E EIL IM  VT GI+ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS 227
            +   +K+CDFGS S       + QE A +  +I  +TT QYRSPEMIDLYR   IDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRP 287
           DIWALG+FLYKL +YTTPFE  G  AILHS+Y+   +  YS RL NLI  ML++ P  RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPNN-YSSRLINLIIIMLAENPNLRP 317

Query: 288 NICQVLEEVSRMQGVSSPMRNFY 310
           NI QV+ +V    G+  P+++ Y
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  310 bits (793), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 214/330 (64%), Gaps = 24/330 (7%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP-------ADTPTGTNKV----- 53
           +  Y PG V+ VG+H  +IL+YIA GGFAQ+YS +           ++P   +++     
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 54  -CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT--------YE 104
            CLKRVI+ ++ GLN LR EVN MK L G+ ++V Y DS+A+R  L+NGT        +E
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFE 132

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EIL +M  V+  IA MH L+ PLIHRDIKIEN
Sbjct: 133 VLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIEN 192

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           VL+     +K+CDFGS S         ++ A++  +I  +TT QYRSPEMIDLYRC  ID
Sbjct: 193 VLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPID 252

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPM 284
           EKSDIWALGIFLYKL ++TTPFE+ G  AILHS+++F  +  YS +L NLI  MLS+ P 
Sbjct: 253 EKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQNN-YSFKLINLIIVMLSENPN 311

Query: 285 QRPNICQVLEEVSRMQGVSSPMRNFYLLRA 314
            RPNI QVL ++ +++ V  P+ + Y L A
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKYGLGA 341

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  305 bits (780), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 203/315 (64%), Gaps = 9/315 (2%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP----ADTPTGTNK----VCL 55
           P +    PGT++ VG+H  +I+KY+A GGFA +Y  +        +TP+ + K     CL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAG 115
           KRV++ ++ GLN LR EV  MK LK S ++V Y DS+A+R    +  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKV 175
            L+D+MN RL  +L E E+L IM  VT+ +A MH L  PLIHRDIKIENVL+ ++  +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIF 235
           CDFGS S         Q+ A + ++I  +TT QYR+PEMIDLYRC  IDEKSDIWALGIF
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           LYKL +YTTPFE  G  AILHS+Y   A+  YS +L NLI  ML++ P  RPNI QV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSRMQGVSSPMRNFY 310
           V  +  V  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  303 bits (775), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 202/316 (63%), Gaps = 10/316 (3%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV---------CLK 56
           I TY PG ++ VG H  +I+KY+A GGFA++Y A+          NK+         CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGG 116
           RV++ +  GLN +R EV+ MK L G+ ++V   DS+A+R       YEV LLME C+   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176
           L+D+MN RL  +L E EIL IM  VT  +A MH L  PLIHRDIKIENVL+ +   +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236
           DFGS S  +      ++ A +  ++  +TT QYRSPEMID+YRC  I+EKSDIWALGIFL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
           YKL +Y TPFE+ G  AILHS+Y+F  H  YS +L NLI  ML++ P  RPNI QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SRMQGVSSPMRNFYLL 312
            ++  + +P+ + Y L
Sbjct: 395 CKIINIKTPIDDIYGL 410

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  309 bits (791), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 211/322 (65%), Gaps = 20/322 (6%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEM------FPADTPTGTNK------- 52
           I  ++ G  ++VG+H  +I+KY+  GGFAQ+Y  ++      F A       +       
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 53  --VCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLME 110
             VCLKRV++ ++AGL+ ++ EVN MK L+G  +VV Y DS+A R+   NG +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 FCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISAD 170
           +C    L+D+MN RL  +L E EILNIM  +T G++ +H L  PLIHRDIKIENVL+  +
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GEYKVCDFGSVSGPIRPP--RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSD 228
             +K+CDFGS +  I PP     Q+ + + HDI  +TT QYRSPEMIDL+RC  ++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPN 288
           IWALG+FLYKL +YTTPFE  G  AILHS+Y+ +    YS+RL NLI  ML++ P  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYE-IPQSHYSERLLNLIVVMLAENPNLRPN 322

Query: 289 ICQVLEEVSRMQGVSSPMRNFY 310
           I QVL E+  +  V  P+ + Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  308 bits (789), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 203/319 (63%), Gaps = 15/319 (4%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV---------- 53
           P    YTPGT ++VG H  +I+KYIA GGFAQ+Y+ +          N++          
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 54  CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT--YEVFLLMEF 111
           CLKRV++ ++ GLN +R EV  MK L+G+ ++V Y DS+A+R    NG   +EV LLME 
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLMEL 134

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C    L+D+MN RL  +L E EIL IM  VT  ++ MH L  PL+HRDIKIENVL+ A  
Sbjct: 135 CPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN 194

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
            +K+CDFGS S         Q+ A +  +I  +TT QYRSPEMIDLYRC  IDEKSDIWA
Sbjct: 195 NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWA 254

Query: 232 LGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQ 291
           LGIFLYKL ++TTPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI Q
Sbjct: 255 LGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQ 313

Query: 292 VLEEVSRMQGVSSPMRNFY 310
           VL  +  + G+  P+ + Y
Sbjct: 314 VLHNICSISGMKVPIEDQY 332

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  303 bits (776), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 155/318 (48%), Positives = 201/318 (63%), Gaps = 14/318 (4%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVY---------SAEMFPADTPTGTNKVC 54
           P +     G+ + VG H  +I+KY+A GGFA +Y           E  P+ T       C
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTA 114
           LKRV++ ++ GLN +R EV+ MK L G  ++V Y DSHA+RS      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
             L+D+MN RL  +L E EIL IM  VT+ +A MH L  PLIHRD+KIENVL+  D  +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGI 234
           +CDFGS S  +      QE A + ++I  +TT QYRSPEMIDLYRC  IDEKSDIWALGI
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKLCYYTTPFEKGGDQAILHSRYQFLAHPI--YSDRLKNLISWMLSQQPMQRPNICQV 292
           FLYKL +YTTPFE  G  AILHS+Y+F   PI  YS +L NLI  ML++ P  RPNI Q+
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEF---PINNYSSKLINLIIIMLAENPNLRPNIYQI 320

Query: 293 LEEVSRMQGVSSPMRNFY 310
           ++ +  +  V +P+ + Y
Sbjct: 321 MDNLCSIMKVENPIEDKY 338

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  305 bits (782), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 201/318 (63%), Gaps = 15/318 (4%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP-----ADTPTGTNK---------VC 54
           Y  GT ++VG+H  +++KYIA GGFAQ+Y+ +        A  P G             C
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTA 114
           LKRV++ +  GLN +R EVN M+ L+G+  VV Y DS+A+        YEV LLMEFC  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
             L+D+MN RL  RL E EI+ IM   T GIA +H L+ PLIHRDIKIENVL+  +  +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGI 234
           +CDFGS S       N ++ A    +I  NTT QYRSPEMIDLYR Q IDEKSDIWALG+
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           FLYKL ++TTPFE+ G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI QVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 EVSRMQGVSSPMRNFYLL 312
            +  + G   P+ + Y L
Sbjct: 398 YLCSINGWKVPLNDKYGL 415

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  305 bits (782), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP--------ADTPTGTNK 52
           M HP +  YTPG ++ VGTH  +I+ Y+A GGFAQ+Y+ +           A  P     
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 53  V-CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           V CLKRV++ ++ GLN +R EV  MK LKG+ +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+ A+ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
            +K+ DFGS S         Q+ A +  +I  +TT QYRSPEMIDLYRC  I+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQ 291
           LGIFLYKL ++TTPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQGVSSPMRNFY 310
           VL  +  +     P+ + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  305 bits (782), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 201/318 (63%), Gaps = 10/318 (3%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEM--FPADTPTGTNK-------VC 54
           P +  Y PGTV++VG    +I+ +IA GGFAQ+YS +   F  +   G+          C
Sbjct: 17  PVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIAC 76

Query: 55  LKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTA 114
           LKRV++P++ GL+ +R EV  MK L+G+K ++ Y DS+A+R       YEV LLME C  
Sbjct: 77  LKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
             L+D+MN RL  RL E EIL +M   T  I+ MH L  PLIHRDIKIENVL+ A   +K
Sbjct: 137 NSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFK 196

Query: 175 VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGI 234
           +CDFGS S         Q+ A +  +I  NTT QYRSPEMIDLYRC  I+EKSDIWALGI
Sbjct: 197 LCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           FLYKL ++ TPFE  G  +ILHS+Y+F A+  YS +L NLI  ML++ P  RPNI QV+ 
Sbjct: 257 FLYKLLFFITPFEMTGQFSILHSKYEFPANK-YSSKLINLIIIMLAENPYVRPNIYQVMH 315

Query: 295 EVSRMQGVSSPMRNFYLL 312
            +  + G   P+ + Y L
Sbjct: 316 HICSVIGCEVPIEDKYGL 333

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  305 bits (780), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 188/307 (61%), Gaps = 11/307 (3%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNK----------VCL 55
           +  +  G+ + VG    +I+KY+  GGFAQ+Y  +         +N            CL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAG 115
           KRV++ ++ GLN +R EV  MKLLKG+ ++V Y DS+A+R       +EV LLME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 116 GLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKV 175
            L+DFMN RL  +L E EIL IM  VT  +A MH L PPLIHRDIKIENVL+ +   +K+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 176 CDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIF 235
            DFGS S         Q+ A +  DI  +TT QYRSPEMIDLY+C  IDEKSDIWALGIF
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 236 LYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           LYKL +Y TPFE  G  AILHS+Y F     YS RL NLI  MLS+ P  RPNI QVL E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDF-PQTNYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 296 VSRMQGV 302
           +  + G 
Sbjct: 321 ICSISGT 327

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  299 bits (765), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 195/309 (63%), Gaps = 9/309 (2%)

Query: 10  TPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNK--------VCLKRVIIP 61
           T G++L VG H  +I++Y+A GGFA +Y             +          CLKRV + 
Sbjct: 29  TAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVN 88

Query: 62  EKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFM 121
           ++ GLN LR EV  MK LKG  +VV Y DS+A+R       +EV LLME C+ G L+D+M
Sbjct: 89  DENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYM 148

Query: 122 NTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSV 181
           N RL  +L E E+L IM  +T+GI+ MH L+ PLIHRDIKIENVL+ +   +K+CDFGS 
Sbjct: 149 NQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGST 208

Query: 182 SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCY 241
           S  +      QE A + ++I  +TT QYRSPEMIDLYRC AI+EKSDIWALGIFLYKL +
Sbjct: 209 STCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLF 268

Query: 242 YTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQG 301
           YTTPFE  G  AILHS+Y  +    +S +L NLI  ML++ P  RPNI Q+L  +  +  
Sbjct: 269 YTTPFELTGQFAILHSKYD-IPQNNFSSKLINLIIVMLAENPYIRPNIYQILYHICSIME 327

Query: 302 VSSPMRNFY 310
              P+ + Y
Sbjct: 328 CDVPIEDHY 336

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  302 bits (774), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 155/319 (48%), Positives = 199/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP--------ADTPTGTNK 52
           M HP +  YTPG ++ VGTH  +I+ Y+A GGFAQ+Y  +           A  P     
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 53  V-CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           + CLKRV++ ++ GLN +R EV  MK LKG+ +VV Y DS+A+R       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+ A  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
            +K+ DFGS S         Q+ A +  +I  +TT QYRSPEMIDLYRC  I+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQ 291
           LGIFLYKL ++TTPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQGVSSPMRNFY 310
           VL  +  +  V  P+ + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  303 bits (775), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 203/326 (62%), Gaps = 25/326 (7%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPA-----DTPTGTNK----------- 52
           +  GT ++VG+H  +I+KYIA GGFAQ+Y+ +   +     D+ T  N            
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 53  --------VCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYE 104
                    CLKRV++ ++ GLN +R EV  MK LKG+ +VV Y DS+A+R       +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E+EIL IM  +T  ++ MH L+ PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           VL+ A   +K+CDFGS S  +      Q+ A +  +I  +TT QYRSPEMIDLYRC  ID
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPM 284
           EKSDIWALGIFLYKL ++ TPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P 
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPN 322

Query: 285 QRPNICQVLEEVSRMQGVSSPMRNFY 310
            RPNI QVL+ +  M  V  P+ + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  302 bits (773), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 153/319 (47%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP--------ADTPTGTNK 52
           M HP +  +TPG ++ VGTH  +++ Y+A GGFAQ+Y  +           A  P     
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 53  V-CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           V CLKRV++ ++ GLN +R EV  MK LKG+ +VV Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L  PLIHRDIKIENVL+ A+ 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
            +K+ DFGS S         Q+ A +  +I  +TT QYRSPEMIDLYRC  I+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQ 291
           LGIFLYKL ++TTPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSRMQGVSSPMRNFY 310
           VL  +  +  +  P+ + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  299 bits (766), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 200/312 (64%), Gaps = 14/312 (4%)

Query: 12  GTVLSVGTHHAKILKYIASGGFAQVY---------SAEMFPADTPTGTNKVCLKRVIIPE 62
           G+ + VG H  +I+KY+A GGFA +Y           E  P       +  CLKRV++ +
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMN 122
           + GLN +R EV+ MK L G  ++V Y DSHA+R+   +  +EV LLME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 123 TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVS 182
            RL  +L E EIL IM  VT+ +A MH L  PLIHRD+KIENVL+ A+  +K+CDFGS S
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 183 GPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                    QE A + ++I  +TT QYRSPEMIDLYRC  I+EKSDIWALGIFLYKL +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 243 TTPFEKGGDQAILHSRYQFLAHPI--YSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           TTPFE  G  AILHS+Y+F   P+  YS +L NLI  ML++ P  RPNI QV++ +  + 
Sbjct: 314 TTPFELTGQFAILHSKYEF---PVNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSIL 370

Query: 301 GVSSPMRNFYLL 312
            V +P+ + Y L
Sbjct: 371 KVKNPLEDKYQL 382

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  301 bits (770), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 151/316 (47%), Positives = 199/316 (62%), Gaps = 10/316 (3%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP--------ADTPTGTNKV-C 54
           P +  + PG V++VGTH  +++ Y+A GGFAQ+Y  +           +  P     V C
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTA 114
           LKRV++ ++ GL+ +R EV  MK L G++++V Y DS+A R    N  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
             L+D+MN RL  +L E EIL IM  V+  ++ MH L+ PLIHRDIKIENVL+ A   +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGI 234
           +CDFGS S         QE A +  +I  +TT QYR PEMIDLYRC  I+EKSDIWALGI
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           FLYKL ++ TPFE  G  AILHS+Y+F  +  YS +L NLI  ML++ P  RPNI QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPNH-YSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EVSRMQGVSSPMRNFY 310
            +  M GV  P+ + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  300 bits (767), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 199/321 (61%), Gaps = 14/321 (4%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP--------ADTPTGTNK 52
           M HP +  YTPG ++ VGTH  +++ Y+A GGFAQ+Y  +           A  P     
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 53  V-CLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           V CLKRV++ ++ GLN +R EV  MK LKG+ ++V Y DS+A+R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C    L+D+MN RL  +L E EI+ IM  V   I+ MH L   LIHRDIKIENVL+ A  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
            +K+ DFGS S         Q+ A +  +I  +TT QYRSPEMIDLYRC  I+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPI--YSDRLKNLISWMLSQQPMQRPNI 289
           LG+FLYKL ++TTPFE  G  AILHS+Y+F   P+  YS +L NLI  ML++ P  RPNI
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEF---PVNKYSSKLINLIIIMLAENPNLRPNI 310

Query: 290 CQVLEEVSRMQGVSSPMRNFY 310
            QVL  +  +  V  P+ + Y
Sbjct: 311 YQVLYHLCEILNVEVPIEDKY 331

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  292 bits (747), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 196/313 (62%), Gaps = 11/313 (3%)

Query: 10  TPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPA--DTPTGTNK--------VCLKRVI 59
           +P T + VGTH  +IL+++A GGFA +Y  +      +   G +          CLKRVI
Sbjct: 30  SPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVI 89

Query: 60  IPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLID 119
           +P++ GLN LR EV  MK L+GS ++V Y DS+A+R    +  +E+ LLME C    L+D
Sbjct: 90  VPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLD 149

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           +MN +L  +L E EIL IM  V+  IA MH L  PLIHRDIKIENVL+  D  +K+CDFG
Sbjct: 150 YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG 209

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
           S S         Q+ A + ++I  +TT QYRSPEMIDLYRC  I+EKSDIWALGIFLYKL
Sbjct: 210 STSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269

Query: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299
            +YTTPFE  G  AILHS+Y+ +    YS +L NLI  ML++ P  RPNI QV+  V  +
Sbjct: 270 LFYTTPFELTGQFAILHSKYE-IPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSI 328

Query: 300 QGVSSPMRNFYLL 312
                P  + Y L
Sbjct: 329 LKCDVPFTDKYEL 341

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  293 bits (749), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 199/322 (61%), Gaps = 11/322 (3%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP----------ADTPTGT 50
           +N P    Y  G ++SVG H  +I+ Y+A GGFAQ+Y  +                 T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLME 110
           +  CLKRVI+ ++ GLN +R EV  MK LK S ++V Y DS+A+R       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 FCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISAD 170
            C    L+D+MN RL+ +L E EIL IM  V+ GI+ MH L  PLIHRDIKIENVL+ A+
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIW 230
             +K+CD GS S    P  + Q+ A +  +I  +TT QYR+PEMIDLYR   I+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNIC 290
           ALGIFLYKL +YTTPFE  G  AILHS+Y F  +  YS ++ NLI  ML++ P  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVLEEVSRMQGVSSPMRNFYLL 312
           QV+  +  +  +  P+ + Y L
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGL 332

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  290 bits (743), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 200/322 (62%), Gaps = 18/322 (5%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPA-----DTPTGTNK-------- 52
           I  +  G  L+VGTH  +I+ Y+  GGFAQ+Y  +         +   G+N         
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 53  ----VCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLL 108
                CLKRV++ ++ GLN +R EVN MK L+G  ++V Y DS+A RS   N  YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLIS 168
           ME C+   L+++MN RL  +L E E+L IM  VT G+A MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 ADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSD 228
           ++  +K+CDFGS +         Q+ A +  ++  +TT QYRSPEMIDLYR   I+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPN 288
           IWALG+FLYKL +YTTPFE  G  A+LHS++   A+  YS ++ NL+  MLS+    RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLRPN 326

Query: 289 ICQVLEEVSRMQGVSSPMRNFY 310
           I QV+  + ++  V +P+ + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  287 bits (734), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 147/315 (46%), Positives = 196/315 (62%), Gaps = 25/315 (7%)

Query: 12  GTVLSVGTHHAKILKYIASGGFAQVYSAEMF--------------PADTPTGTNKVCLKR 57
           G+ + VG H  ++++Y+A GGFA +Y                   P DT      VCLKR
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDT------VCLKR 85

Query: 58  VIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT--YEVFLLMEFCTAG 115
           V + ++ GLN LR EV  MK L+   ++V Y DS+A+R  L +G   YEV LLME C  G
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASR--LGDGKPGYEVLLLMELCPNG 143

Query: 116 GLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKV 175
            L+D+MN RL  +L E E+L IM  +T G++ MH  + PLIHRDIKIENVL+ AD  +K+
Sbjct: 144 SLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKL 203

Query: 176 CDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIF 235
           CDFGS S  +    + QE A + ++I  +TT QYRSPEMIDLYRC  I+EKSDIWALGIF
Sbjct: 204 CDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIF 263

Query: 236 LYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           LYKL +YTTPFE  G  AILHS+Y+ +    +S +L NL+  ML++ P  RPN+ QV+  
Sbjct: 264 LYKLLFYTTPFELTGQFAILHSKYE-IPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYH 322

Query: 296 VSRMQGVSSPMRNFY 310
           +  M      + + Y
Sbjct: 323 ICSMMECEVKIDDLY 337

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  280 bits (717), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 200/321 (62%), Gaps = 19/321 (5%)

Query: 3   HPEIPTYTP-GTVLSVGTHHAKILKYIASGGFAQVYSAEM------FPADTPTGTNK--- 52
            P+I    P G V++VG+H  +++ Y+A GGFAQ+Y  +       F        N+   
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 53  ----VCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT----YE 104
                CLKRV++ ++ GLN +R+EV  MK L+G+ ++V Y DS+A+R    +G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EI  IM  +T  +A MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           VL+ A+  +K+CDFGS S       + Q+ A +  D+  +TT QYRSPEMIDL++   I+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPM 284
           EKSDIWALG+FLYKL ++TTPFE+ G  A+LHS+++F  +  YS +L NLI  ML++ P 
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNS-YSSKLINLIIVMLAENPS 387

Query: 285 QRPNICQVLEEVSRMQGVSSP 305
            RPNI QVL  +S +     P
Sbjct: 388 LRPNIYQVLYYLSEVTNREVP 408

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  278 bits (712), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 193/321 (60%), Gaps = 37/321 (11%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFP----------------ADTPTG 49
           I  Y  GT+L+VG    +ILKY+  GGFAQ+Y+                      +   G
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 50  TNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT------- 102
            +  CLKRV++P++ GL+ +R EV+ MK L    ++V Y DS+A++ +  N         
Sbjct: 97  -DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASK-IKDNSNIDTTNNN 154

Query: 103 ---------YEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQP 153
                    +E+ LLME+C    L+DFMN RL  +L E EIL  M+ +T  +  MH L  
Sbjct: 155 DNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQ 214

Query: 154 PLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP-RNPQEFAFVQHDILKNTTAQYRSP 212
           PLIHRDIKIENVL+ ++  +K+ DFGS +  I+PP    Q+ A +  DI  NTT QYRSP
Sbjct: 215 PLIHRDIKIENVLVDSNNNFKLADFGSTT-KIQPPITTHQDIAILNKDIYMNTTPQYRSP 273

Query: 213 EMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLK 272
           EMIDLY+C  IDEKSDIWALG+ LYKL +YTTPFE  G  AILHS+Y+F A+  YS +  
Sbjct: 274 EMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPANN-YSSKFI 332

Query: 273 NLISWMLSQQPMQRPNICQVL 293
           NLI  ML++ P  RPNI QVL
Sbjct: 333 NLIIIMLAENPNLRPNIFQVL 353

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  280 bits (716), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 190/318 (59%), Gaps = 16/318 (5%)

Query: 6   IPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNK-----------VC 54
           I  Y PG ++SVG H  KI  Y+A GGFAQ+Y  +           K            C
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTA 114
           LKRV++ ++ GLN +R EV  MKLL+G  ++V Y DS+A R       YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
             L+D+MN RL+ +L E EI+ IM   T  ++ MH L  PLIH+DIK+EN+L+ ++  +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGI 234
           +CDFGS S       +  + A +  +I  +TT QYRSPEMIDLYRC  I+E SDIWALG+
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKLCYYTTPFEKGGDQAILHSRYQFLAHPI--YSDRLKNLISWMLSQQPMQRPNICQV 292
           FLYKL ++ TPFE+ G  +ILH+++     P+  Y  +L NLI  MLS+    RPNI QV
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDI---PVNNYHPKLINLIIIMLSENLNLRPNIYQV 328

Query: 293 LEEVSRMQGVSSPMRNFY 310
           + E+  +     P+ + Y
Sbjct: 329 MYEICSITNTPLPIEDKY 346

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 140/295 (47%), Gaps = 55/295 (18%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPE-KAGLN---ALRAEVNAMKL 78
           K L  I  G  + VY         PT    + LK++ I + K   N    +  E+   KL
Sbjct: 51  KQLNKIGKGSHSIVYKVTH-----PTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKL 105

Query: 79  LKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIM 138
           + G K+++  ID     + +       ++++E C AG L D +  R +  L+E+E   +M
Sbjct: 106 VNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKRSLREWEAKRLM 157

Query: 139 SQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQ 198
            Q+   +  +H  +  ++H D+K+ N+LI +    ++CDFG               +FV 
Sbjct: 158 IQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH--------------SFVS 201

Query: 199 HDILKNT-----TAQYRSPEMI---------DLYRCQAIDEKSDIWALGIFLYKLCYYTT 244
            DI  N+     T  Y SPE+I         DLY      ++SDIW++GI LY + +  T
Sbjct: 202 TDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY----FPKESDIWSIGIVLYAMIFDKT 257

Query: 245 PFE----KGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           PFE    +   + I+  +Y F+ +   S+++K LI  +L  QP++R  I +++ +
Sbjct: 258 PFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 141/333 (42%), Gaps = 61/333 (18%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPA-----DTPTGTNKVCLKRVIIPEKAGLN 67
           T + V     KI + +  GG + VY  ++        ++        LK++I P    ++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  ALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN 127
               E+   K  + S +V+  IDS   +   ++G+  +++++ + + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 --RLKEYEILNIMSQVTQGIAAMHA---------------------------------LQ 152
              + E E + IM  VT+G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
             ++           HRDI   N+L S+DG   + D GS S       N  + + +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAI 254
             N T  Y +PE+++L   QA+  K DIW++G   Y L +  +PFE+           AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRP 287
              +Y F  +  +S+RL ++I   +   P+QRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 127/284 (44%), Gaps = 44/284 (15%)

Query: 24  ILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSK 83
            L+ +  G ++ V+ A            KVC K+ II E+  +  +  E + + LL G  
Sbjct: 12  FLEKLGQGSYSTVFRAVERANGLRNYAIKVCSKKHIIRERK-VKYVTVEKDLLNLLAGGG 70

Query: 84  H---VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
           H   V  +   H         T  ++ ++EF + G L+  +  R   RL E     I SQ
Sbjct: 71  HPGVVRLFCTFH--------DTDNLYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQ 120

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVS----GPIRPPRNPQEFAF 196
           +   +  MHA    +IHRD+K ENVL+S +G   + DFG+      G   P    +  +F
Sbjct: 121 LVDTVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRAASF 178

Query: 197 VQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAI-- 254
           V        TA+Y SPE++   +C      SD+WALG  +Y+L     PF   GD  +  
Sbjct: 179 V-------GTAEYVSPELLLHSQCSF---GSDVWALGCIIYQLTQGAPPFR--GDTELQS 226

Query: 255 ------LHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
                 L  R+ + A P+    +  L+  +L   P+QRP+  Q+
Sbjct: 227 FEKIVALDYRWVYAAPPL----IVALVQSILVLDPLQRPSAKQL 266

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 137/299 (45%), Gaps = 60/299 (20%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIP--EKAGL 66
           ++   ++ +G +  KI+K I  G F +VY A           +++  ++V++    K   
Sbjct: 26  FSSNELVDIGNY--KIVKLIGEGSFGKVYLA----------NHRLTHQKVVLKTGNKNDP 73

Query: 67  NALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQ 126
           N +R EV   +      H+    +     S       +V++ +E+C    L +++   +Q
Sbjct: 74  NVVR-EVFYHRQFDFP-HITKLYEVIVTES-------KVWMALEYCPGKELYEYL--LMQ 122

Query: 127 NRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIR 186
           +R+   E   + +Q+   +   H+LQ   +HRD+K+EN+L+   G  K+ DFG       
Sbjct: 123 HRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFG------- 173

Query: 187 PPRNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240
                    F +    K        T  Y +PE+I+         K DIW+LG+ LY + 
Sbjct: 174 ---------FTRECATKTMLETVCGTTVYMAPELIERKSYDGF--KIDIWSLGVILYTMI 222

Query: 241 YYTTPFEKGGDQAILHSRYQFL-AHPIYSDRL-----KNLISWMLSQQPMQRPNICQVL 293
           + T PF++  +     ++++ +   P Y+D +     K+LIS +L + P QRP + QVL
Sbjct: 223 HGTMPFDEEDETK---TKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 125/281 (44%), Gaps = 41/281 (14%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLK 80
           K  + I  G F  VY            TN+VC  +V+  + A   +  ++ EV  +  LK
Sbjct: 20  KRTEVIGRGKFGIVYKGYYI------KTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLK 73

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
              ++  Y  S+       N T E++++ME+C  G L   +      ++ E  I  IM +
Sbjct: 74  QVPNITHYYGSYL------NNT-ELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRE 123

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           +   IA MH  +  +IHRDIK  NVLI+ DG  K+CDFG  +               Q  
Sbjct: 124 LL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTK 169

Query: 201 ILKNTTA---QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQA 253
           I + T A    + +PE+I        D K DIW+LGI  Y++     P+         Q 
Sbjct: 170 IRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQL 227

Query: 254 ILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           I  S+   L    +S  LK  I+  L + P +RP+  ++L+
Sbjct: 228 ITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 153/354 (43%), Gaps = 75/354 (21%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPE---KAGLNAL 69
           +VL  G H+A I + +  GGF+ VY  +     +    +   LK++  P    ++   A+
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 70  RAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN-- 127
           R EVN+ K  + S ++   + S   +   Q+G+  VF+L+ +   G L+D +NT L +  
Sbjct: 74  R-EVNSYKKFR-SPYITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 128 RLKEYEILNIMSQVTQGIAAMH-------------ALQPPLIHRD--------------- 159
            + E EI+ I+  V +G+  MH             ++   L +RD               
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 160 -------------------------IKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEF 194
                                    IK  N++ S+DG   +CD GS S       +  + 
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 195 AFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK-----G 249
              Q    ++ T  +RSPE++++     IDEK DIW+LG  LY +C+  +PFE+     G
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 250 GDQ--AILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQG 301
                AI   ++    +  YS  L  +I   +     +RP+I ++L  +  +QG
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 135/297 (45%), Gaps = 56/297 (18%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK +  G F +VY A   P        KVCLK     +K   N 
Sbjct: 30  FTSDELTEVGNY--KILKQVGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNI 79

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + +    +V++ +E+C    L D + +   +R
Sbjct: 80  VR------EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLS--LHR 128

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q++  +   H++    +HRD+K+EN+L+  +G  K+ DFG         
Sbjct: 129 ISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG--------- 177

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K T      T  Y +PE+I+         K DIW+LG+ LY L   
Sbjct: 178 -------FTRECMTKTTLETVCGTTVYMAPELIERRTYDGF--KIDIWSLGVILYTLITG 228

Query: 243 TTPFEKGGDQAILHSRYQFL-AHPIYS-----DRLKNLISWMLSQQPMQRPNICQVL 293
           + PF+   D   + ++++ +   P Y      D  K+LIS +L++ P +RP++ QVL
Sbjct: 229 SLPFD---DDDEVKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 124/283 (43%), Gaps = 36/283 (12%)

Query: 28  IASGGFAQVYSAEMFPADTPTG---TNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH 84
           +  G ++ VY A     D  TG     KVC K+ II E   +  +  E N + LL    H
Sbjct: 16  LGHGSYSTVYKA----VDRSTGQLFAIKVCSKKHIISENK-VKYVTIEKNTLNLLAHGNH 70

Query: 85  ---VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
              +  Y   H + +L        + +++F   G L+  + T  Q R  E    + M Q+
Sbjct: 71  PGIIKLYYTFHDSENL--------YFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQL 120

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              +  +H  +  ++HRD+K EN+L+S++G+  + DFG  S            +FV    
Sbjct: 121 IDALEYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV---- 174

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF 261
               TA+Y SPE++   +       SDIWA+G  LY+    T PF    + A        
Sbjct: 175 ---GTAEYVSPELLLQNKSNFC---SDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNL 228

Query: 262 LAHPIY--SDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGV 302
             H IY  S  + +L+S +L   P  R  + Q+ +  +  QG+
Sbjct: 229 DYHWIYMVSQHITDLVSKILVLDPDSRYTLPQI-KNHAWFQGI 270

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 139/339 (41%), Gaps = 61/339 (17%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPA-----DTPTGTNKVCLKRVIIPEKAGLN 67
           T + V     KI + +  GG + VY  ++        +         LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  ALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN 127
               E+   K  + S +V+  IDS   +   ++G+  +++++ F T G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 128 --RLKEYEILNIMSQVTQGIAAMHA---------------------------------LQ 152
              + E E + IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLI-----------HRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
             ++           HRDI   N+L S+DG   + D GS S       N  +   +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAI 254
             N T  Y +PE++ L   Q +D K DIW+LG   Y L +  +PFE+           AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
              +Y F  +  +S+ L ++I   +   P+QRP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 129/283 (45%), Gaps = 32/283 (11%)

Query: 24  ILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALR--AEVNAMKLLKG 81
           I K +  G F  V+ A          T +V   ++I  + +         E+  M LLK 
Sbjct: 18  IDKCVGKGNFGDVFKA------MNNVTKEVVAIKIINLDDSEEETFEIIKEMRLMSLLK- 70

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           S ++  YI +        N  Y ++++ME+C  G   D + T  +  L E ++  ++  V
Sbjct: 71  SPYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSV 123

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
             G+  +HA     IHRDIK  N+L++  G  KV DFG VS  +R     + F       
Sbjct: 124 LLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV------ 174

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---R 258
               T  + +PE++ +      +EKSDIW+LGI  Y+L     P  K     ++ +   R
Sbjct: 175 ---GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKR 230

Query: 259 YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQG 301
                H  Y++ +K+ I+  L + P +RP+  ++LE    ++G
Sbjct: 231 KPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG 273

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 128/272 (47%), Gaps = 31/272 (11%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLKGSKHV 85
           +  G F  VY A          T K    +VI  E +   ++ L  E+  +  LK S ++
Sbjct: 22  VGRGNFGDVYKA------IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELK-SDYI 74

Query: 86  VCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGI 145
           + YI      +++++ +  ++++M++C  G   D +     N + E ++  I+  V  G+
Sbjct: 75  INYI-----TTIMEDVS--MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGL 127

Query: 146 AAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT 205
             +H  +   IHRDIK  N+L++ DG+ K+ DFG VSG I+       F           
Sbjct: 128 QYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV---------G 175

Query: 206 TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF---L 262
           T  + +PE+I+       DEK DIW+LGI  Y+L     P  K     ++ S  +     
Sbjct: 176 TPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPK 235

Query: 263 AHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
            H  Y+D  K+ IS+ L + P  RPN+  +L+
Sbjct: 236 LHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 128/296 (43%), Gaps = 54/296 (18%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           ++   +  VG +  KI K I  G F +VY A   P        KV LK     +K+  N 
Sbjct: 31  FSSSELTEVGNY--KIQKQIGEGSFGKVYLATHRPT-----KQKVVLK---TGDKSDPNV 80

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + +    +V++ +E+C    L D + ++  +R
Sbjct: 81  VR------EVFYHRQFDYPYITKLYEVIVTET---KVWMALEYCPGKELYDHLLSK--SR 129

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           L   E   + +Q+T  +   H L    +HRD+K+ENVL+  +G  K+ DFG         
Sbjct: 130 LPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFG--------- 178

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K        T  Y +PEMI          K DIW+LG+ LY L   
Sbjct: 179 -------FTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGF--KVDIWSLGVILYTLLCG 229

Query: 243 TTPFEKGGDQAILHSRYQFLAHPIYSDRL-----KNLISWMLSQQPMQRPNICQVL 293
             PF++  D  +L  +      P+  +R+     +NLI  +LS+ P +RPN   +L
Sbjct: 230 CLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 135/282 (47%), Gaps = 50/282 (17%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIP--EKAGLNALRAEVNAMKLLK 80
           +ILK +  G F +VY A          ++++  ++V++    K   N +R      ++  
Sbjct: 38  RILKIVGEGSFGKVYLA----------SHRLTHQKVVLKMGSKNDPNVVR------EVFY 81

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
             +    YI       + +N    V++ +E+C    L +++   ++ R+   E  ++ SQ
Sbjct: 82  HRQFDYVYITKLYEVIVTENS---VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQ 136

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           +   +   H+++   +HRD+K+EN+L+   G+ K+ DFG            +E A     
Sbjct: 137 IVGAVFYAHSMK--CVHRDLKLENILLDKKGQAKLTDFGFT----------RECA--TKG 182

Query: 201 ILKNT--TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR 258
           IL+    T  Y +PE+I+    +    K D W+LGI LY + +   PF++  D   + ++
Sbjct: 183 ILETVCGTTVYMAPELIERKPYEGY--KIDTWSLGIILYTMIHGAMPFDEEDD---IKTK 237

Query: 259 YQFLAH-PIYSDRL-----KNLISWMLSQQPMQRPNICQVLE 294
           Y+ + + P Y D       K+LI  +L + P QRP++ QVL+
Sbjct: 238 YRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 97/193 (50%), Gaps = 16/193 (8%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +       + E ++  I+    +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++  G+ K+ DFG VSG IR       F           T  + +PE+I+  +C+  +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVIN-KQCKGYN 192

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQFLAHPIYSDRLKNLISWMLSQ 281
           EK+DIW+LGI  Y+L     P  K     ++ +   R     H  YS++ K  +S  L +
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 282 QPMQRPNICQVLE 294
            P QRP+I  +LE
Sbjct: 253 DPKQRPSIEALLE 265

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 30/276 (10%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG-LNALRAEVNAMKLLKG 81
           ++ + +  G F  VY A     D  TG N V +K V + E    ++ L  E+  +  L  
Sbjct: 35  EVQECVGKGNFGDVYKA----IDKSTG-NTVAIKVVNLEETDDEIDLLAQEIYFLAELH- 88

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           S ++  Y  +             ++++ME+C  G   D +    +  L E ++  I  ++
Sbjct: 89  SPYITNYFSTFVE-------DVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREI 141

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
            +G+  +H+ +   IHRDIK  N+L++ DG+ K+ DFG VSG +   R    F       
Sbjct: 142 LRGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRRDTFV------ 192

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILH---SR 258
               T  + +PE+I     Q  +EK+DIW+LGI +++L     P  +     +L    SR
Sbjct: 193 ---GTPFWMAPEVIARSE-QGYNEKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSR 248

Query: 259 YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
                   YS  ++  +S  L++ P +RP   ++L+
Sbjct: 249 RPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 133/292 (45%), Gaps = 37/292 (12%)

Query: 9   YTPGTVLSVGTHHAKILK-YIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG-- 65
           YTP     +   H  I+K  +  G F  VY A          TNKV   +V+  E     
Sbjct: 12  YTP----RISKAHNYIVKECVGRGNFGDVYRA------IDRTTNKVVAIKVVDLENTNER 61

Query: 66  LNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRL 125
           L  L  E+  +  LK S +++ YI +     LL++ +  ++++ME+C  G   D +    
Sbjct: 62  LEVLAQEIFFLAELK-SPYIINYITT-----LLEDAS--MWIVMEYCGGGSCSDLLKYYF 113

Query: 126 QNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPI 185
            N L E ++  I  ++ +G+  +H  +   IHRDIK  N+L++ +G  K+ DFG VSG +
Sbjct: 114 NNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQL 170

Query: 186 RPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTP 245
           +                   T  + +PE+      +  DEK DIW+LGI +++L     P
Sbjct: 171 KSTLRRGTIV---------GTPYWMAPEVAS-QNIEGYDEKIDIWSLGITVFELLKGVPP 220

Query: 246 FEKGGDQAILHSRYQFLA---HPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
             K     +L +  +  A      YSD  K+ ++  L + P +RP    +L+
Sbjct: 221 LVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 125/281 (44%), Gaps = 41/281 (14%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLK 80
           K  + I  G F  VY          T T +VC  +V+  + A   +  ++ E+  +  LK
Sbjct: 20  KRTEVIGRGKFGVVYKGYY------TKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLK 73

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
              ++  Y  S+       N T +++++ME+C  G L   +      ++ E  I  IM +
Sbjct: 74  QVPNITHYYGSYL------NDT-KLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRE 123

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           +    A MH  +  +IHRDIK  NVLI+ DG  K+CDFG  +               Q  
Sbjct: 124 LL--TALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTK 169

Query: 201 ILKNTTA---QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK----GGDQA 253
           I + T A    + +PE+I        D K DIW+LGI  Y++     P+ +       Q 
Sbjct: 170 IRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQL 227

Query: 254 ILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           I  S+   L    +S  LK +I+  L + P +RP+   +L+
Sbjct: 228 ITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 121/271 (44%), Gaps = 28/271 (10%)

Query: 27  YIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVV 86
           ++  GGFA+ +  +M   D      K   K  I  EKA  N L +E+   K ++  +++V
Sbjct: 103 FLGEGGFARCF--QMKDDDGKVFAAKTVAKISIKSEKAR-NKLLSEIQIHKNMR-HQNIV 158

Query: 87  CYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIA 146
            +ID              V++L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 159 HFIDCFE-------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTT 206
            MH+    +IHRD+K+ N+    D   K+ DFG  +  I    N +++           T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFGLAA--IINNENERKYTIC-------GT 258

Query: 207 AQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL----HSRYQFL 262
             Y +PE+I   +      + DIW+LG+ ++ +     PF+      I     H  Y F 
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 AHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
                S  +K LI  +LS  PM+RP I ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 139/331 (41%), Gaps = 61/331 (18%)

Query: 15  LSVGTHHAKILKYIASGGFAQVYSAEM----FPADTPTGTNKV-CLKRVIIPEKAGLNAL 69
           + V     +I + +  GG + VY  ++       D    T ++  LK++I P    ++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN-- 127
             E+   K  + S +V+  IDS   +   ++G+  +++++ + + G L D +N RL    
Sbjct: 83  MREIENYKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 128 RLKEYEILNIMSQVTQGIAAMHA---------------------------------LQPP 154
            + E E + IM  VT+G+  +H                                  L+  
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 155 LI-----------HRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           ++           HRDI   N+L S+DG   + D GS S       N  + + +Q  +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAILH 256
           N T  Y  PE+++L   Q +  K DIW+LG   Y L +  +PFE+           AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 SRYQFLAHPIYSDRLKNLISWMLSQQPMQRP 287
            +Y F  +  +S+ L ++I   +   P+QRP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 115/238 (48%), Gaps = 45/238 (18%)

Query: 73  VNAMKLLKGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLK 130
           +N + ++KGSKH  +V +IDS+     L +G  +++++ME+   G L D +   +   L 
Sbjct: 670 INEILVMKGSKHPNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRN 190
           E +I  +  +   G+  +H+    ++HRDIK +N+L+S +G  K+ DFG           
Sbjct: 720 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNIKLTDFGFC--------- 768

Query: 191 PQEFAFVQHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
               A V    LK TT      + +PE++     +    K DIW+LGI + ++     P+
Sbjct: 769 ----AQVNETTLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY 821

Query: 247 EKGGDQAILHSRY--------QFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
               ++  L + Y        +       SD LK+ + W LS  P QR +  ++LE+V
Sbjct: 822 L---NETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 133/296 (44%), Gaps = 52/296 (17%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KIL  I  G F +VY A+  P  T     KV LK     +K   N 
Sbjct: 27  FTSCGLKEVGNY--KILDQIGEGSFGKVYLAQHRPTHT-----KVVLKS---SDKNDPNI 76

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + +    +V++ +E+C    L D + +   +R
Sbjct: 77  VR------EVFYHRQFDYPYITKLYEVIITET---KVWMALEYCPGKELYDRVLS--MHR 125

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E + + +Q+  G+   H+L    +HRD+K+EN+L+   G+ K+ DFG         
Sbjct: 126 VPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLENILLDKSGDAKLTDFG--------- 174

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K T      T  Y +PE+I+         K DIW+LG+ LY +   
Sbjct: 175 -------FTRECMTKTTLETICGTTVYMAPELIERKSYDGF--KIDIWSLGVILYTMING 225

Query: 243 TTPF----EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           + PF    E   +  I+H   Q   + + +D  K+LI  +L++ P  RP + Q+L+
Sbjct: 226 SMPFDEDDETKTEWKIVHQTPQLNENIVTAD-AKDLILRLLAKNPNDRPTVEQILK 280

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 128/288 (44%), Gaps = 54/288 (18%)

Query: 17  VGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAM 76
           VG +  KILK I  G F +VY A   P        KV LK     +K   N +R      
Sbjct: 36  VGNY--KILKQIGEGSFGKVYLALHKPTHK-----KVVLKS---SDKTDPNVVR------ 79

Query: 77  KLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILN 136
           ++    +    YI       + +    +V++++E+C    L D++ ++   R+   E   
Sbjct: 80  EIFYHRQFDFPYITKLYEVIITET---KVWMVIEYCPNKELYDYLLSK--KRISLDESAR 134

Query: 137 IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAF 196
           I +Q+   +   H+L    +HRD+K+EN+L+  D   K+ DFG                 
Sbjct: 135 IFAQIVGAVYYAHSL--SCVHRDLKLENILLDKDNNAKLTDFG----------------- 175

Query: 197 VQHDILKNT-------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE-- 247
              D  KNT       T  Y +PE+  L R +    K DIWALGI LY +   T PF+  
Sbjct: 176 FTRDFSKNTQLETICGTTVYMAPEL--LRREKYDGYKIDIWALGILLYTIINGTMPFDED 233

Query: 248 --KGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
             K  +  I+ +   +  +  ++D   +L++ +LS+ P  RP I Q+L
Sbjct: 234 DPKKTELKIISASPDY-DNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 125/274 (45%), Gaps = 31/274 (11%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH--- 84
           + +G +++VY A            KVC KR II E   +  +  E N + LL  + H   
Sbjct: 18  LGNGSYSRVYKAVDRSDPQRVYAVKVCSKRHIIHENK-VKYVTIEKNTLNLLARANHPGI 76

Query: 85  VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQG 144
           V  +   H   +L        + +++F   G L+  +N     +  E    + ++Q+   
Sbjct: 77  VKLHSTFHDEENL--------YFVLDFAAGGELLSLLNR--VGKFTEPCARHFIAQLIDT 126

Query: 145 IAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKN 204
              +H+    +IHRD+K ENVL+  DG   V DFG+ +  I         +FV       
Sbjct: 127 TEFIHSQG--VIHRDLKPENVLLHRDGRLMVTDFGTATN-ITKENTEGGASFV------- 176

Query: 205 TTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAH 264
            TA+Y SPE++   +CQ     SD+WALG  LY+      PF +G ++     +   L +
Sbjct: 177 GTAEYVSPELLLYNQCQF---ASDVWALGCMLYQFIEGVPPF-RGENELHTFEKIVALEY 232

Query: 265 PIYSDR---LKNLISWMLSQQPMQRPNICQVLEE 295
           P  ++    + +L+  +L+  P QRP++  + ++
Sbjct: 233 PWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 134/297 (45%), Gaps = 56/297 (18%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK I  G F +VY A   P        KVCLK     +K   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNI 79

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + ++   +V++ +E+C    L D + +   +R
Sbjct: 80  VR------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYDHLLS--LHR 128

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q++  +   H++    +HRD+K+EN+L+  +G  K+ DFG         
Sbjct: 129 ISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG--------- 177

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K T      T  Y +PE+I          K D W+LG+ LY L   
Sbjct: 178 -------FTRECMTKTTLETVCGTTVYMAPELIGRKTYDGF--KIDTWSLGVILYTLITG 228

Query: 243 TTPFEKGGDQAILHSRYQFL-AHPIYSDRL-----KNLISWMLSQQPMQRPNICQVL 293
           + PF+   D     ++++ +   P Y  +L     K+LIS +L++ P +RP++ QVL
Sbjct: 229 SLPFD---DDDEAKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 133/297 (44%), Gaps = 37/297 (12%)

Query: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60
           ++HP      P T +   +    I + +  G F  VY A     D  TG   V +K + +
Sbjct: 21  LHHP------PDTAVEKPSQLYDIKECVGKGSFGDVYRA----IDKETG-EMVAVKIINL 69

Query: 61  PE-KAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLID 119
            E +  ++ L  E+  +  L+ +  V  Y  ++            ++++MEFC  G   D
Sbjct: 70  EETQDDIDVLAQEIYFLSELR-APFVTTYYKTYVE-------DVSMWIVMEFCGGGSCAD 121

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
            +    ++RL E ++  I+ +V  G+  +H+ +   IHRD+K  N+L++ +GE K+ DFG
Sbjct: 122 LLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG 179

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
            VSG I        F           T  + +PE+I   R    DEK+DIW+LGI   +L
Sbjct: 180 -VSGQIMATLKRNTFV---------GTPYWMAPEIIA--RDNGYDEKADIWSLGITAMEL 227

Query: 240 CYYTTPFEKGGDQAILHS---RYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
                P+ K     +L +   R        ++   ++ I+  L++ P  RP    +L
Sbjct: 228 LTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 133/297 (44%), Gaps = 56/297 (18%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK I  G F +VY A   P        KVCLK     +K   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNI 79

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + ++   +V++ +E+C    L D  +     R
Sbjct: 80  VR------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRR 128

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           L   E   + +Q++  +   H++    +HRD+K+EN+L+  +G  K+ DFG         
Sbjct: 129 LSLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG--------- 177

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K T      T  Y +PE+I+         K DIW+LG+ LY L   
Sbjct: 178 -------FTRECMTKTTLETVCGTTVYMAPELIERKTYDGF--KIDIWSLGVILYTLITG 228

Query: 243 TTPFEKGGDQAILHSRYQFL-AHPIYS-----DRLKNLISWMLSQQPMQRPNICQVL 293
             PF+   D   + ++++ +   P Y      D  K+LIS +L++ P +RP++ QVL
Sbjct: 229 YLPFD---DDDEVKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 135/333 (40%), Gaps = 61/333 (18%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV-----CLKRVIIPEKAGLN 67
           T + V     KI + +  GG + VY  ++           +      LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  ALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN 127
               E+   K  + S +V+  IDS   +   +NG+  +++++ + + G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 --RLKEYEILNIMSQVTQGIAAMH------------------------------------ 149
              + E E + IM  VT+G+  +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 150 --------ALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
                   A      HRDI   N+L S++G   + D GS S       +  + + +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAI 254
             N T  Y +PE+++L   Q +  K DIW++G   Y L +  +PFE+           AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRP 287
              +Y F  +  +S+ L N+I   +   P+QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 94/193 (48%), Gaps = 16/193 (8%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +     N + E ++  I SQV +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH--EQKKIHRDIKAAN 143

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G  K+ DFG VSG IR       F           T  + +PE++        D
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTFV---------GTPYWMAPEVVSK-ENDGYD 192

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAI---LHSRYQFLAHPIYSDRLKNLISWMLSQ 281
           EK+DIW+LGI +Y+L     P  K     +   L  R     H  YS   KN +S  L +
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 282 QPMQRPNICQVLE 294
            P+ R +  +++E
Sbjct: 253 NPVGRASAYEMVE 265

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 132/297 (44%), Gaps = 56/297 (18%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK I  G F +VY A   P        KVCLK     +K   N 
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNI 79

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + ++   +V++ +E+C    L D  +     R
Sbjct: 80  VR------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYD--HLLSLRR 128

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q++  +   H++    +HRD+K+EN+L+  +G  K+ DFG         
Sbjct: 129 ISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG--------- 177

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
                  F +  + K T      T  Y +PE+I+         K DIW+LG+ LY L   
Sbjct: 178 -------FTRECMTKTTLETVCGTTVYMAPELIERRTYDGF--KIDIWSLGVILYTLITG 228

Query: 243 TTPFEKGGDQAILHSRYQFL-AHPIYS-----DRLKNLISWMLSQQPMQRPNICQVL 293
             PF+   D     ++++ +   P Y      D  ++LIS +L++ P +RP++ QVL
Sbjct: 229 YLPFD---DDDEAKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 140/317 (44%), Gaps = 64/317 (20%)

Query: 25  LKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSK 83
           L  I  G    VY+A         GTN  V +K++ + ++     +   +N + ++KGSK
Sbjct: 658 LTKIGQGASGGVYTAYEL------GTNASVAIKQMNLEKQPKKELI---INEIMVMKGSK 708

Query: 84  H--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           H  +V +IDS+  +        +++++ME+   G L D +   +   L E +I  +  + 
Sbjct: 709 HRNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRET 758

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
             G+  +H+    +IHRDIK +N+L+S  GE K+ DFG               A +    
Sbjct: 759 LAGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFGFC-------------AQINEIN 803

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
           LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L +
Sbjct: 804 LKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRA 857

Query: 258 RYQF-------LAHPI-YSDRLKNLISWMLSQQPMQR---------PNICQVLEEVSRMQ 300
            Y         L  P    + L+N + W L+ +P QR         P + QV EE S + 
Sbjct: 858 LYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSLA 917

Query: 301 GVSSPMRNFYLLRAMQH 317
            +    R   +   M+H
Sbjct: 918 PLVKLARMKKIAEKMEH 934

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 127/284 (44%), Gaps = 34/284 (11%)

Query: 24  ILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLKG 81
           I + +  G F  VY A          + KV   +V+  E     +N L  E+  +  LK 
Sbjct: 19  IKQCVGRGNFGDVYKA------CEKVSGKVVAVKVVNLEHTDEDINLLAQEIFFLAELK- 71

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           S ++  YI +             ++++ME+C  G   D +       L E +   I  +V
Sbjct: 72  SPYITNYITTMTE-------DVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREV 124

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
            +G+  +H  +   IHRDIK  N+L++ +G+ K+ DFG VSG IR       F       
Sbjct: 125 LKGLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV------ 175

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAI---LHSR 258
               T  + +PE++        DEK+DIW+LGI +Y+L   + P  K     +   L  R
Sbjct: 176 ---GTPFWMAPEVVS-KDSDGYDEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKR 231

Query: 259 YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL--EEVSRMQ 300
              + H  YS   K+ ++  L + P  RP+  ++L  E V+ +Q
Sbjct: 232 KPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 123/269 (45%), Gaps = 34/269 (12%)

Query: 37  YSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHA 93
           YS  M      +G     KV  K  +I +K  +  +  E NA++ L  S+ +V    +  
Sbjct: 193 YSTVMLATAKDSGKKYAVKVLNKEYLIKQKK-VKYVNIEKNALQRLNNSRGIVKLFFTFQ 251

Query: 94  ARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQP 153
             S L       + L+E+   G  +  M  +    L E       +Q+  GI  +H+   
Sbjct: 252 DESSL-------YFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--K 300

Query: 154 PLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQ----EFAFVQHDILKNTTAQY 209
            +IHRDIK EN+L+  D + K+ DFG  +  I  P+N      EF  +        TA+Y
Sbjct: 301 GIIHRDIKPENILLDKDMKVKITDFG--TAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 210 RSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLA- 263
            SPE++ D Y    +D + DIWA G  ++++     PF+   +    Q ++  +Y F A 
Sbjct: 359 VSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG 414

Query: 264 HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
            P+    +++L+  +L + P QR  I Q+
Sbjct: 415 FPVV---VRDLVKRILLKVPEQRLTIPQI 440

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 138/304 (45%), Gaps = 47/304 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGS 82
           KILK +  G F +VY A            KV LK   +  K   N +R EV   +    S
Sbjct: 38  KILKIVGEGSFGKVYLASHCLTH-----QKVVLK---MGSKNDPNVVR-EVFYHRQFDYS 88

Query: 83  KHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVT 142
                Y        ++    Y V++ +E+C    L +++  +    L+E     + SQ+ 
Sbjct: 89  HITKLY-------EVIVTENY-VWMALEYCPGKELYEYLLAKKHIPLEE--CSELFSQIV 138

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDIL 202
             +   H+++   +HRD+K+EN+L+   G  K+ DFG            +E A     IL
Sbjct: 139 GAVYYAHSMK--CVHRDLKLENILLDKKGHAKLTDFGFT----------RECA--TKGIL 184

Query: 203 KNT--TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ 260
           +    T  Y +PE+I+    +    K D W+LGI LY + + T PF++  +   + ++Y+
Sbjct: 185 ETICGTTVYMAPELIERKPYEGY--KIDTWSLGIILYTMIHGTMPFDEVDE---VKTKYK 239

Query: 261 FLAH-PIYSDRL-----KNLISWMLSQQPMQRPNICQVLEE-VSRMQGVSSPMRNFYLLR 313
            + + P Y +       K LIS +L + P QRP++ QVL+    +  G+    R   ++R
Sbjct: 240 IVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPYGLKILERTEKVIR 299

Query: 314 AMQH 317
           A  H
Sbjct: 300 AQSH 303

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 121/272 (44%), Gaps = 42/272 (15%)

Query: 37  YSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVV-CYIDSH 92
           YS  M      +G     KV  K  +I +K  +  +  E NA++ L  S+ +V  Y    
Sbjct: 178 YSTVMLATSKESGKKYAVKVLSKEYLIRQKK-VKYVNIEKNALQRLNNSRGIVKLYFTFQ 236

Query: 93  AARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILN------IMSQVTQGIA 146
              SL        + L+E+   G  +  M        K+Y  LN        +Q+   I 
Sbjct: 237 DESSL--------YFLLEYAPNGDFLSIM--------KKYGSLNEDCACYYSAQIIDAID 280

Query: 147 AMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTT 206
            +H+    ++HRDIK EN+L+  D + K+ DFG+       P     +  +        T
Sbjct: 281 FLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGT 338

Query: 207 AQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQF 261
           A+Y SPE++ D Y    +D + DIWA G  L+++     PF+   +    Q ++  +Y F
Sbjct: 339 AEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAF 394

Query: 262 LA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
            A  P+    +++L+  +L +QP QR  I Q+
Sbjct: 395 TAGFPLV---VRDLVKGILIKQPAQRLTIPQI 423

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 129/284 (45%), Gaps = 49/284 (17%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKT--------VAKISIKSEKTKRKLLSEIQIHKSMKH 151

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           S ++V +ID     +        V++L+E C  G L+D +  R    L E E+    +Q+
Sbjct: 152 S-NIVQFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQI 201

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  +H+ +  +IHRD+K+ N+    D   KV DFG               A + +D 
Sbjct: 202 CGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLA-------------AVLANDR 246

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
            +  T      Y +PE++ + +      + DIW++G+ +Y L     PF+   D  +++ 
Sbjct: 247 ERKYTVCGTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYE 304

Query: 258 RYQFLAHPIYSDRLKN-----LISWMLSQQPMQRPNICQVLEEV 296
           R +   +    D+  +     LI  +LS  P+QRP I  ++++V
Sbjct: 305 RIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 139/331 (41%), Gaps = 73/331 (22%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFP----------ADTPTGTNKVCLKRVIIPE 62
           T + VG+    + K I  G FA V+ A +             D+ +  N  C    I+P 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 63  -----KAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGL 117
                K  L  L  E+  +K +    H+V  ID        +  + + +L+ME+C+ G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLKEYEILNIMSQVTQGIAAMHALQPPL 155
              +  R Q                      N L +  ILN + Q++  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRS--KNL 198

Query: 156 IHRDIKIENVLISA-----DGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ-- 208
           +HRDIK +N+L+SA     +      D G V     P     +F F +   L NT+    
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAET 256

Query: 209 ------YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ-- 260
                 Y +PE+++    Q  + K+D+W++G  LY++CY   PF K  +   L+ + +  
Sbjct: 257 LCGSPLYMAPEILNY---QKYNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIKKA 312

Query: 261 --FLAHPIY---SDRLKNLISWMLSQQPMQR 286
              +  P Y    + LK+LIS +L+  P +R
Sbjct: 313 NDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 134/287 (46%), Gaps = 55/287 (19%)

Query: 25  LKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSK 83
           L  I  G    VY+A         GTN  V +K++ + ++     +   +N + ++KGSK
Sbjct: 626 LTKIGQGASGGVYTA------YEVGTNASVAIKQMNLEKQPKKELI---INEILVMKGSK 676

Query: 84  H--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           H  +V +IDS+  +        +++++ME+   G L D +   +   L E +I  +  + 
Sbjct: 677 HQNIVNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRET 726

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
            +G+  +H+    +IHRDIK +N+L+S +GE K+ DFG               A +    
Sbjct: 727 LRGLQFLHS--KGVIHRDIKSDNILLSMNGEIKLTDFGFC-------------AQINEIN 771

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
           LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L +
Sbjct: 772 LKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRA 825

Query: 258 RYQF-------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
            Y         L  P + S  LK+ ++W L+  P  R +  ++L +V
Sbjct: 826 LYLIATNGTPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 131/284 (46%), Gaps = 51/284 (17%)

Query: 25  LKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH 84
           L  I  G    VY+A     D      ++ L++   P+K  +      +N + ++K SKH
Sbjct: 554 LVKIGQGASGGVYTAYEVGTDASVAIKQMNLEKQ--PKKELI------INEIIVMKDSKH 605

Query: 85  --VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVT 142
             +V +IDS      L  G  +++++MEF   G L D +   +   L E +I  +  +  
Sbjct: 606 PNIVNFIDS-----FLLKG--DLWVIMEFMEGGSLTDVVTHCI---LTEGQIGTVCRETL 655

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDIL 202
           +G+  +H+    +IHRDIK +N+L+S  G+ K+ DFG  +               +H++ 
Sbjct: 656 RGLQFLHSNG--VIHRDIKSDNILLSMKGDIKLTDFGFCA------------QINEHNLK 701

Query: 203 KNT---TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY 259
           + T   T  + +PE++     +    K DIW+LGI + ++     P+    ++  L + Y
Sbjct: 702 RTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIESEPPYL---NETPLRALY 755

Query: 260 QF-------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
                    L  P + SD L + +SW L   P +R +   +LE+
Sbjct: 756 LIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 114/246 (46%), Gaps = 25/246 (10%)

Query: 52  KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           KV  K  +I +K  +  +  E NA++ +  SK +V    +    S L       + L+E+
Sbjct: 208 KVLNKEYLIKQKK-VKYVNIEKNALQRINNSKMIVKLFFTFQDESSL-------YFLLEY 259

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C  G  +  M  +    L E       +QV   I  +H     +IHRDIK EN+L+  + 
Sbjct: 260 CPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEF 315

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWA 231
           + K+ DFG  +  I       +F  +        TA+Y +PE+++      +D + D+WA
Sbjct: 316 KIKLTDFG--TAKILDSSTNNKFDLLTRSKSFVGTAEYVAPELLN---DSFVDYRCDVWA 370

Query: 232 LGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQR 286
            G  LY++     PF+   +    Q ++  +Y F A  P+    +++L+  +L +   QR
Sbjct: 371 FGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVKDLNQR 427

Query: 287 PNICQV 292
           P+I Q+
Sbjct: 428 PSISQI 433

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 92/186 (49%), Gaps = 16/186 (8%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D + T   N L E ++  I  +V +G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQKK--IHRDIKAAN 143

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G+ K+ DFG VSG IR       F           T  + +PE+++       +
Sbjct: 144 ILLTDEGKVKLGDFG-VSGQIRATMKRGTFV---------GTPYWMAPEVVN-KESNGYN 192

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQFLAHPIYSDRLKNLISWMLSQ 281
           EK+DIW+LGI +Y+L     P  K     ++ S   R     H  YSD  K  ++  L +
Sbjct: 193 EKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHGQYSDVAKGFVAACLVK 252

Query: 282 QPMQRP 287
            P  RP
Sbjct: 253 DPNLRP 258

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/336 (22%), Positives = 135/336 (40%), Gaps = 57/336 (16%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLN---AL 69
           + +S+     +I K +  GG + VY  E    +         LK+   P  +  +   A+
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGEL------FALKKTRCPFGSIGSISPAM 70

Query: 70  RAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN-- 127
           +   N  +    S ++   +DS   +   ++G+  V++L+ +   G L D +N  L +  
Sbjct: 71  KEVANYQRF--SSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLKEYEILNIMSQVTQGIAAMHALQP---------------------------------- 153
           ++ E +IL +   + +G+  +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSP 212
               HRD+K  N++IS +    + D GS S       + Q     Q     N T  Y +P
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAP 246

Query: 213 EMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAILHSRYQFLAHP 265
           E++D+     I EK DIW+ G  +Y +C+  +PFE+           AI   +Y      
Sbjct: 247 EILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGT 306

Query: 266 IYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQG 301
            YS  L  LI   LS  P QRP++ +++  +  +QG
Sbjct: 307 SYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 145/318 (45%), Gaps = 46/318 (14%)

Query: 26  KYIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLK 80
           +++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K + 
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKT--------VAKISIKSEKTRKKLLSEIQIHKSMS 136

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
            + ++V +ID              V++L+E C  G L++ +  R    + E E+   M+Q
Sbjct: 137 HT-NIVQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQ 186

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           +  GI  MH+ +  +IHRD+K+ N+        K+ DFG  +  +      ++F      
Sbjct: 187 ICGGIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAA--VLANDRERKFTIC--- 239

Query: 201 ILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ 260
                T  Y +PE++ + +      + DIW++G+ LY L     PF+   D   ++ R +
Sbjct: 240 ----GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIK 293

Query: 261 --FLAHP---IYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFYLLRAM 315
               A+P     S   K LI  +LS  PM+RP+I ++++ V   +G   P    Y L ++
Sbjct: 294 QRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVW-FRGTFPP----YTLNSV 348

Query: 316 QHTNTSTSFITPPVSMVN 333
             T    S ITP  S +N
Sbjct: 349 MTTVPDYSHITPQESFMN 366

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 122/268 (45%), Gaps = 32/268 (11%)

Query: 26  KYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLKGSK 83
           K +  G F  VY A          + K+   +V+  E     +  L  E+  +  L+ S 
Sbjct: 19  KCVGRGNFGDVYKA------VEIKSGKIVAIKVVNLEHTNEDIELLSQEIFFLAELR-SP 71

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
           +V  Y+      +LL++ +  ++++ME+C  G   D +    +  L E +   I  +V +
Sbjct: 72  YVTKYL-----TTLLEDVS--IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLK 124

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  +H  +   IHRDIK  N+L++ DG  K+ DFG VSG I+       F         
Sbjct: 125 GLRYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIKATLKKDTFV-------- 173

Query: 204 NTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQ 260
             T  + +PE++        +EK+DIW+LGI +Y+L     P  K     ++ S   R  
Sbjct: 174 -GTPYWMAPEVVKKDE-SGYNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRA 231

Query: 261 FLAHPIYSDRLKNLISWMLSQQPMQRPN 288
              H  YS+  K+ IS  L + P  RPN
Sbjct: 232 PKLHGHYSEDAKSFISHCLIKDPNARPN 259

>TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1121

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 131/298 (43%), Gaps = 48/298 (16%)

Query: 15  LSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVN 74
           +S G +  K  + I  G ++ V  A    ++      KV  K  +I +K  +  +  E N
Sbjct: 236 ISKGINDFKFGEVIGDGSYSTVMLATSIESNQKYAV-KVLNKEYLIRQKK-VKYVNVEKN 293

Query: 75  AMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEI 134
            ++ L  S+ VV    +    + L       + L+E+   G  +  M        K+Y  
Sbjct: 294 TLQRLNNSRTVVKLFFTFQDEAHL-------YFLLEYAPNGDFLSVM--------KKYGT 338

Query: 135 LNIMSQVTQG---IAAMHALQPP-LIHRDIKIENVLISADGEYKVCDFGS--VSGPIRPP 188
           LN       G   I A+H +    +IHRDIK EN+L+  D + K+ DFG+  +  P+   
Sbjct: 339 LNEECACYYGAQIIDAIHFIHSKGIIHRDIKPENILLDGDMKVKLTDFGTAKILDPVTKV 398

Query: 189 RNPQEFAFVQHDILKNT-----TAQYRSPEMID----LYRCQAIDEKSDIWALGIFLYKL 239
            N         D+L  +     TA+Y +PE+++     YRC       DIWA G  L+++
Sbjct: 399 NNNNS-KTATFDLLTRSKSFVGTAEYVTPELLNDSYTDYRC-------DIWAFGCILFQM 450

Query: 240 CYYTTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
                PF+   +    Q ++  +Y F A  P+    +++L+  +L +QP QR  I  +
Sbjct: 451 IAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV---IRDLVKKILLKQPSQRLTISAI 505

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 130/292 (44%), Gaps = 41/292 (14%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+  G    K  + +  G ++ V  A    +       KV  K  +I +K  +  +  E 
Sbjct: 155 VIKKGIKDFKFGEVLGDGSYSTVMLARSIDSGKKYAV-KVLNKEYLIRQKK-VKYVNIEK 212

Query: 74  NAMKLLKGSKHVV-CYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEY 132
           N ++ L   + ++  Y       SL        + L+E+   G   DF++      +K+Y
Sbjct: 213 NTLQRLNDGRGIIKLYFTFQDEASL--------YFLLEYAPNG---DFLSV-----IKKY 256

Query: 133 EILN------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIR 186
             LN        +Q+   I  +H  Q  +IHRDIK EN+L+  D + K+ DFG+    + 
Sbjct: 257 GSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPENILLDKDMKVKLTDFGTAK-LVE 313

Query: 187 PPRNPQEFAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTP 245
                Q +  ++       TA+Y SPE++ D Y    +D K DIWA G  L+++     P
Sbjct: 314 KDETTQTYNLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPP 369

Query: 246 FEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
           F+   +    Q ++  +Y F A  P+    +++LI  +L + P QR +  QV
Sbjct: 370 FKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLIKQILVKNPEQRLDTLQV 418

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 147/322 (45%), Gaps = 45/322 (13%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKT--------VAKISIKTEKTKKKLLSEIQIHKSMK- 147

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V ++D        ++ T  V++L+E C+ G L+D M  R    L E E+    +Q+
Sbjct: 148 HPNIVHFVDC------FEDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQI 198

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              +  MH+ +  +IHRD+K+ N+    D   KV DFG  +  +      +++       
Sbjct: 199 CGAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAA--VLANNRERKYTVC---- 250

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW++G+ +Y L     PF+   D  +++ R   
Sbjct: 251 ---GTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKA 305

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFYLLRAMQ 316
             Y +      S   K LI+ +L   P++RP+I +++++V   +G+  P         M+
Sbjct: 306 CQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDVW-FRGIFPPK---ITEDVME 361

Query: 317 HTNTSTSFITPPVSMVNTNTFM 338
            T   T+ IT   S  N  T M
Sbjct: 362 LTPKDTNEITLEESFTNFRTCM 383

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 137/298 (45%), Gaps = 58/298 (19%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK I  G F +VY A   P        KV LK     +K+  N 
Sbjct: 26  FTSDELSEVGNY--KILKQIGEGSFGKVYLASHKPTH-----RKVVLK---TSDKSDPNL 75

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + +    +V++ +E+C    L + +   + +R
Sbjct: 76  VR------EVFYHRQFDFPYITKLYEVIVTET---KVWMALEYCPGRELYEHL--LMLHR 124

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q+   +   H+L    +HRD+K+EN+L+  +G  K+ DFG         
Sbjct: 125 IPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFG--------- 173

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMIDLYRCQAIDE-KSDIWALGIFLYKLCY 241
                  F +  + K++      T  Y +PE+I   + QA D  K DIW+LG+ LY +  
Sbjct: 174 -------FTRECVSKSSLETICGTTVYMAPELI---QRQAYDGFKIDIWSLGVILYTMIN 223

Query: 242 YTTPFEKGGDQAILHSRYQFL-AHPIYSDRL-----KNLISWMLSQQPMQRPNICQVL 293
            T PF++  +     ++++ +   P ++D       K+LI  +L++ P +RP + Q+L
Sbjct: 224 GTMPFDEDDETK---TKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 115/241 (47%), Gaps = 47/241 (19%)

Query: 72  EVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKE 131
           E+NA+KLL     V           +LQN  Y + +++EF + G    ++  + + RLKE
Sbjct: 103 EINALKLLTHPNIV-------RLEEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 132 YEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNP 191
                + +Q+  G+  MH+    L+HRD+K+EN+L+  +    + DFG V+         
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVN--------- 201

Query: 192 QEFAFVQHDILKNTTAQ--YRSPEMI---DLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            EF F  ++++K +     Y +PE++   + YR + +    DIW+ GI LY +     P+
Sbjct: 202 -EF-FGSNELMKRSCGSPCYAAPELVLSTEPYRARKV----DIWSCGIILYAMLAGYLPW 255

Query: 247 E------KGGDQAILHSRYQF-----LAHPIYSDRL-KNLISWMLSQQPMQRPNICQVLE 294
           +       G D   L   YQ+     L  P Y   L ++LI  +L+  P +R +I  + +
Sbjct: 256 DDDSQNPNGDDIGKL---YQYITKTALKFPAYISPLARDLIRKILTANPSRRISISYICK 312

Query: 295 E 295
            
Sbjct: 313 H 313

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 86/183 (46%), Gaps = 28/183 (15%)

Query: 116  GLIDFMN-TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
            G ID  +   L+  + EYE   I  QV   I  +H+    ++HRDIK ENV++ + G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEK-SDI 229
            + DFGS     SGP           FV        T  Y +PE++     +  D K  DI
Sbjct: 1152 LIDFGSAAYVKSGPFD--------VFV-------GTIDYAAPEVL---SGEPFDGKPQDI 1193

Query: 230  WALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNI 289
            WA+G+ LY + +   PF    +  IL    +F      S+   NLI  +L++ P QRP I
Sbjct: 1194 WAIGVLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTI 1251

Query: 290  CQV 292
             +V
Sbjct: 1252 DEV 1254

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 110/262 (41%), Gaps = 45/262 (17%)

Query: 56  KRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSH--AARSLLQNGTYE-VFLLMEFC 112
           K+V  P K     +  E+   K++  S H      +H  A R   Q G    +++++++C
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHH------NHIVALRDAFQWGKESCIYMILDYC 123

Query: 113 TAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGE 172
           +   L   +  R    L E E   +M Q+  GI  +H     +IH D+K+ N+L     +
Sbjct: 124 SNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQ 179

Query: 173 YKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS----- 227
            K+CDFGS       PR P E            T  Y +PE +  Y  + I++       
Sbjct: 180 LKICDFGSSFIATSSPRGPGEIM---------GTPYYLAPETV--YTHKNINKSGMAILL 228

Query: 228 -----DIWALGIFLYKLCYYTTPFEKGGD-----------QAILHSRYQFLAHPIYSDRL 271
                DIW++GI LY L Y   PF K  D           Q I     +F  +       
Sbjct: 229 ISFPIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGA 288

Query: 272 KNLISWMLSQQPMQRPNICQVL 293
           + LI  MLSQ P++R  + +++
Sbjct: 289 QQLILKMLSQNPLERITLVEIV 310

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 129/278 (46%), Gaps = 34/278 (12%)

Query: 24  ILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSK 83
            L  +  G ++ VY A            KVC K+ II EK  +  +  E + + +L    
Sbjct: 12  FLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNMLAKGG 70

Query: 84  H---VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
           H   V  +   H   +L        + ++E+ + G L+  +  RL  RL E    +I +Q
Sbjct: 71  HLGIVKLFCTFHDIENL--------YFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQ 120

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG-SVSGPIRPPRNPQEFA-FVQ 198
           +   +  MH+    +IHRD+K ENVL+S +G   + DFG + +   R   N +  A FV 
Sbjct: 121 LVDTVDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFV- 177

Query: 199 HDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAI 254
                  TA+Y SPE++   +C      SDIWALG  +Y+L     PF    +    + I
Sbjct: 178 ------GTAEYVSPELLLHSQCGF---SSDIWALGCIIYQLNQGKPPFRGENELQTFEKI 228

Query: 255 LHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
           +   Y++L     S ++ +++  +L   P++RP+  Q+
Sbjct: 229 VALDYKWLFSN--SPQVVSIVQSILVTDPLKRPSAAQL 264

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 127/278 (45%), Gaps = 44/278 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIP--EKAGLNALRAEVNAMKLLK 80
           KI K+I  G F +VY A          T+++  ++V++    K   N +R      ++  
Sbjct: 38  KISKFIGEGSFGKVYLA----------THRLTHQKVVLKTGNKRDPNVVR------EVFY 81

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
             +    YI       + ++    V++++E+C+   L + +    + RL   E   + SQ
Sbjct: 82  HRQFDFPYITKLYEVIVTES---RVWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQ 136

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAF-VQH 199
           +   +   H L+   +HRD+K+ENVL+  +G  K+ DFG            +E A   Q 
Sbjct: 137 IASAVYYAHELK--CVHRDLKLENVLLDGNGHAKLTDFGFT----------REMATRSQL 184

Query: 200 DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAIL 255
           + +  TT  Y +PE+I+         K DIW+LGI LY +     PF++  D      I+
Sbjct: 185 ETICGTTV-YMAPELIERKCYDGF--KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIV 241

Query: 256 HSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
           +    F    I  D + +LI  ML + P +R ++ QVL
Sbjct: 242 NDELDFNQEWISDDAI-DLIQGMLRKNPNERISLAQVL 278

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 130/283 (45%), Gaps = 44/283 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLK 80
           +IL+ I  G F  VY A          TN++   +V+  E     ++ L  E+  +  L+
Sbjct: 21  EILQCIGRGNFGDVYKARYL------ATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELR 74

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
                  YI ++    L+      ++++ME+C  G   + +    +++L E +   I+S+
Sbjct: 75  SP-----YITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           V  G+  +H+ +   IHRDIK  N+L++ +G  K+ DFG VSG +   R    F      
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV----- 178

Query: 201 ILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ 260
                T  + +PE+ID  + +  +E +DIW+LGI + +L     P +K      L     
Sbjct: 179 ----GTPFWMAPEVIDRNK-KGYNEMADIWSLGITVIELLMGHPPLDKYDAMKAL----- 228

Query: 261 FLAHPI---------YSDRLKNLISWMLSQQPMQRPNICQVLE 294
            +A P          +S   K+ ++  L + P QRP   ++L+
Sbjct: 229 -MAIPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 85/187 (45%), Gaps = 30/187 (16%)

Query: 116  GLIDFMN-TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
            G ID  +   L+N + E E+  I  Q+  GI  +H     +IHRDIK ENV++ A G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  VCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMI--DLYRCQAIDEKSD 228
            + DFGS     SGP           FV        T  Y +PE++  D Y  +      D
Sbjct: 1330 LIDFGSAAHVKSGPFD--------VFV-------GTIDYAAPEVLSGDPYEGKP----QD 1370

Query: 229  IWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPN 288
            IWA+GI LY + +   PF    +  IL     F      S   K LIS +L++   +RP 
Sbjct: 1371 IWAIGILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPT 1428

Query: 289  ICQVLEE 295
            I  +  +
Sbjct: 1429 IDDIYND 1435

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/351 (22%), Positives = 144/351 (41%), Gaps = 71/351 (20%)

Query: 15  LSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV-------CLKRVIIP--EKAG 65
           +S+      I + +  G  + VY  +   + T TG+  +        LKR+  P      
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRL 125
           ++A   EV+  K  + S +++  +DS   +   ++G+  + +L+ +   G L D +N   
Sbjct: 86  ISAAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVN--- 139

Query: 126 QNRLK-----EYEILNIMSQVTQGIAAMH----------------------------ALQ 152
           +N LK     E E + IM  + +G+  +H                               
Sbjct: 140 RNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDD 199

Query: 153 PPL----------------IHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAF 196
            PL                +HRDI++ N+L S++G   V D GS            +   
Sbjct: 200 TPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNE 259

Query: 197 VQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK-----GGD 251
           +Q  +  N +  Y +PE++++     ID K+DIW++G   Y + +  +PFE+     G  
Sbjct: 260 LQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGAS 319

Query: 252 --QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
              AI   +Y F     YS+ L  +I   L   P  RP+I ++L+ +  +Q
Sbjct: 320 LTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {ON}
           Anc_5.591 YDR466W
          Length = 808

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 100/223 (44%), Gaps = 29/223 (13%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH--- 84
           +  G ++ VY A            KVC K  II E   +  +  E N + LL  + H   
Sbjct: 19  LGHGAYSTVYKALDKRNLKKAYAIKVCSKNHIIKENK-VKYVNIEKNTLNLLGKTNHPGI 77

Query: 85  VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQG 144
           +  Y   H  ++L        + ++++   G L+  ++ +      E    + M Q+   
Sbjct: 78  IKLYYTFHDKQNL--------YFVLDYAKGGELLSLLHIQTNGTFDELYSKHFMVQIIDT 129

Query: 145 IAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEF-AFVQHDILK 203
           +  +H+    +IHRD+K EN+L+   G+  + DFG+ S    PP N     +FV      
Sbjct: 130 LEYIHSCG--IIHRDLKPENLLLDKWGKLMITDFGAAS----PPANMSTCSSFV------ 177

Query: 204 NTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
             TA+Y SPE++   +C+     SD+WALG  LY+    T PF
Sbjct: 178 -GTAEYVSPELLLFNQCKF---ASDVWALGCILYQFINGTPPF 216

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 134/299 (44%), Gaps = 42/299 (14%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+ +G    K  + +  G ++ V  A    +       KV  K  +I +K  +  +  E 
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAV-KVLSKEYLIRQKK-VKYVTVEK 174

Query: 74  NAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYE 133
            A++ L G+K ++    +    + L       + L+E+ + G   DF+       +K+Y 
Sbjct: 175 LALQKLNGTKGIIRLFFTFQDEASL-------YFLLEYASHG---DFLGL-----IKKYG 219

Query: 134 ILN------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRP 187
            LN        SQ+   + ++HA+   +IHRDIK EN+L+  D + K+ DFG+       
Sbjct: 220 SLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPENILLDKDMKVKLTDFGTAKILPEQ 277

Query: 188 PRNPQE----FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYY 242
           P N  +    F           TA+Y SPE++ D Y     D + DIWA G  LY++   
Sbjct: 278 PSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILYQMVAG 333

Query: 243 TTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             PF+   +    Q ++  +Y F A  P+ +   K+L+  +L ++P  R  + Q+   V
Sbjct: 334 KPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDLVKKLLVREPNDRLTVEQIKAHV 389

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +     N L E ++  I+ +VT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G  K+ DFG VSG IR       F           T  + +PE++    C  +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV---------GTPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF----LAHPIYSDRLKNLISW 277
              EK+DIW+LGI  Y+L     P  K     ++ +  +     L  P +SD  K+ ++ 
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSDAAKDFVAG 251

Query: 278 MLSQQPMQRPNICQVL 293
            L + P  RP+   +L
Sbjct: 252 CLVKTPADRPSAYNLL 267

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 113/240 (47%), Gaps = 23/240 (9%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++MEFC  G   D +    ++RL E ++  I+ +V  G+  +H+ +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ DGE K+ DFG VSG I        F           T  + +PE+I   +    +
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRTTFV---------GTPYWMAPEII-AKKDNGYN 216

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQFLAHPIYSDRLKNLISWMLSQ 281
           EK+DIW+LGI   +L     P+ K     +L +   R        ++   ++ I+  L +
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK 276

Query: 282 QPMQRPNICQVLEE----VSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTF 337
            P  RP+  ++L       +  +G  +  R   L++A++     T++   P   V  N +
Sbjct: 277 DPDLRPSAAELLGHKFLNKASWRGSGTLKREVDLVKALK---KRTNYFKEPRHSVEDNVY 333

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 127/273 (46%), Gaps = 32/273 (11%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLKGSKHV 85
           +  G F  VY A     D  TG  ++   +V+  E +   +  +  E+  +  LK S ++
Sbjct: 27  VGRGNFGDVYKA----IDKLTG--EIVAIKVVNLESSDEDIELIAQEIFFLAELK-SPYI 79

Query: 86  VCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGI 145
             YI      ++L++ +  ++++ME+C  G   D +       L E ++  I   V +G+
Sbjct: 80  TNYI-----TTMLEDVS--MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGL 132

Query: 146 AAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT 205
             +H  +   IHRD+K  NVL++ DG  K+ DFG VSG +R       F           
Sbjct: 133 QYLHEQRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAKRNTFV---------G 180

Query: 206 TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQFL 262
           T  + +PE+I        +EK+DIW+LGI +Y+L     P+ K     ++ +   +    
Sbjct: 181 TPYWMAPEIIS-NSSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQD 239

Query: 263 AHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
               +SD  K  IS  L + P +RP   ++L++
Sbjct: 240 CMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 134/290 (46%), Gaps = 56/290 (19%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLL 79
           +A ++K I  G    VY+A         GTN  V +K++ + ++     +   +N + ++
Sbjct: 599 YANLVK-IGQGASGGVYTAYEI------GTNVSVAIKQMNLEKQPKKELI---INEILVM 648

Query: 80  KGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNI 137
           KGSKH  +V +IDS+  +        +++++ME+   G L D +   +   L E +I  +
Sbjct: 649 KGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAV 698

Query: 138 MSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFV 197
             +   G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG               A +
Sbjct: 699 CRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFC-------------AQI 743

Query: 198 QHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQA 253
               LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++ 
Sbjct: 744 NELNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NET 797

Query: 254 ILHSRYQF-------LAHPI-YSDRLKNLISWMLSQQPMQRPNICQVLEE 295
            L + Y         L  P   S  LK  + W L  +P +R +  ++L +
Sbjct: 798 PLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 847

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 130/271 (47%), Gaps = 32/271 (11%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLKGSKHV 85
           I  G F  VY A+       T  N+V   +V+  E +   +  L  E+  +  LK S +V
Sbjct: 11  IGRGNFGDVYKAK------DTWLNEVVAVKVVNLENSEEEVELLAQEIFFLAELK-SPYV 63

Query: 86  VCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGI 145
             YI      +++++ +  +++ ME+C  G + D +     + L E++   I  ++ +G+
Sbjct: 64  TNYI-----ATVVEDVS--MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGL 116

Query: 146 AAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT 205
           + +H+ +   IHRDIK  N+L++ +G+ K+ DFG VSG +        F           
Sbjct: 117 SYLHSQRK--IHRDIKAANILLTDEGKVKLSDFG-VSGKLLSSFRRDTFV---------G 164

Query: 206 TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS---RYQFL 262
           T  + +PE++  +  +  DE++DIW+LGI + ++   + P  K     ++ +   R    
Sbjct: 165 TPYWMAPEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPK 223

Query: 263 AHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
            H  +SD  K+ ++  L ++   RP    +L
Sbjct: 224 LHGDFSDDAKHFVALCLIKESAIRPTAADLL 254

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 129/288 (44%), Gaps = 55/288 (19%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           K L  I  G    VY+A         GTN  V +K++ + ++     +   +N + ++K 
Sbjct: 668 KNLIKIGQGASGGVYTA------YEVGTNASVAIKQMNLEKQPKKELI---INEILVMKA 718

Query: 82  SKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
           SKH  +V +IDS+  R        +++++ME+   G L D +   +   L E +I  +  
Sbjct: 719 SKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSR 768

Query: 140 QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
           +  +G+  +H+    +IHRDIK +NVL+S  GE K+ DFG               A +  
Sbjct: 769 ETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFGFC-------------AQINE 813

Query: 200 DILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL 255
             LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L
Sbjct: 814 INLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPL 867

Query: 256 HSRYQFLAHPI--------YSDRLKNLISWMLSQQPMQRPNICQVLEE 295
            + Y    +           SD LK+ + W L   P +R    Q+L +
Sbjct: 868 RALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 102/227 (44%), Gaps = 35/227 (15%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R E+  +  LK + ++  Y  S+   + L       +++ME+C  G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTKL-------WVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           ++E  I  IM ++   + ++H  +  +IHRDIK  N+LI+ +G  K+CDFG         
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVA------- 159

Query: 189 RNPQEFAFVQHDILKNTTAQ----YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTT 244
                 A +   +LK  T      + +PE+I        D K DIW+LGI  Y++     
Sbjct: 160 ------AQLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 245 PF----EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRP 287
           P+         Q I  S+   L    YS  LK  I+  L + P +RP
Sbjct: 212 PYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 133/300 (44%), Gaps = 60/300 (20%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  +I+K +  G F +VY A          T+K+  ++V++   A    
Sbjct: 26  FTASELREVGNY--RIVKQVGEGSFGKVYLA----------THKLTHQKVVLKTGA---- 69

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSL-LQNGTYEV-------FLLMEFCTAGGLIDF 120
                      K   +VV  +  H           YEV       ++ +E+C    L D+
Sbjct: 70  -----------KSDPNVVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDY 118

Query: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180
           +   L+ R+   E   + +Q+   +   H+LQ   +HRD+K+EN+L+  +G   + DFG 
Sbjct: 119 L--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLENILLDKNGYAMLTDFGF 174

Query: 181 VSGPIRPPRNPQEFAF-VQHDILKNTTAQYRSPEMIDLYRCQAID-EKSDIWALGIFLYK 238
                      +E A   Q + +  TT  Y +PE+I   + +A D  K D W+LGI LY 
Sbjct: 175 T----------RECATKTQLETVCGTTV-YMAPELI---KREAYDGYKVDTWSLGIILYT 220

Query: 239 LCYYTTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           + +   PF++         I+H     L     S + K+LI  +L +   QRPN+ +VL+
Sbjct: 221 MLHGYMPFDEDDTVRTGLKIMHEEPAVL-DEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQ 279

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 92/195 (47%), Gaps = 22/195 (11%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G  K+ DFG VSG +R       F           T  + +PE++    C  +D
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTFV---------GTPYWMAPEVV----CCEVD 187

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGDQAI---LHSRYQFLAHPIYSDRLKNLISWM 278
              EK+DIW+LGI  Y+L     P  K     +   L  R        +SD  K  ++  
Sbjct: 188 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGC 247

Query: 279 LSQQPMQRPNICQVL 293
           L + P  RP+   +L
Sbjct: 248 LVKVPADRPSAYDLL 262

>Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {ON}
           YJR059W (PTK2) - putative serine)/threonine kinase
           involved in spermine metabolism [contig 43] FULL
          Length = 735

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 98/234 (41%), Gaps = 53/234 (22%)

Query: 35  QVYSAEMFPA---DTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDS 91
           +VY+ + F     + P    K C K  I+ ++   NA  A  N   L+K S         
Sbjct: 302 EVYALKKFKLLRNEKPEHFYKRCSKEFILAKRLSHNAHVA--NTFYLVKVSTSTFM---- 355

Query: 92  HAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHAL 151
                     T     +ME+CT G L   ++     +    E      QV +GI  +H+ 
Sbjct: 356 ----------TRGWAFVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIHSQ 405

Query: 152 QPPLIHRDIKIENVLISADGEYKVCDFG----------SVSGPIR--------PPRN-PQ 192
              ++HRDIK ENVLIS +G  K+ DFG           ++ P+R        PP + P+
Sbjct: 406 G--VVHRDIKPENVLISKEGIAKMTDFGISDWGNEDPDDLTSPVRLFDTYVGSPPYSAPE 463

Query: 193 EFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
             AF   D    +T Q R P   D Y       K D WALG+ L+ L Y  TPF
Sbjct: 464 VVAFKDED----STYQDRKP--YDAY-------KMDCWALGVLLFTLVYQCTPF 504

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 125/280 (44%), Gaps = 53/280 (18%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH--V 85
           I  G    VY+A     +      ++ L++   P+K  +      +N + ++KGSKH  +
Sbjct: 335 IGQGASGGVYTAYELGTNASVAIKQMNLEKQ--PKKELI------INEILVMKGSKHSNI 386

Query: 86  VCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGI 145
           V +IDS+  +        +++++ME+   G L D +   +   L E +I  +  +  +G+
Sbjct: 387 VNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLKGL 436

Query: 146 AAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT 205
             +H+    +IHRDIK +N+L+S +G+ K+ DFG               A +    LK T
Sbjct: 437 QFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFC-------------AQINEVNLKRT 481

Query: 206 TA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF 261
           T      + +PE++     +    K DIW+LGI + ++     P+    ++  L + Y  
Sbjct: 482 TMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRALYLI 535

Query: 262 LAHPI--------YSDRLKNLISWMLSQQPMQRPNICQVL 293
             +           SD LK  + W L   P  R N  ++L
Sbjct: 536 ATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 104/217 (47%), Gaps = 20/217 (9%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+E+ + G L+  +  +      E   +   +Q+   I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 165 VLISADGEYKVCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMI-DLYR 219
           +L++ D + K+ DFG+            ++   F  ++       TA+Y SPE++ D Y 
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 220 CQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLI 275
               D + DIWA G  L++L     PF+   +    Q I+  +Y F A   +   L++LI
Sbjct: 449 ---TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAG--FPTILRDLI 503

Query: 276 SWMLSQQPMQRPNICQVLEEV-SRMQGVSSPMRNFYL 311
             +L + P  R  I Q+   +  R +  S+P   +YL
Sbjct: 504 KKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 92/195 (47%), Gaps = 22/195 (11%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 141

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G  K+ DFG VSG IR       F           T  + +PE++    C  +D
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTFV---------GTPYWMAPEVV----CCEVD 187

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGDQAI---LHSRYQFLAHPIYSDRLKNLISWM 278
              EK+DIW+LGI  Y+L     P  K     +   L  R        +S+  K  ++  
Sbjct: 188 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGC 247

Query: 279 LSQQPMQRPNICQVL 293
           L + P  RP+   +L
Sbjct: 248 LVKAPADRPSAYDLL 262

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 108/227 (47%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--------LNALRAEVNAMKLL 79
            I  G F  VY A     +  TG   + +K+V +PE +         + AL++EV+ +K L
Sbjct: 1044 IGKGSFGAVYLA----LNVTTG-EMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL 1098

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         +NG Y +FL  E+   G +   +  R+  R  +  I ++  
Sbjct: 1099 -NHVNIVQYLGFEE-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTK 1148

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S   R   N     +   
Sbjct: 1149 QVLEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDFG-IS---RKSNN----IYSNS 1198

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D         K DIW+LG  + ++     P+
Sbjct: 1199 DMTMRGTVFWMAPEMVDT--AHGYSAKVDIWSLGCVVLEMFAGKRPW 1243

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 134/292 (45%), Gaps = 56/292 (19%)

Query: 19  THHAKILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMK 77
           T +A ++K I  G    VY+A         GTN  V +K++ + ++     +   +N + 
Sbjct: 618 TKYANLVK-IGQGASGGVYTAYEI------GTNVSVAIKQMNLEKQPKKELI---INEIL 667

Query: 78  LLKGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEIL 135
           ++KGSKH  +V +IDS+  +        +++++ME+   G L D +   +   L E +I 
Sbjct: 668 VMKGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIG 717

Query: 136 NIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFA 195
            +  +   G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG               A
Sbjct: 718 AVCRETLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFC-------------A 762

Query: 196 FVQHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD 251
            +    LK TT      + +PE++     +    K DIW+LGI + ++     P+    +
Sbjct: 763 QINELNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY---LN 816

Query: 252 QAILHSRYQF-------LAHPI-YSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           +  L + Y         L  P   S  LK  + W L  +P  R +  ++L +
Sbjct: 817 ETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 132/298 (44%), Gaps = 40/298 (13%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+ +G    K  + +  G ++ V  A    +       KV  K  +I +K  +  +  E 
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSVVLATARESGKKYAV-KVLSKEYLIRQKK-VKYVTVEK 174

Query: 74  NAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYE 133
            A++ L G+K ++    +    + L       + L+E+   G   DF+       +K+Y 
Sbjct: 175 LALQKLNGTKGIIRLFFTFQDEASL-------YFLLEYAPHG---DFLGL-----IKKYG 219

Query: 134 ILNIM------SQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRP 187
            LN +      SQ+   + ++H++   +IHRDIK EN+L+  D + K+ DFG+       
Sbjct: 220 SLNEICARYYASQIIDAVDSLHSI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQ 277

Query: 188 PRNPQE----FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYY 242
           P N  +    F           TA+Y SPE++ D Y     D + DIWA G  LY++   
Sbjct: 278 PSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILYQMLAG 333

Query: 243 TTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             PF+   +    Q ++  +Y F A   +   +K+L+  +L + P  R  I Q+   V
Sbjct: 334 KPPFKAANEYLTFQKVMKIQYAFTAG--FPQIVKDLVKKLLVRDPNDRLAIEQIKAHV 389

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 128/281 (45%), Gaps = 40/281 (14%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGS 82
           +IL+ I  G F  VY A    ++       V L+    P    ++ L  E+  +  L+  
Sbjct: 21  EILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELRSP 76

Query: 83  KHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVT 142
                YI ++    L+      ++++ME+C  G   + +    ++++ E +   I+S+V 
Sbjct: 77  -----YITNYKTAFLVD---VSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDIL 202
            G+  +H+ +   IHRDIK  N+L++ +G  K+ DFG VSG +   R    F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------- 178

Query: 203 KNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFL 262
              T  + +PE+ID  + Q  +E +DIW+LGI + +L     P +K      L      +
Sbjct: 179 --GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLDKYDAMKAL------M 229

Query: 263 AHPI---------YSDRLKNLISWMLSQQPMQRPNICQVLE 294
           A P          +S   ++ ++  L + P QRP   ++L+
Sbjct: 230 AIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 116/273 (42%), Gaps = 41/273 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNAMKLLK 80
           K  + I  G F  VY            T ++C  +V+  + +   +  ++ E+  +  LK
Sbjct: 27  KRTEVIGRGKFGVVYKGYHI------RTKQICAIKVLNLDTSEDEVEDVQKEIQFLSSLK 80

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
              ++  Y  S+   + L       +++ME+C  G L   +      ++ E  I  IM +
Sbjct: 81  QVPNITHYYGSYLYDTKL-------WIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRE 130

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           +   +  +H  +  +IHRDIK  NVLI+ DG  K+CDFG  +               Q +
Sbjct: 131 LLVALLYIH--KDNVIHRDIKAANVLITNDGRVKLCDFGVAA------------QLTQSN 176

Query: 201 ILKNTTA---QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQA 253
           + + T A    + +PE+I        D K DIW+LGI  Y++     P+         Q 
Sbjct: 177 VRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQL 234

Query: 254 ILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
           I  S+   L    YS  LK  I+  L + P +R
Sbjct: 235 ITKSKPPRLEGRQYSPLLKEFIALCLDEDPKER 267

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/322 (24%), Positives = 143/322 (44%), Gaps = 45/322 (13%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K ++ 
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKT--------VAKLSIKTEKTRKKLLSEIQIHKSMRH 157

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           + ++V +ID     +        V++L+E C  G L++ +  R    L E E+    +Q+
Sbjct: 158 A-NIVQFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQI 207

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
             GI  MH+ +  +IHRD+K+ N+    +   K+ DFG  +       N +E  +     
Sbjct: 208 CGGIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAA----VLANDRERKYTV--- 258

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW++G+ +Y L     PF+   D   ++ R   
Sbjct: 259 --CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKC 314

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFYLLRAMQ 316
             + F      S   + L+  +LS  P++RP+I +VL+ V   +G+  P   +     M 
Sbjct: 315 CDFVFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYVW-FRGIFPP---YIQSDVMT 370

Query: 317 HTNTSTSFITPPVSMVNTNTFM 338
                   IT   SMVN  T M
Sbjct: 371 EVPDYEKKITMQESMVNFRTCM 392

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 135/289 (46%), Gaps = 42/289 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKT--------VAKLSIKSEKTRKKLLSEIQIHKSMK- 137

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
            ++VV +ID        ++ T  V++L+E C  G L+D +  R    L E E+    +Q+
Sbjct: 138 HQNVVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQI 188

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+    +   K+ DFG  +       N +E  +     
Sbjct: 189 CGAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAA----VLANDRERKYTV--- 239

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW++G+ LY L     PF+   D   ++ R   
Sbjct: 240 --CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKC 295

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSP 305
             + F      S+  K LI  +LS  P++RP+I ++++ V   +G+  P
Sbjct: 296 CDFSFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPP 343

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 140/334 (41%), Gaps = 55/334 (16%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIP--EKAGLNALR 70
           + +SV  H   I + +  GGF+ VY  E            + LK++  P      ++   
Sbjct: 17  SYVSVNGHRYHIKRLLGEGGFSFVYLVE------SRENGLMALKKIRCPFGSIGSISPAM 70

Query: 71  AEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN--R 128
            EV+  +  K S ++   IDS   +   ++G+  V++L+ + + G L D +N  L +  +
Sbjct: 71  KEVDNYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPP---------------------------------- 154
           + E E++ +   V +G+  +H   P                                   
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 155 -LIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPE 213
              H DIK  N++IS++G   + D GS S       + Q     Q    ++ T  + +PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 214 MIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD-------QAILHSRYQFLAHPI 266
           ++D+     I EK D+W+ G  +Y +C+  +PFE+           ++   +Y   +   
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTN 307

Query: 267 YSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300
           YS  L +++   L+  P  RP++ +++  +  +Q
Sbjct: 308 YSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 124/262 (47%), Gaps = 50/262 (19%)

Query: 60  IPEKAGLNALRAEVNAMKLLKGS-KHVVCYIDSHAARSL-----------LQNGTYEVFL 107
           +P++  +  +R +     ++KGS K +  Y + +A + L           LQN  Y + +
Sbjct: 100 VPKQVAIKLIRRDA----IVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKY-IGI 154

Query: 108 LMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLI 167
           ++E+ + G    ++  + + RLKE    N+ SQ+  G+  MH     L+HRD+K+EN+L+
Sbjct: 155 VLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHC--KGLVHRDLKLENLLL 210

Query: 168 SADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ--YRSPEMIDLYRCQAIDE 225
              G   + DFG V+          EF+    +++K +     Y +PE++   R      
Sbjct: 211 DKYGNLIITDFGFVN----------EFSKFS-ELMKTSCGSPCYAAPELVISTRPYEA-R 258

Query: 226 KSDIWALGIFLYKLCYYTTPFE------KGGDQAILHSRYQF-----LAHPIY-SDRLKN 273
           K+DIW+ GI L+ +     P++       G D A L   Y++     L  P Y S   ++
Sbjct: 259 KADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKL---YKYITTTPLKFPEYISPMARD 315

Query: 274 LISWMLSQQPMQRPNICQVLEE 295
           L+  +L   P +R  + Q+L+ 
Sbjct: 316 LLRNILIPYPQKRATLKQILKH 337

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 114/253 (45%), Gaps = 37/253 (14%)

Query: 52  KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           K+  +  I+        +  E+NA+K L     +V          +LQN  Y + +++E+
Sbjct: 90  KLIRRDTIVRNSDKETKIYREINALKHLTHPNIIVL-------EEILQNSKY-IGIVLEY 141

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
            + G    ++  +   RLKE     + SQ+  G+  MH+    L+HRD+K+EN+L+  + 
Sbjct: 142 ASGGEFYKYIQRK--RRLKEVNASRLFSQLVSGVHYMHS--KGLVHRDLKLENLLLDKNE 197

Query: 172 EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ---YRSPEMIDLYRCQAIDEKSD 228
              + DFG V+             F   ++L  T+     Y +PE++ + R   +  K D
Sbjct: 198 NLMITDFGFVN------------EFSNENVLMKTSCGSPCYAAPELV-VSREAYVGVKVD 244

Query: 229 IWALGIFLYKLCYYTTPFE------KGGDQAILHSRYQF--LAHPIYSDRL-KNLISWML 279
           IW+ G+ LY +     P++       G D + L+S      L  P Y + L ++L+  +L
Sbjct: 245 IWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPDYVNPLPRDLLRRIL 304

Query: 280 SQQPMQRPNICQV 292
              P +R  +  +
Sbjct: 305 VADPRRRYTLGHI 317

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 103/204 (50%), Gaps = 22/204 (10%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+ + G L+D++   +Q+  L+E+        V   +  +HA    ++HRD+KIEN
Sbjct: 201 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGVASALQYLHANN--IVHRDLKIEN 255

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           ++IS  GE K+ DFG +S      +    F           +  + +PE+  L     I 
Sbjct: 256 IMISTSGEIKIIDFG-LSNVFDTRKQLHTFC---------GSLYFAAPEL--LKANPYIG 303

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWMLSQ 281
            + DIW+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S ML  
Sbjct: 304 PEVDIWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVEYPNHLSIEVISLLSKMLVV 362

Query: 282 QPMQRPNICQVLEEVSRMQGVSSP 305
            P++R N+ +V+E    ++G   P
Sbjct: 363 DPLKRANLTKVIEHPWMIRGYDFP 386

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 93/199 (46%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++E+   G L D++  R   +L E E ++   Q+ QG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLISADGE-YKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTA---QYRSPEMIDLYR 219
           N+L+    +  K+ DFG               A    + L  T+     Y SPE++   +
Sbjct: 194 NLLLDKKNKTVKIADFGMA-------------ALETTNRLLETSCGSPHYASPEIVMGQK 240

Query: 220 CQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL----HSRYQFLAHPIYSDRLKNLI 275
                  SD+W+ GI L+ L     PF     + +L    H RYQ  ++   S   K+LI
Sbjct: 241 YHG--SPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDLI 296

Query: 276 SWMLSQQPMQRPNICQVLE 294
           S +L   P +R  + ++LE
Sbjct: 297 SKILVVDPEKRITVDKILE 315

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 131/293 (44%), Gaps = 31/293 (10%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAE 72
           T++  G    K    +  G ++QV+ A      + T   KV  K  +I +K  +  +  E
Sbjct: 109 TIIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKK-VKYVNIE 167

Query: 73  VNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEY 132
             A++ LK    V+         S        ++ L+E+   G  +  +  +    L E 
Sbjct: 168 KTALQNLKSVTGVINL-------SFTFQDEANLYFLLEYAPNGDFLSLI--KKFGTLNEE 218

Query: 133 EILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQ 192
             +   +Q+   I +MH+    +IHRDIK EN+L+  + + K+ DFG+        +   
Sbjct: 219 CTIYYSAQIIDAIGSMHS--HGIIHRDIKPENILLDGNMKIKLTDFGTAK---LLQKKSD 273

Query: 193 EFAFVQHDILKNT-----TAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
           +     +++L  +     TA+Y SPE++ D Y     D K DIWA G  +Y++     PF
Sbjct: 274 KNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPF 329

Query: 247 EKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
           +   +    Q ++  ++ F A   +   +++L+  +L +QP +R  I Q+ E 
Sbjct: 330 KATNEYLTFQKVMKVQFAFTAG--FPTIIRDLVKNILVKQPEKRLTIPQIKEH 380

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 134/290 (46%), Gaps = 56/290 (19%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLL 79
           +A ++K I  G    VY+A         GTN  V +K++ + ++     +   +N + ++
Sbjct: 622 YANLVK-IGQGASGGVYTAYEI------GTNVSVAIKQMNLEKQPKKELI---INEILVM 671

Query: 80  KGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNI 137
           KGS+H  +V +IDS+  +        +++++ME+   G L D +   +   L E +I  +
Sbjct: 672 KGSRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAV 721

Query: 138 MSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFV 197
             +   G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG               A +
Sbjct: 722 CRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFC-------------AQI 766

Query: 198 QHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQA 253
               LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++ 
Sbjct: 767 NELNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY---LNET 820

Query: 254 ILHSRYQF-------LAHPI-YSDRLKNLISWMLSQQPMQRPNICQVLEE 295
            L + Y         L  P   S  LK  + W L  +P +R +  ++L +
Sbjct: 821 PLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHD 870

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 127/284 (44%), Gaps = 24/284 (8%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+  G +  K  + +  G ++ V  A    ++      K+  K  +I +K  +  +  E 
Sbjct: 147 VIKKGINDFKFGETLGDGSYSTVLLATSIESNKKYAV-KILNKEYLIKQKK-VKYVNIEK 204

Query: 74  NAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYE 133
           N ++ LK +K ++    +    S L       + L+E+   G L+  M  R    + E  
Sbjct: 205 NTLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNEKC 255

Query: 134 ILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQE 193
                +Q+   +  MH     +IHRD+K EN+L+  D + K+ DFG+         +  +
Sbjct: 256 TQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLK 313

Query: 194 FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD- 251
           +  +        TA+Y SPE++ D Y    +D + DIWA G  L+++     PF+   + 
Sbjct: 314 YDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPPFKANNEY 369

Query: 252 ---QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
              Q ++  ++ F A   +   +++L+  +L + P +R  I Q+
Sbjct: 370 LTFQKVMKVQFAFTAG--FPMTVRDLVKNILIKNPERRLLINQI 411

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 95/196 (48%), Gaps = 24/196 (12%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G   D +     N L E ++  I+ QVT G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +L++ +G  K+ DFG VSG IR       F           T  + +PE++    C  +D
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTFKRDTFV---------GTPYWMAPEVV----CCEVD 192

Query: 225 ---EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF----LAHPIYSDRLKNLISW 277
              EK+DIW+LGI  Y+L     P  K     ++ +  +     L  P +S+  K  ++ 
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP-FSEAAKEFVAG 251

Query: 278 MLSQQPMQRPNICQVL 293
            L + P  RP+   +L
Sbjct: 252 CLVKTPADRPSAYDLL 267

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 88/181 (48%), Gaps = 20/181 (11%)

Query: 116  GLIDFMN-TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
            G ID  +    +  + E+E   I  Q+  GI+ +H  +  ++HRDIK ENV++ A G  K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 175  VCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEK-SDIWALG 233
            + DFGS +     P +     FV        T  Y SPE++   R +  + K  DIWALG
Sbjct: 1152 LIDFGSAAYVKNGPFD----VFV-------GTIDYASPEVL---RGEKYEGKPQDIWALG 1197

Query: 234  IFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
            I LY + +   PF    +  IL    +F      S    +LI  +L++  ++RP+I  + 
Sbjct: 1198 ILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDIS 1255

Query: 294  E 294
            E
Sbjct: 1256 E 1256

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 136/297 (45%), Gaps = 54/297 (18%)

Query: 13  TVLSVG--THHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALR 70
           T++S G  + H K L  I  G    V++A     D+      V +K++ + ++     + 
Sbjct: 666 TIVSEGDPSKHYKDLVKIGQGASGGVFTAH----DSRDENRLVAIKQMNLQKQPKKELI- 720

Query: 71  AEVNAMKLLKGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
             +N + ++KGS+H  +V +IDS+  +        +++++ME+   G L D +   +   
Sbjct: 721 --INEIIVMKGSRHENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI--- 768

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           L E +I  +  +   G+A +H+    +IHRDIK +N+L+S +G+ K+ DFG         
Sbjct: 769 LTEGQIGTVCKETLGGLAFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFC------- 819

Query: 189 RNPQEFAFVQHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTT 244
                 A +    LK TT      + +PE++     +    K DIW+LGI + ++     
Sbjct: 820 ------AQINEVHLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEP 870

Query: 245 PFEKGGDQAILHSRYQFLAH--PIYSD------RLKNLISWMLSQQPMQRPNICQVL 293
           P+    ++  L + Y    +  P   D       LK  + W L+  P +R    ++L
Sbjct: 871 PY---LNETPLRALYLIATNGTPQLKDPENLGEILKKFLDWCLTVNPEERATALELL 924

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 132/284 (46%), Gaps = 49/284 (17%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K ++ 
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKT--------VAKISIKSEKTRKKLLSEIQIHKSMRH 147

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             +VV +ID        ++ T  V++L+E C  G L++ +  R    + E E+   M+Q+
Sbjct: 148 F-NVVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQI 197

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+    +   K+ DFG               A + +D 
Sbjct: 198 CGAIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLA-------------AVLANDR 242

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
            +  T      Y +PE++ + +      + DIW++G+ +Y L     PF+   D  +++ 
Sbjct: 243 ERKYTVCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYE 300

Query: 258 R-----YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
           R     + F      S+  K LI  +LS  P++RP+I ++++ V
Sbjct: 301 RIKNRDFAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 100/207 (48%), Gaps = 28/207 (13%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E+        +   +  +HA    ++HRD+KIEN+
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENI 295

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRCQ 221
           +IS  GE K+ DFG +S    P      F     F   ++LK   + Y  PE+       
Sbjct: 296 MISTSGEIKIIDFG-LSNMFDPRTQLHTFCGSLYFAAPELLK--ASPYVGPEV------- 345

Query: 222 AIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWM 278
                 D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S M
Sbjct: 346 ------DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVDYPQHLSIEVISLLSKM 398

Query: 279 LSQQPMQRPNICQVLEEVSRMQGVSSP 305
           L   P +R ++ QV+E    ++G   P
Sbjct: 399 LVVDPRKRASLKQVVEHHWMIRGYDFP 425

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 30/195 (15%)

Query: 106  FLLMEFCTAGGLIDFMN-TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
            ++ +E     G ID  +   L+  + E+E   I  Q+  GI  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 165  VLISADGEYKVCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMI--DLY 218
            V++ ++G  K+ DFGS     +GP           FV        T  Y +PE++  + Y
Sbjct: 935  VIVDSNGFVKLIDFGSAAYTKTGPFE--------VFV-------GTIDYAAPEILGGNPY 979

Query: 219  RCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWM 278
            + +      DIWALG+ LY L Y   PF    +  IL  + +F      +    +LI W+
Sbjct: 980  KGKP----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWI 1033

Query: 279  LSQQPMQRPNICQVL 293
            L++    RP+I +++
Sbjct: 1034 LTKSVNDRPSIDEIV 1048

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+   + L       +++ME+C  G L   +      +
Sbjct: 66  VQREIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLR---PGK 115

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM +V   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +   +  
Sbjct: 116 IDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS 173

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK 248
              Q  A          T  + +PE+I        D K DIW+LGI  Y++     P+ +
Sbjct: 174 LRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCE 222

Query: 249 ----GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I+ S+   L    YS  LK  I+  L + P +R
Sbjct: 223 VEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 123/235 (52%), Gaps = 49/235 (20%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLL 79
           +A ++K I  GG A VY+A         GTN  V +K++ + ++     +   +N + ++
Sbjct: 613 YANLVK-IGRGGSALVYTA------YEVGTNLSVAIKQINLEKQPRKQLI---LNEIIVM 662

Query: 80  KGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNI 137
           K S+H  +V +IDS+     L +G  +++++ME+  AG L D +   +   L+E +I  +
Sbjct: 663 KKSQHPNIVNFIDSY-----LVDG--KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAV 712

Query: 138 MSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFV 197
             +V +G+  +H+    +IHRDIK +NVL+S DG+ K+ DFG              F   
Sbjct: 713 CREVLKGLVFLHS--KGVIHRDIKSDNVLLSMDGDIKLTDFG--------------FCAQ 756

Query: 198 QHDI--LKNT---TAQYRSPEMID-LYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            +DI   +NT   T  + +PE+++  + C  +    DIW+LG+ + ++     P+
Sbjct: 757 LNDIHLKRNTMVGTPYWMAPEIVEKKHYCPKV----DIWSLGVMIIEMIEGEPPY 807

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 103/224 (45%), Gaps = 33/224 (14%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH--- 84
           +  G ++ VY A            KVC K+ II EK  +  +  E N + LL  ++H   
Sbjct: 18  LGHGSYSTVYKAVDRTNANRVYAIKVCSKQHIIKEKK-VKYVTIEKNTLNLLTRARHPGI 76

Query: 85  VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQG 144
           V  +   H   +L        + ++++   G L+  ++     R+K +  +       Q 
Sbjct: 77  VKLHYTFHDEENL--------YFVLDYAPGGELLSLLH-----RMKTFSEMWACHFTCQL 123

Query: 145 IAAMHALQPP-LIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           I +M  L    +IHRD+K EN+L++ +G   + DFG+ +G      + +  +FV      
Sbjct: 124 IDSMQFLHSQGIIHRDLKPENLLLNNEGRLMITDFGTATGT-----DSRGSSFV------ 172

Query: 204 NTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE 247
             TA+Y SPE++   +C   D  SDIWALG  +Y+    + PF 
Sbjct: 173 -GTAEYVSPELLLHNQC---DVSSDIWALGCMIYQFLQGSPPFR 212

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 100/207 (48%), Gaps = 28/207 (13%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E+        +   +  +HA    ++HRD+KIEN+
Sbjct: 178 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENI 233

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRCQ 221
           +IS  GE K+ DFG +S      +    F     F   ++LK   + Y  PE+       
Sbjct: 234 MISTSGEIKIIDFG-LSNLFDKSKQLHTFCGSLYFAAPELLK--ASPYTGPEV------- 283

Query: 222 AIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWM 278
                 D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S M
Sbjct: 284 ------DVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLSKM 336

Query: 279 LSQQPMQRPNICQVLEEVSRMQGVSSP 305
           L   P +R ++ QV+E    ++G   P
Sbjct: 337 LVVDPHRRASLKQVVEHHWMVRGYDGP 363

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 128/288 (44%), Gaps = 55/288 (19%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           K L  I  G    VY+A         GTN  V +K++ + ++     +   +N + ++K 
Sbjct: 667 KSLIKIGQGASGGVYTA------YEVGTNASVAIKQMNLEKQPKKELI---INEILVMKA 717

Query: 82  SKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
           SKH  +V +IDS+  R        +++++ME+   G L D +   +   L E +I  +  
Sbjct: 718 SKHANIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSR 767

Query: 140 QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
           +  +G+  +H+    +IHRDIK +N+L+S  GE K+ DFG               A +  
Sbjct: 768 ETLKGLQFLHS--KGVIHRDIKSDNILLSMTGEIKLTDFGFC-------------AQINE 812

Query: 200 DILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL 255
             LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L
Sbjct: 813 INLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPL 866

Query: 256 HSRYQFLAHPI--------YSDRLKNLISWMLSQQPMQRPNICQVLEE 295
            + Y    +           SD LK  + W L   P +R    ++L +
Sbjct: 867 RALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 75/315 (23%), Positives = 141/315 (44%), Gaps = 61/315 (19%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLL 79
           +A ++K I  G    VY+A         GTN  V +K++ + ++     +   +N + ++
Sbjct: 661 YASLVK-IGQGASGGVYTAYEI------GTNVSVAIKQMNLEKQPKKELI---INEILVM 710

Query: 80  KGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNI 137
           KGSKH  +V +IDS+  +        +++++ME+   G L D +   +   L E +I  +
Sbjct: 711 KGSKHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAV 760

Query: 138 MSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFV 197
             +   G+  +H+    ++HRDIK +N+L+S +G+ K+ DFG               A +
Sbjct: 761 CRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFC-------------AQI 805

Query: 198 QHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQA 253
               LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++ 
Sbjct: 806 NELNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NET 859

Query: 254 ILHSRYQF-------LAHPI-YSDRLKNLISWMLSQQPMQRPNICQVLE-----EVSRMQ 300
            L + Y         L  P   S  LK  + W L  +P +R +   +L      E++   
Sbjct: 860 PLRALYLIATNGTPKLKEPENLSSYLKKFLDWCLCVEPEERASATDLLHDEYITEIAEAN 919

Query: 301 GVSSPMRNFYLLRAM 315
              +P+     L+ +
Sbjct: 920 STLAPLVKLARLKKL 934

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 129/280 (46%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKT--------VAKLSIKSEKTRRKLLSEIQIHKSMKN 139

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V +ID        ++ T  V++L+E C  G L+D +  R    L E E+    +Q+
Sbjct: 140 V-NIVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQI 189

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+    D   K+ DFG  +       N +E  +     
Sbjct: 190 CGAIKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAA----VLANDRERKYTV--- 240

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW++G+ LY L     PF+   D   ++ R   
Sbjct: 241 --CGTPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKC 296

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F      S   K LI  +LS  P++RP++ ++++ V
Sbjct: 297 CDFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 129/291 (44%), Gaps = 44/291 (15%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KI+K I  G F +VY A   P        KV LK     +K   N 
Sbjct: 26  FTAEELSEVGNY--KIMKQIGEGSFGKVYLASHKPTH-----RKVVLK---TSDKNDPNV 75

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R      ++    +    YI       + +    +V++ +E+C    L + +      R
Sbjct: 76  VR------EVFYHRQFDYLYITRLYEVIVTET---KVWMALEYCPGKELYEHLLA--LKR 124

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q+   I   H+L    +HRD+K+EN+L+   G  K+ DFG     +   
Sbjct: 125 ISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECVSKS 182

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK 248
                    Q D +  TT  Y +PE+ +         K DIWALG+ LY +   + PF++
Sbjct: 183 ---------QLDTICGTTV-YMAPELTERKSYDGF--KIDIWALGVILYTMINGSMPFDE 230

Query: 249 GGDQAILHSRYQF------LAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
             D+A   ++++       +   + S   K+LI  +L++ P +RP+I ++L
Sbjct: 231 -DDEA--KTKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 117/274 (42%), Gaps = 41/274 (14%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIP-EKAGLNA---LRAEVNAMKLLKGSK 83
           +  G F +VY         P+G   +C  +V+   E    N     + E++    L    
Sbjct: 124 LGKGKFGKVYCVR----HKPSGL--ICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKN 177

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
               Y   H +++        V+L+ME+   G L   +  +    + +    N + Q+T 
Sbjct: 178 LTKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTD 227

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
            +  MH  +  +IHRD+K EN+LI  + + K+ DFG     I  P N +           
Sbjct: 228 ALNYMH--KRKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC------ 276

Query: 204 NTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQA----ILHSRY 259
             T  Y SPE+I     +  DE  D+WALGI  Y+L     PFE+   +     I  S  
Sbjct: 277 -GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDL 332

Query: 260 QFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVL 293
           +F   P  S   ++LI+ +L   P +R N+ QV+
Sbjct: 333 KF--PPNVSSEARDLITNLLKVVPSERFNLQQVM 364

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 127/267 (47%), Gaps = 49/267 (18%)

Query: 48  TGTNKV-------CLKRVIIPEKAGLNA-LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQ 99
           TG+N+V        ++R  +P+ +     +  E+NA+K L     V           +LQ
Sbjct: 66  TGSNEVPKQVAIKLIRRDTVPKNSDKEVKIYREINALKHLTHPNIVRL-------EEVLQ 118

Query: 100 NGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRD 159
           N  Y + +++E+ + G    ++  +   RLKE+    + +Q+  G+  MH+    L+HRD
Sbjct: 119 NSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHS--KGLVHRD 173

Query: 160 IKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ--YRSPEMIDL 217
           +K+EN+L+  +    + DFG V+          EF   +++++K +     Y +PE++  
Sbjct: 174 LKLENLLLDKNENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPELVVT 222

Query: 218 YRCQAIDEKSDIWALGIFLYKLCYYTTPFE------KGGDQAILHSRYQF-----LAHPI 266
            +      K+DIW+ G+ +Y +     P++      +G D A L   Y +     L  P 
Sbjct: 223 TKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKL---YHYITKTPLKFPE 278

Query: 267 YSDRL-KNLISWMLSQQPMQRPNICQV 292
           Y + + ++L+  +L   P +R N+ QV
Sbjct: 279 YINPVPRDLLRRILVSNPKKRLNLRQV 305

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLN--------ALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+ +  N        ALR+EV+ +K L
Sbjct: 1184 IGKGSFGAVY----LCLNVTTG-EMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL 1238

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         +N  Y +FL  E+   G +   +  R+  R  E  I ++ +
Sbjct: 1239 -DHLNIVQYLGFEN-----KNNIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTT 1288

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S      R  ++  +   
Sbjct: 1289 QVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNS 1338

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1339 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCIVLEMFAGKRPW 1383

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 129/278 (46%), Gaps = 42/278 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGS 82
           +IL+ I  G F +VY A   P        KV LK      K+  N +R EV   +  +  
Sbjct: 38  RILRQIGEGSFGKVYLAHHLPTH-----RKVVLKS---SAKSDPNVVR-EVFYHRQFEFP 88

Query: 83  KHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVT 142
                Y        ++   T +V++ +E+C    L + +  RL  R+   E   + +Q++
Sbjct: 89  YITKLY-------EIIVTET-KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQIS 138

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDIL 202
             +   H+L    +HRD+K+EN+L+   G  K+ DFG            +E A    +IL
Sbjct: 139 GAMYYAHSLN--CVHRDLKLENILLDKVGNAKLTDFGFT----------RECA--SKNIL 184

Query: 203 KNT--TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQAILH 256
           +    T  Y +PE+I   R      K D+W+LG+ LY L     PF    +K  +  I++
Sbjct: 185 ETICGTTVYMAPELIKRERYDGF--KIDVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVN 242

Query: 257 SRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
               F +  +  D + +L+S +L++ P+ RP++ +VLE
Sbjct: 243 EMPSFDSTLLGPDAV-DLLSKLLAKDPIDRPSMKEVLE 279

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 20/194 (10%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G L   +      ++ E  I  IM ++   +  +H  +  +IHRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAAN 142

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           VLI+ +G+ K+CDFG  +   +     Q  A          T  + +PE+I        D
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYD 191

Query: 225 EKSDIWALGIFLYKLCYYTTPF----EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLS 280
            K DIW+LGI  Y++     P+         Q I+ S+   L    Y+ +LK  I+  L 
Sbjct: 192 TKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLD 251

Query: 281 QQPMQRPNICQVLE 294
           + P +R +  ++L+
Sbjct: 252 EDPQERLSAEELLK 265

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 115/247 (46%), Gaps = 39/247 (15%)

Query: 28  IASGGFAQV---YSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA-LRAEVNAMKLLKGSK 83
           +  G F +V   ++    P + P       ++R  I + A     +  E+NA+K L    
Sbjct: 52  LGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVKIYREINALKHLTHPN 111

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
             + Y++      +LQN  Y + +++EF + G    ++  + + RLKE     + +Q+  
Sbjct: 112 --IIYLEE-----VLQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLIS 161

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  MH+    L+HRD+K+EN+L+       + DFG V+          EF F  +++++
Sbjct: 162 GVDYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVN----------EF-FEDNELMR 208

Query: 204 NTTAQ--YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK------GGDQAIL 255
            +     Y +PE++   +      K+D+W+ G+ LY +     P++       G D A L
Sbjct: 209 TSCGSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 256 HSRYQFL 262
              YQ++
Sbjct: 268 ---YQYI 271

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 125/275 (45%), Gaps = 41/275 (14%)

Query: 32  GFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA-LRAEVNAMKLLKGSKHVVCYID 90
           G+++  S+ M   D P       ++R  IP+ +     +  E+NA+K L     V     
Sbjct: 57  GWSKTSSSSM---DVPKQVAIKLIRRDTIPKNSEKEVKIYREINALKHLNHPNIVRL--- 110

Query: 91  SHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHA 150
                 +LQN  Y + +++E+ + G    ++  +   RLKE     + +Q+  G+  MH+
Sbjct: 111 ----EEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHS 163

Query: 151 LQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ-- 208
               L+HRD+K+EN+L+  +    + DFG V+          EF   +++++K +     
Sbjct: 164 KG--LVHRDLKLENLLLDKNENLLITDFGFVN----------EF-LPENELMKTSCGSPC 210

Query: 209 YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE------KGGDQAILHSRYQFL 262
           Y +PE++   R      K+DIW+ G+ +Y +     P++       G D   L+ RY   
Sbjct: 211 YAAPELVVTARPYEA-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLY-RYITR 268

Query: 263 AHPIYSDRL----KNLISWMLSQQPMQRPNICQVL 293
               + D +    ++L+  +L   P +R  I Q L
Sbjct: 269 TPLKFPDYIAPVPRDLLRAILVADPKKRITIAQTL 303

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 135/294 (45%), Gaps = 51/294 (17%)

Query: 24  ILKYIASGGFAQV-----YSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNALRAEVNA 75
           ILK I    F +V     YS  M      T      KV  K  +I +K  +  +  E NA
Sbjct: 204 ILKGIKDFKFGEVLGDGSYSTVMLATSIETKKKYAVKVLSKEYLIKQKK-VKYVNIEKNA 262

Query: 76  MKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEIL 135
           ++ L  S+ +V    +    + L       + L+E+   G   DF++      +K++  +
Sbjct: 263 LQKLNNSRGIVRLFFTFQDEASL-------YFLLEYAPNG---DFLSL-----IKKFGSM 307

Query: 136 N------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPR 189
           N        +Q+   I  +H+    +IHRDIK EN+L+ ++ + K+ DFG+ +  + P  
Sbjct: 308 NEDCASYYSAQIIDAIHFVHSRG--IIHRDIKPENILLDSEMKVKLTDFGT-AKILEPKS 364

Query: 190 NPQEFAFVQHDILKNT-----TAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYT 243
           +        +D+L  +     TA+Y SPE++ D Y     D + DIWA G  ++++    
Sbjct: 365 SSSSSKHETYDLLTRSKSFVGTAEYVSPELLNDSY----ADSRCDIWAFGCIVFQMIAGK 420

Query: 244 TPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
            PF+   +    Q ++  +Y F A  P+    +++L+  +L + P QR  I Q+
Sbjct: 421 PPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKRILIKAPEQRLTISQI 471

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 129/283 (45%), Gaps = 55/283 (19%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH-- 84
            I  G    VY+A         GTN  V +K++ + ++     +   +N + ++KGSKH  
Sbjct: 842  IGQGASGGVYTAYEI------GTNASVAIKQMNLEKQPKKELI---INEILVMKGSKHKN 892

Query: 85   VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQG 144
            +V +IDS+    LL+    +++++ME+   G L D +   +   L E +I  +  +  +G
Sbjct: 893  IVNFIDSY----LLKG---DLWVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRG 942

Query: 145  IAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKN 204
            +  +H+    +IHRDIK +N+L+S DG  K+ DFG               A +    LK 
Sbjct: 943  LHFLHS--KGVIHRDIKSDNILLSMDGNIKLTDFGFC-------------AQINESNLKR 987

Query: 205  TTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ 260
            TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L + Y 
Sbjct: 988  TTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRALYL 1041

Query: 261  FLAH--PIYSDR------LKNLISWMLSQQPMQRPNICQVLEE 295
               +  P   D       LK  ++W L   P  R    ++L +
Sbjct: 1042 IATNGTPKLKDAGSLSSVLKRFLNWCLHVNPENRATAVELLSD 1084

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 128/296 (43%), Gaps = 38/296 (12%)

Query: 10  TPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNAL 69
           T   V+  G    K  + I  G ++ V  A    +       KV  K  +I +K  +  +
Sbjct: 158 TTKQVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKKYAV-KVLNKEYLIRQKK-VKYV 215

Query: 70  RAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRL 129
             E  A++ L  S+ ++    +    + L       + L+E+   G   DF++      +
Sbjct: 216 NIEKIALQRLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNG---DFLSV-----M 260

Query: 130 KEYEILN------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS--V 181
           K+Y  LN        +Q+   I  MH     +IHRDIK EN+L+  D + K+ DFG+  +
Sbjct: 261 KKYGSLNEECACYYGAQILDAIGFMHTRG--IIHRDIKPENILMDKDMKVKITDFGTAKI 318

Query: 182 SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLC 240
                   N   +  +        TA+Y SPE++ D Y     D + DIWA G  LY++ 
Sbjct: 319 LDEKTNGNNKTSYELLTRSKSFVGTAEYVSPELLNDNYS----DSRCDIWAFGCILYQMI 374

Query: 241 YYTTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
               PF+   +    Q ++  +Y F A   +   +++LI  +L + P QR  I Q+
Sbjct: 375 AGKPPFKATNEYLTFQKVMKVQYAFTAG--FPTIIRDLIKRILLKVPEQRLTIGQI 428

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLN--------ALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+ +  N        ALR+EV+ +K L
Sbjct: 1187 IGKGSFGAVY----LCLNVTTG-EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1241

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         +N  Y +FL  E+   G +   +  R+  R  E  I ++ +
Sbjct: 1242 -DHLNIVQYLGFEN-----KNSIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTT 1291

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S      R  ++  +   
Sbjct: 1292 QVLRGLAYLHS--KGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNS 1341

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1342 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCIVLEMFAGKRPW 1386

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 109/234 (46%), Gaps = 49/234 (20%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGL---------NALRAEVNAMKL 78
            I  G F  V+ A     +  TG   + +K+V +P K GL         +ALR EV+ +K 
Sbjct: 1146 IGKGSFGAVFLA----MNITTG-EMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKD 1199

Query: 79   LKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIM 138
            L    ++V Y+   A     +NG Y +FL  E+   G +   +  R+  R  +  I ++ 
Sbjct: 1200 L-DHLNIVQYLGFEA-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLT 1249

Query: 139  SQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQ 198
             QV QG++ +H+    ++HRD+K +N+L+  DG  K+ DFG               +   
Sbjct: 1250 IQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG--------------ISRKS 1293

Query: 199  HDILKNT------TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            +DI  N+      T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1294 NDIYSNSEMTMKGTVFWMAPEMVDTK--QGYSAKVDIWSLGCIVLEMFAGKRPW 1345

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 119/282 (42%), Gaps = 43/282 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--------LNALRAEVNAMKLL 79
            I  G F  V+       +  TG   + +K+V +P            L ALR+EV  +K L
Sbjct: 1152 IGKGSFGSVF----LGLNVTTG-EMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL 1206

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
              + ++V Y+         +N  Y   L +E+   G +   +  RL  +  E  I  +  
Sbjct: 1207 DHT-NIVQYLG-------FENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAV 1256

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G++ +H+ +  ++HRD+K +N+L+  DG  K+ DFG     I    N     +   
Sbjct: 1257 QVLRGLSYLHSKK--ILHRDMKADNLLLDVDGICKISDFG-----ISKKSNN---IYSNS 1306

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY 259
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+      A +    
Sbjct: 1307 DMTMRGTVFWMAPEMVDTK--QGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIG 1364

Query: 260  QFLAHP--------IYSDRLKNLISWMLSQQPMQRPNICQVL 293
            +F + P        I S   K  +       P +RP   ++L
Sbjct: 1365 KFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 135/289 (46%), Gaps = 42/289 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKT--------VAKLSIKTEKTRKKLLSEIQIHKSMK- 200

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
            +++V +ID        ++ T  V++L+E C  G L++ +  R Q  L E E+    +Q+
Sbjct: 201 HQNIVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQI 251

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+    +   K+ DFG  +       N +E  F     
Sbjct: 252 CGAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAA----VLANDRERKFTV--- 302

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + D+W++G+ +Y L     PF+   D   ++ R   
Sbjct: 303 --CGTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKC 358

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSP 305
             + F      S   K L+  +LS  P++RP+I ++++ V   +G+  P
Sbjct: 359 CDFIFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVW-FRGIFPP 406

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 125/282 (44%), Gaps = 48/282 (17%)

Query: 26  KYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH- 84
           KY       Q  S  ++ A  PT    V +K++ + ++     +   +N + ++K SKH 
Sbjct: 649 KYTDLIKIGQGASGGVYTAHDPTREGYVAIKQMNLEKQPKKELI---INEIIVMKESKHE 705

Query: 85  -VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
            +V +IDS+  +        +++++ME+   G L D +   L   L E ++  +  +   
Sbjct: 706 NIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLS 755

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  +H+    +IHRDIK +N+L+S  G+ K+ DFG               A +    LK
Sbjct: 756 GLQFLHS--KGVIHRDIKSDNILLSMRGDIKLTDFGFC-------------AQINELNLK 800

Query: 204 NTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY 259
            TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L + Y
Sbjct: 801 RTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY 854

Query: 260 QF-------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVL 293
                    L  P   SD L N + W L   P +R +   +L
Sbjct: 855 LIATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 128/280 (45%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S E+F A T        + +  I  +     L +E+   K +  
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKT--------VAKASIKSEKTRKKLLSEIQIHKSM-A 137

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V ++D     S        V++L+E C  G L++ +  R    L E E+    +Q+
Sbjct: 138 HPNIVQFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQI 188

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+   ++   K+ DFG  +  +    + +++       
Sbjct: 189 CGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAA--VLANESERKYTIC---- 240

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW+LG+ LY L     PF+   D   ++ R   
Sbjct: 241 ---GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKC 295

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F      SD  K LI  +LS  P++RP++ ++++ V
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 116/250 (46%), Gaps = 30/250 (12%)

Query: 52  KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVV-CYIDSHAARSLLQNGTYEVFLLME 110
           KV  K  +I +K  +  +  E NA++ L  S+ ++  Y       SL        + L+E
Sbjct: 199 KVLSKEYLIRQKK-VKYVNIEKNALQRLNNSRGIIRLYFTFQDEASL--------YFLLE 249

Query: 111 FCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISAD 170
           +   G  +  M  +    L E       +Q+   I  +H  Q  +IHRDIK EN+L+  +
Sbjct: 250 YAPNGDFLSIM--KKYGSLNEECTCYYSAQIIDAIKFLH--QRGIIHRDIKPENILLDKE 305

Query: 171 GEYKVCDFGS---VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS 227
            + K+ DFG+   + G  +      +        +   TA+Y SPE+++      +D + 
Sbjct: 306 MKVKLTDFGTAKLLDGKSQASGETYDLHTRSKSFV--GTAEYVSPELLN---DNWVDYRC 360

Query: 228 DIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQ 282
           DIWA G  ++++     PF+   +    Q ++  +Y F A  P+    +++L+  +L +Q
Sbjct: 361 DIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLRQ 417

Query: 283 PMQRPNICQV 292
           P QR +I Q+
Sbjct: 418 PDQRLSIPQI 427

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 110/237 (46%), Gaps = 45/237 (18%)

Query: 73  VNAMKLLKGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLK 130
           +N + +++ SKH  +V +IDS+ A+        +++++ME+   G L D +   L   L 
Sbjct: 663 LNEILVMRESKHSNIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LS 712

Query: 131 EYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRN 190
           E +I  +  +  +G+  +H+    ++HRDIK +N+L+S  G  K+ DFG           
Sbjct: 713 EGQIGAVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFGFC--------- 761

Query: 191 PQEFAFVQHDILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
               A +  + LK TT      + +PE++     +    K DIW+LGI + ++     P+
Sbjct: 762 ----AQINENNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY 814

Query: 247 EKGGDQAILHSRYQF-------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
               ++  L + Y         L  P   SD L   + W L   P +R    ++L++
Sbjct: 815 ---LNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 140/323 (43%), Gaps = 71/323 (21%)

Query: 25  LKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSK 83
           L  I  G    VY+A         GTN  V +K++ + ++     +   +N + ++KGS+
Sbjct: 686 LVKIGQGASGGVYTAYEI------GTNASVAIKQMNLEKQPKKELI---INEILVMKGSR 736

Query: 84  H--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
           H  +V +IDS+    LL+    +++++ME+   G L D +   +   L E +I  +  + 
Sbjct: 737 HNNIVNFIDSY----LLKG---DLWVIMEYMEGGSLTDVVTHCI---LTEGQIAAVSRET 786

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
            +G+  +H+    +IHRDIK +N+L+S DG  K+ DFG               A +    
Sbjct: 787 LRGLHFLHS--KGVIHRDIKSDNILLSMDGNIKLTDFGFC-------------AQINETN 831

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
           LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L +
Sbjct: 832 LKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRA 885

Query: 258 RYQFLAH--PIYSDR------LKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNF 309
            Y    +  P   D        K  +SW L  QP                + +  P  N+
Sbjct: 886 LYLIATNGTPKLKDADSLSPVFKRFLSWGLQSQP----------------ETIEQPQWNY 929

Query: 310 YLLRAMQHTNTSTSFITPPVSMV 332
           Y ++ +     + + + P V + 
Sbjct: 930 YTIKFIVEVAEANASLAPLVKLA 952

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 137/336 (40%), Gaps = 62/336 (18%)

Query: 13  TVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGT---NKVCLKRVIIP--EKAGLN 67
           + LS+      I K +    F+ +Y  +   + T + T   N   LKR+  P      ++
Sbjct: 24  SYLSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESIS 83

Query: 68  ALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN 127
               EV+  K  + S +++  +DS  A+   ++G+  V++L+ +   G L D  +  L N
Sbjct: 84  GAMKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 128 --RLKEYEILNIMSQVTQGIAAMHA---------------------------------LQ 152
              + E E + I+  + +G+  +H                                  L+
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 153 PPLI------------HRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
             ++            HRDIK  N+L S+DG   + + GS S          +   +Q  
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 201 ILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK-------GGDQA 253
           +  + T  Y +PE++ +   +++D K DIW+LG   Y + +  +PFE+           A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 254 ILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNI 289
           I    + F +   YS+ L  LI+  L   P  RP+I
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 131/287 (45%), Gaps = 55/287 (19%)

Query: 25  LKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH 84
           L  I  G    VY A    ++      ++ L++   P+K  +      +N + ++KGS+H
Sbjct: 614 LVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQ--PKKELI------INEILVMKGSRH 665

Query: 85  --VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVT 142
             +V +IDS+     L +G  +++++ME+   G L D +   +   L E +I  +  +  
Sbjct: 666 PNIVNFIDSY-----LLDG--DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETL 715

Query: 143 QGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI- 201
            G+  +H+    ++HRDIK +N+L+S  G+ K+ DFG              F    ++I 
Sbjct: 716 SGLQFLHS--KGVLHRDIKSDNILLSISGDIKLTDFG--------------FCAQINEIN 759

Query: 202 LKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHS 257
           LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L +
Sbjct: 760 LKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPYL---NETPLRA 813

Query: 258 RYQF-------LAHPI-YSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
            Y         L  P   S  L+N + W L   P QR +   +L +V
Sbjct: 814 LYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPEQRASATDLLNDV 860

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 114/247 (46%), Gaps = 39/247 (15%)

Query: 28  IASGGFAQV---YSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA-LRAEVNAMKLLKGSK 83
           +  G F +V   +S    P + P       ++R  I + A     +  E+NA+K L    
Sbjct: 52  LGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKEVKIYREINALKHLTHPN 111

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
             + Y++      +LQN  Y + +++EF + G    ++  + + RLKE     + +Q+  
Sbjct: 112 --IIYLEE-----VLQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLIS 161

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  MH     L+HRD+K+EN+L+       + DFG V+          EF F  +++++
Sbjct: 162 GVNYMHT--KGLVHRDLKLENLLMDKHENLVITDFGFVN----------EF-FEDNELMR 208

Query: 204 NTTAQ--YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK------GGDQAIL 255
            +     Y +PE++   +      K+D+W+ G+ LY +     P++       G D A L
Sbjct: 209 TSCGSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 256 HSRYQFL 262
              YQ++
Sbjct: 268 ---YQYI 271

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 104/212 (49%), Gaps = 30/212 (14%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+ + G L+D++   +Q+  L+E+        +   +  +H+    ++HRD+KIEN
Sbjct: 283 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHSNN--IVHRDLKIEN 337

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRC 220
           ++IS  GE K+ DFG +S      R    F     F   ++LK     Y  PE+      
Sbjct: 338 IMISTSGEIKIIDFG-LSNLYDTTRQLHTFCGSLYFAAPELLK--AHPYTGPEV------ 388

Query: 221 QAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISW 277
                  D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S 
Sbjct: 389 -------DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVDYPQHLSIEVISLLSK 440

Query: 278 MLSQQPMQRPNICQVLEEVSRMQGVSSPMRNF 309
           ML   P +R  + QV+E    ++G  +P  ++
Sbjct: 441 MLVVDPKKRATLRQVVEHHWMVRGYDNPSSSY 472

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 98/222 (44%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+   + L       ++LME+C  G L   +      +
Sbjct: 66  VQREIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLLRP---GK 115

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +   +  
Sbjct: 116 IDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAAQVNQTS 173

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF-- 246
              Q  A          T  + +PE+I        D K DIW+LGI  Y++     P+  
Sbjct: 174 LRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCD 222

Query: 247 --EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I+ S+   L    YS  LK  I+  L + P +R
Sbjct: 223 VEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 130/294 (44%), Gaps = 40/294 (13%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+ +G    K  + +  G ++ V  A    +       KV  K  +I +K  +  +  E 
Sbjct: 116 VVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAV-KVLSKEYLIRQKK-VKYVTVEK 173

Query: 74  NAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYE 133
            A++ L G+K ++    +    + L       + L+E+   G   DF+       +K+Y 
Sbjct: 174 LALQKLNGTKGIIRLFFTFQDEASL-------YFLLEYAPHG---DFLAL-----IKKYG 218

Query: 134 ILN------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRP 187
            LN        SQ+   + ++H +   +IHRDIK EN+L+  D + K+ DFG+       
Sbjct: 219 SLNEQCARYYASQIIDAVDSLHTI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEE 276

Query: 188 PRNPQE----FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYY 242
           P N  +    F           TA+Y SPE++ D Y     D + DIWA G  L+++   
Sbjct: 277 PSNDADGKPCFDLNARSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILFQMVAG 332

Query: 243 TTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
             PF+   +    Q ++  +Y F A   +   +K+L+  +L ++P  R  I Q+
Sbjct: 333 KPPFKASNEYLTFQKVMKIQYAFTAG--FPQIIKDLVKKLLVKEPNDRLTIEQI 384

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 104/225 (46%), Gaps = 40/225 (17%)

Query: 98  LQNGTYEVFLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLI 156
           +Q  +   ++  EF + G L+D++   +Q+  LKE     +   +   +  +HA    ++
Sbjct: 159 MQTLSNHYYMFFEFISGGQLLDYI---IQHGSLKENHARKVSRGILSALQYLHANN--IV 213

Query: 157 HRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSP 212
           HRD+KIEN+++S  GE K+ DFG +S    P ++ Q F     F   ++LK     Y  P
Sbjct: 214 HRDLKIENIMLSKTGEIKLIDFG-LSNMYDPRKSLQTFCGSLYFAAPELLK--AHPYLGP 270

Query: 213 EMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY--------QFLAH 264
           E+             D+W+ G+ LY L     PF+     A LH +         QFL+ 
Sbjct: 271 EV-------------DVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSI 316

Query: 265 PIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNF 309
            + S     L+S +L   P +R  + QV+     ++G   P +++
Sbjct: 317 DVIS-----LLSKILVVDPQKRATLQQVVNHQWMLKGYDFPPQSY 356

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 128/280 (45%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S E+F A T        + +  I  +     L +E+   K +  
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKT--------VAKASIKSEKTRKKLLSEIQIHKSM-S 137

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V +ID     S        V++L+E C  G L++ +  R    L E E+    +Q+
Sbjct: 138 HPNIVQFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQI 188

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+   ++   K+ DFG  +  +    + +++       
Sbjct: 189 CGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAA--VLANESERKYTIC---- 240

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW+LG+ LY L     PF+   D   ++ R   
Sbjct: 241 ---GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKC 295

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F      SD  K LI  +LS  P++RP++ ++++ V
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 126/285 (44%), Gaps = 38/285 (13%)

Query: 24  ILKYIASGGFAQV-----YSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNALRAEVNA 75
           I K I    F +V     YS  M      +G     KV  K  +I +K  +  +  E N 
Sbjct: 151 IKKGIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKK-VKYVNIEKNT 209

Query: 76  MKLLKGSKHVV-CYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNT-RLQNRLKEYE 133
           ++ L   + V+  Y       SL        + L+E+   G   DF++  +    L +  
Sbjct: 210 LQRLNDGRGVIKLYFTFQDEASL--------YFLLEYAPNG---DFLSVIKKFGSLSQEC 258

Query: 134 ILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQE 193
            +   +Q+   I  +H     ++HRDIK EN+L+  D + K+ DFG+    +      Q 
Sbjct: 259 AVYYSAQILDAIDYLH--HKGIVHRDIKPENILLDKDMKVKLTDFGTAR-ILEKDETTQT 315

Query: 194 FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD- 251
           F  ++       TA+Y SPE++ D Y    +D K DIWA G  L+++     PF+   + 
Sbjct: 316 FNLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKATNEY 371

Query: 252 ---QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
              Q ++  +Y F A  P+    +++LI  +L + P QR +  Q+
Sbjct: 372 LTFQKVMKVQYAFTAGFPLV---IRDLIKKILVKSPEQRLDASQI 413

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 101/208 (48%), Gaps = 30/208 (14%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+   G L+D++   +Q+  L+E+        V   +  +HA    ++HRD+KIEN
Sbjct: 208 YMLFEYVAGGQLLDYI---IQHGSLREHHARKFARGVASALQYLHANN--IVHRDLKIEN 262

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRC 220
           ++IS  GE K+ DFG +S      +    F     F   ++LK     Y  PE+      
Sbjct: 263 IMISNSGEIKIIDFG-LSNVYDTRKQLHTFCGSLYFAAPELLK--AHPYTGPEV------ 313

Query: 221 QAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF--LAHPIY-SDRLKNLISW 277
                  D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S 
Sbjct: 314 -------DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKRGKVEYPQHLSIEVMSLLSK 365

Query: 278 MLSQQPMQRPNICQVLEEVSRMQGVSSP 305
           ML   P +R ++ QV+E     +G  +P
Sbjct: 366 MLVVDPSRRASLKQVVEHPWMTKGYDTP 393

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 130/288 (45%), Gaps = 55/288 (19%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTN-KVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           K L  I  G    VY+A         GTN  V +K++ + ++     +   VN + ++KG
Sbjct: 699 KNLIKIGQGASGGVYTAYEL------GTNASVAIKQMNLEKQPKKELI---VNEILVMKG 749

Query: 82  SKH--VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
           SKH  +V +IDS+  R        +++++ME+   G L D +   +   L E +I  +  
Sbjct: 750 SKHNNIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSR 799

Query: 140 QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
           +  +G+  +H+    +IHRDIK +N+L+S +G+ K+ DFG               A +  
Sbjct: 800 ETLKGLQFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFGFC-------------AQINE 844

Query: 200 DILKNTTA----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL 255
             LK TT      + +PE++     +    K DIW+LGI + ++     P+    ++  L
Sbjct: 845 VNLKRTTMVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPL 898

Query: 256 HSRYQF-------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
            + Y         L  P   S ++   ++W L   P  R     +LE+
Sbjct: 899 RALYLIATNGTPKLKDPGNLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 102/208 (49%), Gaps = 30/208 (14%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+ + G L+D++   +Q+  L+E+        +   +  +HA    ++HRD+KIEN
Sbjct: 262 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALEYIHANN--IVHRDLKIEN 316

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRC 220
           ++IS  GE K+ DFG +S      +    F     F   ++LK     Y  PE+      
Sbjct: 317 IMISTSGEIKIIDFG-LSNVFDRKKQLHTFCGSLYFAAPELLK--AHPYTGPEV------ 367

Query: 221 QAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISW 277
                  D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S 
Sbjct: 368 -------DVWSFGVVLYVLVCGKVPFD-DENSSVLHEKIKQGKVDYPNHLSIEVISLLSK 419

Query: 278 MLSQQPMQRPNICQVLEEVSRMQGVSSP 305
           ML   P++R ++ QV+E     +G   P
Sbjct: 420 MLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 128/280 (45%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S E+F A T        + +  I  +     L +E+   K +  
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKT--------VAKASIKSEKTRKKLLSEIQIHKSM-S 137

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V +ID     S        V++L+E C  G L++ +  R    L E E+    +Q+
Sbjct: 138 HPNIVQFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQI 188

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+   ++   K+ DFG  +  +    + +++       
Sbjct: 189 CGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAA--VLANESERKYTIC---- 240

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW+LG+ LY L     PF+   D   ++ R   
Sbjct: 241 ---GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKC 295

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F      SD  K LI  +LS  P++RP++ ++++ V
Sbjct: 296 RDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 78/179 (43%), Gaps = 35/179 (19%)

Query: 107 LLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVL 166
            +ME+C  G L   +      R    E   +  QVTQG+  MH     ++HRDIK ENVL
Sbjct: 371 FVMEYCPGGDLHSLITRTGWKRSPLKERFCLFKQVTQGLRFMH--NQGVVHRDIKPENVL 428

Query: 167 ISADGEYKVCDFG----------SVSGPIR--------PPRNPQEFAFVQHDILKNTTAQ 208
           IS DG  K+ DFG           ++ P+R        PP +P E        LKN    
Sbjct: 429 ISKDGIAKLTDFGISDWAHEDPDDLNSPMRVFDCYVGSPPFSPPEVM-----ALKNAKGD 483

Query: 209 YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIY 267
              P   D +       K D WALG+ L+ L Y  TPF    + +  H R   L++ ++
Sbjct: 484 AVKP--YDPF-------KMDCWALGMILFALVYQATPF-LSAESSNAHYREYILSYDMF 532

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 95/204 (46%), Gaps = 43/204 (21%)

Query: 99   QNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHR 158
            Q G+ ++F ++EF              ++ + E+E   I  Q+  GI  +H     ++HR
Sbjct: 1036 QTGSVDLFDIIEF--------------KSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHR 1079

Query: 159  DIKIENVLISADGEYKVCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEM 214
            DIK ENV++ + G  K+ DFGS     SGP           FV        T  Y +PE+
Sbjct: 1080 DIKDENVIVDSKGFVKLIDFGSAAYVKSGPFD--------VFV-------GTIDYAAPEV 1124

Query: 215  I--DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLK 272
            +  + Y  ++     DIWA+GI LY L Y   PF    +  IL    +F      S   K
Sbjct: 1125 LGGNPYEGKS----QDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECK 1178

Query: 273  NLISWMLSQQPMQRPNICQVLEEV 296
             LI+ +L++   +RP I ++ ++V
Sbjct: 1179 ALITKILNRCVRKRPTIDEICQDV 1202

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 117/273 (42%), Gaps = 41/273 (15%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVI--IPEKAGLNALRAEVNAMKLLK 80
           K  + I +G F  VY            T +V   +V+    ++  +  ++ EV  +  +K
Sbjct: 30  KRTEVIGTGKFGVVYKGHH------ARTKQVYAIKVLNLDSDEDEVEDVQREVQFLASMK 83

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQ 140
            + ++  Y  S+   + L       ++++E+C  G L   +      ++ E  I  IM +
Sbjct: 84  QTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLLR---PGKIDEKYIGIIMRE 133

Query: 141 VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHD 200
           V   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +               Q  
Sbjct: 134 VLIALKYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAA------------QLNQSS 179

Query: 201 ILKNTTA---QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQA 253
           + + T A    + +PE+I      + D K DIW+LGI  Y++     P+         Q 
Sbjct: 180 LKRQTMAGTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQL 237

Query: 254 ILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
           I  S+   L    YS  LK  I+  L + P +R
Sbjct: 238 ITKSKPPRLEGRHYSPMLKEFIALCLDEDPKER 270

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 129/280 (46%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + ++ I  +     L +E+   K +K 
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKT--------VAKISIKSEKTRKKLLSEIQIHKSMKH 151

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V +ID        ++ T  V++L+E C  G L+D +  R    L E E+    +Q+
Sbjct: 152 V-NIVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQI 201

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+        K+ DFG  +       N +E  +     
Sbjct: 202 CGAIKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAA----TLANDRERKYTV--- 252

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW++G+ +Y L     PF+   D   ++ R   
Sbjct: 253 --CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKC 308

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F    + S   K LI  +LS  P++RP++ ++++ +
Sbjct: 309 RDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 128/280 (45%), Gaps = 41/280 (14%)

Query: 27  YIASGGFAQVY-----SAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKG 81
           ++  GGFA+ +     S ++F A T        + +  I  +     L +E+   K +  
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKT--------VAKASIKSEKTRKKLLSEIQIHKSM-A 137

Query: 82  SKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
             ++V +ID     S        V++L+E C  G L++ +  R    L E E+    +Q+
Sbjct: 138 HPNIVQFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQI 188

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              I  MH+ +  +IHRD+K+ N+   ++   K+ DFG  +  +    + +++       
Sbjct: 189 CGAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAA--VLANESERKYTIC---- 240

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSR--- 258
               T  Y +PE++ + +      + DIW+LG+ LY L     PF+   D   ++ R   
Sbjct: 241 ---GTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKC 295

Query: 259 --YQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296
             + F      SD  K LI  +LS  P++RP++ ++++ V
Sbjct: 296 RDFSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 117/273 (42%), Gaps = 31/273 (11%)

Query: 26  KYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHV 85
           K I  G F  VY      +        + L   I      +  ++ E+  + LL+ + ++
Sbjct: 10  KVIGKGKFGTVYKGHSIKSKKVFAIKVLNLDCDI----NEIQDIQNEIKFLSLLRYAPNI 65

Query: 86  VCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGI 145
             Y  S+           +++++ME+C  G + + +      R  E  I  I+ ++   +
Sbjct: 66  TYYYHSYLINR-------KIWIIMEYCNGGSVRNLIKI---GRFNEIYISVILRELLYAL 115

Query: 146 AAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT 205
             +H     +IHRDIK  N+LI+ +G  K+CDFG  +          EF+  +   +   
Sbjct: 116 EYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAK--------LEFSKPKRQTMAG- 164

Query: 206 TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK----GGDQAILHSRYQF 261
           T  + +PE+I        D K+DIW++GI  Y++     P+ +       Q I   +   
Sbjct: 165 TPYWMAPEVI--IESSLYDTKADIWSVGITAYEITTGNPPYCEYDATKAMQLITKLKPPR 222

Query: 262 LAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           L   +YS  LK  I+  L + P +R    ++LE
Sbjct: 223 LEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLN--------ALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+ +  N        ALR+EV+ +K L
Sbjct: 1181 IGKGSFGAVY----LCLNVTTG-EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1235

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         +N  Y +FL  E+   G +   +  R+  R  E  I ++ +
Sbjct: 1236 -DHLNIVQYLGFEN-----KNNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTT 1285

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S      R  ++  +   
Sbjct: 1286 QVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNS 1335

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1336 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCIVLEMFAGKRPW 1380

>TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.167
           YDL025C
          Length = 745

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 113/253 (44%), Gaps = 44/253 (17%)

Query: 63  KAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQN-GTYEVFLLMEFCTAGGLIDFM 121
           +AG  A   +V     +  + H    ID++    +LQ+ G Y   + MEF       DF 
Sbjct: 396 RAGQLAFSRKVTKEYCIGAALHHFNIIDTY---DMLQDSGLY--LVCMEFAP----YDFF 446

Query: 122 NTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSV 181
           N  +     ++E+   + Q+ +G+  MH+    + HRD+K++N ++++DG  K+ DFGS 
Sbjct: 447 NLVMSELFTKHEVYCYLKQLVRGVNFMHS--QGIAHRDLKLDNCVVNSDGILKIIDFGSA 504

Query: 182 SGPIRPPRNPQEFAFVQHDILKNTTAQ--YRSPEMI--DLYRCQAIDEKSDIWALGIFLY 237
                  +NP E   +   + +       Y +PE++  D Y  +A    +D+W++GI  Y
Sbjct: 505 V----IFKNPNEDKLI---LARGVVGSDPYLAPELLIRDKYDPRA----ADVWSIGIIFY 553

Query: 238 KLCYYTTPFEKGGDQAILHSRYQFLAHPIYSD---------------RLKNLISWMLSQQ 282
             C Y   F     +  L S   F + P   D               R +NLI  ML  +
Sbjct: 554 --CMYLRRFPWRAPKENLESFRNFCSKPDSPDDINKGPNKLLIYLPHRSRNLIGRMLDLE 611

Query: 283 PMQRPNICQVLEE 295
           P +R    +++++
Sbjct: 612 PSRRIKTSEIIQD 624

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 113/250 (45%), Gaps = 31/250 (12%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRV--IIPEKAGLNALRAEVNAMKL 78
           H +I++++  G +  V S + F    P    K+ +K++  I  ++  L     E+  M  
Sbjct: 37  HYEIIQFLGKGAYGTVCSVK-FKGQNPPA--KIAVKKISNIFNKEILLKRAIRELKFMNF 93

Query: 79  LKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIM 138
            KG K++V  ID     S   +G Y    L+++     L   +++ +Q  L E+ I   +
Sbjct: 94  FKGHKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFL 147

Query: 139 SQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSG------PIRPPRNPQ 192
            Q+  G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G         P   P 
Sbjct: 148 YQILCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSVQPH 205

Query: 193 EFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQ 252
              +V        T  YR+PE+  L   Q  ++  DIWA+G  L +  Y   P   G D 
Sbjct: 206 ITNYV-------ATRWYRAPEL--LLSNQPYNKSIDIWAVGCILAEF-YARKPVFMGRDS 255

Query: 253 AILHSRYQFL 262
             +H  ++ +
Sbjct: 256 --MHQVFEII 263

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 97/207 (46%), Gaps = 20/207 (9%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 284 YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENI 339

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDE 225
           +IS  GE K+ DFG +S    P +    F           +  + +PE+  L  C     
Sbjct: 340 MISTSGEIKIIDFG-LSNMFNPKKQLHTFC---------GSLYFAAPEL--LKACPYTGP 387

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWMLSQQ 282
           + D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S ML   
Sbjct: 388 EVDVWSFGVVLYVLVCGKVPFDD-ENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVD 446

Query: 283 PMQRPNICQVLEEVSRMQGVSSPMRNF 309
           P +R  + QV+      +G   P  ++
Sbjct: 447 PSKRATLKQVVNHQWMQRGYDFPAPSY 473

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 125/289 (43%), Gaps = 41/289 (14%)

Query: 23  KILKYIASGGFAQVYSAEMF-----PADTPTGTNKVCLKRVIIPEKAG--LNALRAEVNA 75
           ++L+ +  G F  VY A        P D     N     + I  E +   ++ L  E+  
Sbjct: 8   QLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEHSNEPIDLLLKEIYF 67

Query: 76  MKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEIL 135
           +  L       C   +H   +    G   ++++ME+C+ G L++ +  R  +RL E    
Sbjct: 68  LSTLH------CPYITHYYGTF--TGDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQTTC 117

Query: 136 NIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFA 195
            I+ QV   +  +H  +  LIHRD+K  N+L++ DGE ++ D G V+G ++       F 
Sbjct: 118 FIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLG-VTGQLK-------FN 167

Query: 196 FVQHDILKNT-----TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
             +H   KN      T  + +PE+I   + Q+ D K DIW+LGI   +L     P     
Sbjct: 168 STRHGG-KNLNTFVGTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPMSHLD 223

Query: 251 DQAILHSRYQFLAHPIYSDRL-----KNLISWMLSQQPMQRPNICQVLE 294
               L    +  A  I  +       K+ I   L Q P QRP   Q+L+
Sbjct: 224 SMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQ 272

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 97/222 (43%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+   + L       +++ME C  G L   +      +
Sbjct: 66  VQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLLRP---GK 115

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +   +  
Sbjct: 116 IDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS 173

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF-- 246
              Q  A          T  + +PE+I        D K DIW+LGI  Y++     P+  
Sbjct: 174 LRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCD 222

Query: 247 --EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I+ S+   L    YS  LK  I+  L + P +R
Sbjct: 223 VEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 98/222 (44%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+   + L       +++ME+C  G L   +      +
Sbjct: 66  VQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLRP---GK 115

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +   +  
Sbjct: 116 IDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS 173

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF-- 246
              Q  A          T  + +PE+I        D K DIW+LGI  Y++     P+  
Sbjct: 174 LRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCD 222

Query: 247 --EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I+ S+   L    YS  LK  I+  L + P +R
Sbjct: 223 VEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+     LQ+    ++++ME+C  G L   +   +   
Sbjct: 87  VQREIQFLASLKQVPNITRYYGSY-----LQDT--NLWIIMEYCAGGSLRTLLRPGM--- 136

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G+ K+CDFG  +   +  
Sbjct: 137 IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQLNQTS 194

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK 248
              Q  A          T  + +PE+I        D K DIW+LGI  Y++     P+ +
Sbjct: 195 LRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCE 243

Query: 249 ----GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I  S+   L    YS  LK  I+  L + P +R
Sbjct: 244 IEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 95/196 (48%), Gaps = 28/196 (14%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E+        +   +  +HA    ++HRD+KIEN+
Sbjct: 209 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLKIENI 264

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRCQ 221
           +IS  GE K+ DFG +S    P +    F     F   ++LK     Y  PE+       
Sbjct: 265 MISTSGEIKIIDFG-LSNVYDPRKQLHTFCGSLYFAAPELLK--ARPYLGPEV------- 314

Query: 222 AIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWM 278
                 D+W+ G+ LY L     PF+     ++LH + +   + +P + S  + +L+S M
Sbjct: 315 ------DVWSFGVVLYVLVCGKVPFDDEVS-SVLHEKIKQGNVEYPNHLSIEVLSLLSKM 367

Query: 279 LSQQPMQRPNICQVLE 294
           L   P +R ++ QV+E
Sbjct: 368 LVVDPERRASLKQVIE 383

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 127/290 (43%), Gaps = 43/290 (14%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNALR 70
           V+  G    K  + +  G     YS  M      +G     KV  K  +I +K  +  + 
Sbjct: 166 VVKKGIKDFKFGEMLGDGA----YSTVMLATSNDSGKKYAVKVLNKEYLIRQKK-VKYVN 220

Query: 71  AEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLK 130
            E  A++ L  S+ ++    +    + L       + L+E+   G L+  M  +    L 
Sbjct: 221 IEKLALQRLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNGDLLSLM--KKFGSLN 271

Query: 131 EYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVS-GPIRPPR 189
           E       +Q+   I  MH+    +IHRDIK EN+L+  D + K+ DFG+      +PP 
Sbjct: 272 EECCCYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPG 329

Query: 190 NPQEFAFVQHDILKNT-----TAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYYT 243
                    +D+L  +     TA+Y SPE++ D Y     D +SDIWA G  ++++    
Sbjct: 330 -------TSYDLLTRSKSFVGTAEYVSPELLNDNY----TDARSDIWAFGCIVFQMIAGK 378

Query: 244 TPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNI 289
            PF+   +    Q ++  +Y F A   +   +++L+  +L + P QR  I
Sbjct: 379 PPFKATNEYLTFQKVMKVQYAFTAG--FPTVVRDLVKRILIKAPEQRLTI 426

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 105/230 (45%), Gaps = 27/230 (11%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ E+  +  LK   ++  Y  S+     L+N +  ++++ME+C  G L   +      +
Sbjct: 78  VQKEIQFLASLKQLPNITRYYGSY-----LKNTS--LWIIMEYCGGGSLRSLLR---PGK 127

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ DG  K+CDFG  +   +  
Sbjct: 128 IDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVAAQLNQTK 185

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF-- 246
              Q  A          T  + +PE+I        D K+DIW+ GI  Y++     P+  
Sbjct: 186 SRRQTMA---------GTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTTGNPPYCD 234

Query: 247 --EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
                  Q I  S+   L    YS  +K  I+  L + P +RP   ++L+
Sbjct: 235 VEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 90/201 (44%), Gaps = 39/201 (19%)

Query: 99   QNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHR 158
            + G  ++F L+EF T               + E+E   I  QV  GI  +H     ++HR
Sbjct: 1241 ETGCIDLFDLIEFKT--------------NMTEFEAKLIFKQVVSGIKHLH--HQGIVHR 1284

Query: 159  DIKIENVLISADGEYKVCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEM 214
            DIK ENV++ + G  K+ DFGS     SGP           FV        T  Y +PE+
Sbjct: 1285 DIKDENVIVDSKGLVKIIDFGSAAYVKSGPFD--------VFV-------GTIDYAAPEV 1329

Query: 215  IDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNL 274
            +     +   +  DIWALGI LY + +   PF    +  IL    +F ++   ++    L
Sbjct: 1330 LSGEPYEG--KPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMEL 1385

Query: 275  ISWMLSQQPMQRPNICQVLEE 295
            I  +L +Q   RP I ++ ++
Sbjct: 1386 IKKVLIRQVRNRPAIDEIFDD 1406

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 114/252 (45%), Gaps = 32/252 (12%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRV--IIPEKAGLNALRAEVNAMKL 78
           + +I++++  G +  V S + F   TP    K+ +K++  I  ++  L     E+  M  
Sbjct: 45  YYEIIQFLGKGAYGTVCSVK-FKGQTPPA--KIAVKKISNIFNKEILLKRAIRELKFMNF 101

Query: 79  LKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIM 138
            KG K++V  ID     S   +G Y    L+++     L   +++ +Q  L E+ I   +
Sbjct: 102 FKGHKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFL 155

Query: 139 SQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQ 198
            Q+  G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G         EF   Q
Sbjct: 156 YQILCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGI------HTEFFQCQ 207

Query: 199 --------HDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGG 250
                   H      T  YR+PE+  L   Q  D+  DIWA+G  L +  Y   P   G 
Sbjct: 208 TTNSAVQPHITNYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCILAEF-YARKPVFMGR 264

Query: 251 DQAILHSRYQFL 262
           D   +H  ++ +
Sbjct: 265 DS--MHQVFEII 274

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 121/274 (44%), Gaps = 39/274 (14%)

Query: 28  IASGGFAQV---YSAEMFPADTPTGTNKVCLKRVIIPEKAGLN-ALRAEVNAMKLLKGSK 83
           +  G F +V   +S    P +         ++R  IP+ +     +  E+NA+K L    
Sbjct: 50  LGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEIKIYREINALKHLSHPN 109

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
            V           +LQN  Y + +++E+ + G    ++  +   RLKE     + +Q+  
Sbjct: 110 IV-------KLEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEAVACRLFAQLIS 159

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  MH+    L+HRD+K+EN+L+       + DFG V+          EF F   +++K
Sbjct: 160 GVQYMHSKG--LVHRDLKLENLLLDKHENLVITDFGFVN----------EF-FAHSELMK 206

Query: 204 NTTAQ--YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE---KGGDQAILHSR 258
            +     Y +PE++   +      K+DIW+ G+ LY +     P++   K  D   +   
Sbjct: 207 TSCGSPCYAAPELVVSSKPYEA-RKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKL 265

Query: 259 YQF-----LAHPIYSDRL-KNLISWMLSQQPMQR 286
           YQ+     L  P Y   L ++L+  +L   P +R
Sbjct: 266 YQYITRTPLKFPEYITPLPRDLLRRILYPDPKRR 299

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 136/311 (43%), Gaps = 47/311 (15%)

Query: 4   PEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRV----I 59
           P    YT G  L  G      L YI +     + S+     +      +V +K +    +
Sbjct: 54  PRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTL 113

Query: 60  IPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLID 119
              K     L  E+NA+K+L     V           +LQN  Y + +++E+ + G    
Sbjct: 114 SASKESEIKLYREINALKMLTHPNIV-------KLEEVLQNSKY-IGIVLEYASGGEFYK 165

Query: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179
           ++  + + RLKE +   I +Q+  G++ +H+    L+HRD+K+EN+L+   G   + DFG
Sbjct: 166 YI--KFKKRLKESKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNLLITDFG 221

Query: 180 SVSGPIRPPRNPQEFAFVQHDILKNT---TAQYRSPEM---IDLYRCQAIDEKSDIWALG 233
            V+               + + L +T   +  Y +PE+   ++ Y  +    K+DIW+ G
Sbjct: 222 FVN------------EVTKTNKLMHTPCGSPCYAAPELVTSVEPYNAR----KADIWSCG 265

Query: 234 IFLYKLCYYTTPFE------KGGDQAILHS--RYQFLAHPIYSDRL-KNLISWMLSQQPM 284
           + LY +     P++       G D   L+     Q L  P Y + + ++L+  ML   P 
Sbjct: 266 VILYAMLAGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPA 325

Query: 285 QRPNICQVLEE 295
           +R ++  +L+ 
Sbjct: 326 KRMSMKHILQH 336

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 108/233 (46%), Gaps = 37/233 (15%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +  E+  MKLL     +  Y        + +N   E++L++E+   G L D++ ++   +
Sbjct: 182 IEREIVIMKLLSHPNVMALY-------EVWENNN-ELYLVLEYVDGGELFDYLVSK--GK 231

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEY-KVCDFGSVSGPIRP 187
           L E E ++   Q+  GI+  H+    + HRD+K EN+L+       K+ DFG  +     
Sbjct: 232 LTESEAVHYFKQIINGISYCHSFN--ICHRDLKPENLLLDKKRRIIKIADFGMAALQ--- 286

Query: 188 PRNPQEFAFVQHDILKNTTA--QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTP 245
                    V + +L+ +     Y SPE++ + +C      SDIW+ GI L+ L     P
Sbjct: 287 ---------VSNRLLQTSCGSPHYASPEIV-MGKCYN-GAPSDIWSCGIILFALLTGHLP 335

Query: 246 FEKGGDQAIL----HSRYQFLAHPIY-SDRLKNLISWMLSQQPMQRPNICQVL 293
           F     + +L    + RYQ    P Y S   KNLIS +L   P +R +  Q+L
Sbjct: 336 FNDDNIKKLLIKVQNGRYQM---PSYISQEAKNLISRILVVDPSKRISTEQIL 385

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 101/222 (45%), Gaps = 27/222 (12%)

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           ++ EV  +  LK   +++ Y  S+   + L       +++M++C  G +   +      +
Sbjct: 89  VQREVQFLSSLKQFPNIIRYFGSYLKDTNL-------WIIMDYCAGGSIRTLLRP---GK 138

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           + E  I  IM ++   +  +H  +  +IHRDIK  NVL++ +G+ K+CDFG  +   +  
Sbjct: 139 IDEKYIGIIMREILIALQYIH--KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTK 196

Query: 189 RNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK 248
              Q  A          T  + +PE+I        D K+DIW+LGI  Y++     P+ +
Sbjct: 197 LRRQTMA---------GTPYWMAPEVI--MEGAYYDTKADIWSLGITAYEIATGNPPYCE 245

Query: 249 ----GGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
                  Q I  S+   L    YS  LK  I+  L + P +R
Sbjct: 246 IEALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKER 287

>Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {ON}
           complement(36018..38015) [1998 nt, 666 aa]
          Length = 665

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 67/269 (24%), Positives = 122/269 (45%), Gaps = 33/269 (12%)

Query: 24  ILKYIASGGFAQVYSAEMFPADTPT-GTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGS 82
           IL+ +  G F +VY  E    DT T    KV  KR +I  K     ++  +N   +L  +
Sbjct: 264 ILRMLGKGTFGRVYQVE--KKDTKTLYAMKVISKRNVIKRKE----VKHTLNERNILVHN 317

Query: 83  KHVVCYIDSHAARSLLQNGTYE-VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQV 141
            + +C   S   +      T E ++L+ +F + G L  F++ + + R  EY      +Q+
Sbjct: 318 ANKLC---SFIVKLKFSFQTAEDLYLVTDFMSGGEL--FLHLQREGRFPEYRAKFYCAQL 372

Query: 142 TQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDI 201
              +  +H     +I+RD+K EN+L+ A G   +CDFG     +    N     F     
Sbjct: 373 VMALEFLH--DNDIIYRDLKPENILLDAKGNIALCDFGLSKLNLEGRTN----TFC---- 422

Query: 202 LKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQAILHS 257
               T +Y +PE+  L       +  D W+LG+ ++++C   +PF     +   Q I +S
Sbjct: 423 ---GTTEYLAPEL--LLDATGYTKMVDFWSLGVLMFEMCCGWSPFFAPTNQQMYQKIAYS 477

Query: 258 RYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
           + +F  + + S   +  I  ++++ P+ R
Sbjct: 478 KIKFPVNSL-SKGCRLFIKGLMNRNPLHR 505

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLN--------ALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+ +  N        ALR+EV+ +K L
Sbjct: 1181 IGKGSFGAVY----LCLNVTTG-EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1235

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         ++  Y +FL  E+   G +   +  R+  R  E  I ++ +
Sbjct: 1236 -DHLNIVQYLGFEN-----KDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTT 1285

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S      R  ++  +   
Sbjct: 1286 QVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNS 1335

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1336 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCIVLEMFAGKRPW 1380

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 96/203 (47%), Gaps = 20/203 (9%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 9   YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENI 64

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDE 225
           +IS  GE K+ DFG +S    P +    F           +  + +PE+  L  C     
Sbjct: 65  MISTSGEIKIIDFG-LSNMYNPKKQLHTFC---------GSLYFAAPEL--LKACPYTGP 112

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWMLSQQ 282
           + D+W+ G+ L+ L     PF+   + ++LH + +   + +P + S  + +L+S ML   
Sbjct: 113 EVDVWSFGVVLFVLVCGKVPFD-DENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVD 171

Query: 283 PMQRPNICQVLEEVSRMQGVSSP 305
           P +R ++ QV+      +G   P
Sbjct: 172 PTKRASLKQVVNHQWMQRGYDFP 194

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 106/254 (41%), Gaps = 36/254 (14%)

Query: 52  KVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEF 111
           KV  KR +I  K     ++  +   ++L  S H       H+     Q   Y V+L ME+
Sbjct: 465 KVFTKREMIKRKK----VQRILTEQEILATSNHPFVVTLYHS----FQTEDY-VYLCMEY 515

Query: 112 CTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADG 171
           C  G     + TR    + E +     S+VT  +  +H L    I+RD+K EN+L+   G
Sbjct: 516 CMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSG 573

Query: 172 EYKVCDF------GSVSGPIRPPRNPQEFAFVQHDILKN--------TTAQYRSPEMIDL 217
              + DF         + P++  R   + + V   +            T +Y +PE+I  
Sbjct: 574 HIMLSDFDLSVQANDAAKPVK--RVATQSSMVDTKVFSEGFRTNSFVGTEEYIAPEVI-- 629

Query: 218 YRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQ-----AILHSRYQFLAHPIYSDRLK 272
            R        D W LGI +Y++ +  TPF KG +       IL +   F  H   S   K
Sbjct: 630 -RGNGHTAAVDWWTLGILIYEMLFGCTPF-KGENTNETFCNILKNEVTFPEHHEISRHCK 687

Query: 273 NLISWMLSQQPMQR 286
           +LI  +LS+   +R
Sbjct: 688 DLIRKLLSKNESKR 701

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 129/295 (43%), Gaps = 46/295 (15%)

Query: 17  VGTHHAKILKYIASGGFAQV-----YSAEMFPADTPTGTN---KVCLKRVIIPEKAGLNA 68
           V T H  I K I    F ++     YS  M      +G     KV  K  +I +K  +  
Sbjct: 169 VTTQHI-IKKGIKDFKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKK-VKY 226

Query: 69  LRAEVNAMKLLKGSKHVV-CYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN 127
           +  E N ++ L  S+ V+  Y       SL        + L+E+   G  +  M  +   
Sbjct: 227 VNIEKNTLQRLNNSRGVIKLYFTFQDEASL--------YFLLEYAPNGDFLSVM--KKFG 276

Query: 128 RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRP 187
            L E       +Q+   I  +H  +  ++HRDIK EN+L+    + K+ DFG+     R 
Sbjct: 277 SLNEECCRYYGAQMLDAIDFIH--KNGVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRD 334

Query: 188 PRNPQEFAFVQHDILKNT-----TAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYY 242
            ++        +++LK +     TA+Y SPE+++      ++ K DIWA G  LY++   
Sbjct: 335 EKS-------GYNLLKKSRSFVGTAEYVSPELLN---DNCVNYKCDIWAFGCILYQMIAG 384

Query: 243 TTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISWMLSQQPMQRPNICQV 292
             PF+   +    Q ++  +Y F A  P+    +++L+  +L + P  R N  QV
Sbjct: 385 KPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKQLLVKSPEARLNASQV 436

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 128/294 (43%), Gaps = 40/294 (13%)

Query: 14  VLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEV 73
           V+ +G    K  + +  G ++ V  A    +       KV  K  +I +K  +  +  E 
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAV-KVLSKEYLIRQKK-VKYVTVEK 174

Query: 74  NAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYE 133
            A++ L G+K +     +    + L       + L+E+   G   DF+       +K+Y 
Sbjct: 175 LALQKLNGTKGIFKLFFTFQDEASL-------YFLLEYAPHG---DFLGL-----IKKYG 219

Query: 134 ILN------IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRP 187
            LN        SQ+   + ++H +   +IHRDIK EN+L+  + + K+ DFG+       
Sbjct: 220 SLNETCARYYASQIIDAVDSLHNI--GIIHRDIKPENILLDKNMKVKLTDFGTAKILPEE 277

Query: 188 PRNPQE----FAFVQHDILKNTTAQYRSPEMI-DLYRCQAIDEKSDIWALGIFLYKLCYY 242
           P N  +    F           TA+Y SPE++ D Y     D + DIWA G  LY++   
Sbjct: 278 PSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY----TDSRCDIWAFGCILYQMLAG 333

Query: 243 TTPFEKGGD----QAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQV 292
             PF+   +    Q ++  +Y F A   +   +K+L+  +L + P  R  I Q+
Sbjct: 334 KPPFKAANEYLTFQKVMKIQYAFTAG--FPQIVKDLVKKLLVRDPNDRLTIKQI 385

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 119/274 (43%), Gaps = 35/274 (12%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCL---KRVIIPEKAGLNALRAEVNAMKLLKGSKH 84
           +  GGFA+      F      G +  C    K+ I  E+     L +E+   + L+ S H
Sbjct: 99  LGEGGFARC-----FHIKDDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRYS-H 151

Query: 85  VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQG 144
           +V ++D              V++L+E C  G L+D +  R    L E E+  + +QV   
Sbjct: 152 IVKFMDCFE-------DELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGA 202

Query: 145 IAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKN 204
           I  MH+    +IHRD+K+ NV    +   K+ DFG  +       N  E  +        
Sbjct: 203 INYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAA----TLSNVSEKKYTMCG---- 252

Query: 205 TTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILH----SRYQ 260
            T  Y +PE+I L +      ++DIW+LGI +Y +     PF+      I       +Y+
Sbjct: 253 -TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYE 310

Query: 261 FLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLE 294
           F      ++ +K LI  +L   P QRP I  +L+
Sbjct: 311 FPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.192
           YGR052W
          Length = 384

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 110/234 (47%), Gaps = 36/234 (15%)

Query: 21  HAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLK 80
           ++K+ K I SG F+ VY A      + T    V LK VI  +K     +  E   MKLL 
Sbjct: 2   YSKLTK-IQSGSFSTVYKAW-----SSTLEQYVALK-VIPKKKYSSEGMDNEYKIMKLLG 54

Query: 81  GSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQN------RLKEYEI 134
            +   +C     +     ++ +Y V +++E+C  G L DF++   +        L + + 
Sbjct: 55  RNHPNIC-----SMLDFYEDDSYYV-VVLEYCECGDLYDFLDIAKKQGDPYSPALIQLDF 108

Query: 135 LNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEF 194
            N+++Q+   I   H+L   + HRDIK EN+L++ DG  K+ D+G  +   +     +E+
Sbjct: 109 RNLINQLFSAINYAHSL--GIAHRDIKPENILLTKDGNIKLADWGHATTDAK----SKEY 162

Query: 195 AFVQHDILKNTTAQYRSPEMIDLYRCQAIDE-KSDIWALGIFLYKLCYYTTPFE 247
                      T  YR PE  +    ++ D  KSD W++G+ +  L +   PF+
Sbjct: 163 HI--------GTDNYRGPETFN--GTESYDTIKSDYWSIGVTMLYLIFGQCPFK 206

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 91/195 (46%), Gaps = 20/195 (10%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++++ME+C  G +   +      ++ E  I  IM ++   +  +H  +  +IHRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVIHRDIKAAN 168

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +LI+ +G  K+CDFG  +   +     Q  A          T  + +PE+I      + D
Sbjct: 169 LLITNEGNVKLCDFGVAAQLNQNTMRRQTMA---------GTPYWMAPEVI--MEGISYD 217

Query: 225 EKSDIWALGIFLYKLCYYTTPFEK----GGDQAILHSRYQFLAHPIYSDRLKNLISWMLS 280
            K+DIW++GI  Y++     PF +       Q I  S+   L    +   LK  I+  L 
Sbjct: 218 TKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLD 277

Query: 281 QQPMQRPNICQVLEE 295
           + P +RP   ++L E
Sbjct: 278 EDPQERPTADKLLHE 292

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 97/198 (48%), Gaps = 30/198 (15%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       LKE+        +   +  +HA    ++HRD+KIEN+
Sbjct: 199 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENI 254

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQ-YRSPEMIDLYRC 220
           +IS+ GE K+ DFG +S      +    F     F   ++LK   AQ Y  PE+      
Sbjct: 255 MISSSGEIKIIDFG-LSNIFDYRKQLHTFCGSLYFAAPELLK---AQPYTGPEV------ 304

Query: 221 QAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISW 277
                  DIW+ GI LY L     PF+   + +ILH + +   + +P + S  + +L++ 
Sbjct: 305 -------DIWSFGIVLYVLVCGKVPFD-DENSSILHEKIKKGKVDYPSHLSIEVISLLTR 356

Query: 278 MLSQQPMQRPNICQVLEE 295
           M+   P++R  +  V+E 
Sbjct: 357 MIVVDPLRRATLKNVVEH 374

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 113/239 (47%), Gaps = 41/239 (17%)

Query: 72  EVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKE 131
           E+NA+K L      + Y++      +LQN  Y + +++EF + G    ++  + + RLKE
Sbjct: 100 EINALKHLTHPN--IIYLEE-----VLQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKE 149

Query: 132 YEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNP 191
                + +Q+  G+  MH     L+HRD+K+EN+L+       + DFG V+         
Sbjct: 150 SSACRLFAQLISGVNYMHY--KGLVHRDLKLENLLLDKHENLVITDFGFVN--------- 198

Query: 192 QEFAFVQHDILKNTTAQ--YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK- 248
            EF F  ++++K +     Y +PE++   +      K+D+W+ G+ LY +     P++  
Sbjct: 199 -EF-FEDNELMKTSCGSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAGYLPWDDD 255

Query: 249 -----GGDQAILHSRYQF-----LAHPIYSDRL-KNLISWMLSQQPMQRPNICQVLEEV 296
                G D A L   Y++     L  P Y   + ++L+  +L   P +R N+  +   V
Sbjct: 256 HENPTGDDIARL---YKYITQTPLKFPEYITPIPRDLLRRILVPNPRRRINLQTIKRHV 311

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 127/281 (45%), Gaps = 48/281 (17%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGS 82
           KIL+ I  G F +VY A   P        KV +K  +   K   N +R EV   +     
Sbjct: 47  KILEQIGEGSFGKVYLAMHRPTH-----RKVVIKSSV---KNDPNIVR-EVFYHRQF--- 94

Query: 83  KHVVCYIDSHAARSLLQNGTYE--VFLLMEFCTAGGLIDFMNTRLQ-NRLKEYEILNIMS 139
                  + H    L +    E  V++ +E+C    L D +   LQ  R+   E + + S
Sbjct: 95  -------EYHYITKLYEIIVTESKVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFS 144

Query: 140 QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
           Q+   +   H+L    +HRD+K+EN+L+  DG  K+ DFG     +           V  
Sbjct: 145 QIVGAVYYAHSLN--CVHRDLKLENILLDKDGNAKLTDFGFTRECMEK---------VNL 193

Query: 200 DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY 259
           + +  TT  Y +PE+ +         K DIW+LG+ LY +   + PF++  D+A   +++
Sbjct: 194 ETICGTTV-YMAPELTERKPYDGF--KIDIWSLGVILYTMLSGSMPFDE-DDEA--KTKW 247

Query: 260 QFL-AHPIYSDRL-----KNLISWMLSQQPMQRPNICQVLE 294
           + +   P Y+ +      ++L+  +L +    RP++ ++L+
Sbjct: 248 KIINEEPEYNSKFMTAEGEDLVRKLLQKDSNLRPSVREILQ 288

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 97/207 (46%), Gaps = 28/207 (13%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 272

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRCQ 221
           +IS+ GE ++ DFG +S    P +    F     F   ++LK     Y  PE+       
Sbjct: 273 MISSSGEIRIIDFG-LSNLYDPKKQLHTFCGSLYFAAPELLK--AHPYTGPEV------- 322

Query: 222 AIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWM 278
                 DIW+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S M
Sbjct: 323 ------DIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSKM 375

Query: 279 LSQQPMQRPNICQVLEEVSRMQGVSSP 305
           L   P++R  + QV+      +G   P
Sbjct: 376 LVVDPLKRATLKQVVNHQWMQKGYDFP 402

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 91/199 (45%), Gaps = 29/199 (14%)

Query: 104 EVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++E+   G L D++ +R   +L E E ++   Q+ QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLISADG-EYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTA---QYRSPEMIDLYR 219
           N+L+       K+ DFG               A    D L  T+     Y SPE++   +
Sbjct: 197 NLLLDKKNLSVKIADFGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 220 CQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAIL----HSRYQFLAHPIYSDRLKNLI 275
                  SD+W+ GI L+ L     PF     + +L      +YQ   +   S+  K+LI
Sbjct: 244 YHG--SPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKDLI 299

Query: 276 SWMLSQQPMQRPNICQVLE 294
           + +L   P  R  I +VLE
Sbjct: 300 AKILIVDPAMRITIDEVLE 318

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 97/198 (48%), Gaps = 32/198 (16%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+ + G L+D++   +Q+  LKE    N   Q+   +  +HA    ++HRD+KIEN
Sbjct: 203 YMLFEYVSGGQLLDYI---IQHGSLKESHARNFARQILSALKYLHANN--IVHRDLKIEN 257

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           ++IS++G  K+ DFG +S      +  + +           +  + +PE+  L     I 
Sbjct: 258 IMISSNGNIKIIDFG-LSNLYDKSKKLKTYC---------GSLYFAAPEL--LRANPYIG 305

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY--------QFLAHPIYSDRLKNLIS 276
            + D+W+ G+ LY L     PF+   +  +LH +         QFL+  + S     L+S
Sbjct: 306 PEIDVWSFGVVLYVLVCGKVPFD-DENSNVLHEKIKQGRVFYPQFLSIEVIS-----LLS 359

Query: 277 WMLSQQPMQRPNICQVLE 294
            ML   P +R  + QV++
Sbjct: 360 TMLVVDPFKRATLDQVMK 377

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 111/238 (46%), Gaps = 47/238 (19%)

Query: 72  EVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKE 131
           E+NA+K L     V           +LQN  Y + +++E+ + G    ++  + + RLKE
Sbjct: 99  EINALKHLTHPNIVKL-------EEVLQNSKY-IGIVLEYASGGEFYRYI--QRKRRLKE 148

Query: 132 YEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNP 191
                + +Q+  G+  MH+    L+HRD+K+EN+L+       + DFG V+         
Sbjct: 149 TAGCRLFTQLVSGVNYMHS--KGLVHRDLKLENLLLDKHENLVITDFGFVN--------- 197

Query: 192 QEFAFVQHDILKNTTAQ--YRSPEMI---DLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            EF    +D++K +     Y +PE++     Y  +    K+DIW+ GI LY +     P+
Sbjct: 198 -EF-LKDNDLMKTSCGSPCYAAPELVISTKPYEAR----KADIWSCGIILYAMLAGYLPW 251

Query: 247 E------KGGDQAILHSRYQF-----LAHPIYSDRL-KNLISWMLSQQPMQRPNICQV 292
           +      +G D A L   Y F     L  P Y   + ++L+  +L   P +R NI Q+
Sbjct: 252 DDDPQNPEGDDIARL---YYFITRTSLKFPEYISPIPRDLLRRLLVSDPRKRLNIRQI 306

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 93/198 (46%), Gaps = 29/198 (14%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           V+LLME+   G L   +  R      +      + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAID 224
           +LI  +   K+ DFG     I  PR  +             T  Y SPEMI   R +  D
Sbjct: 220 ILIGFNNVIKLTDFG---WSIINPRGVKRKTLC-------GTIDYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGIFLYKLCYYTTPFEKGGDQA----ILHSRYQF---LAHPIYSDRLKNLISW 277
           +K D+WALG+  Y+L   + PFE+   +     IL +  +F   ++H +     K+LIS 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDV-----KDLISK 321

Query: 278 MLSQQPMQRPNICQVLEE 295
           +L   P +R ++  V++ 
Sbjct: 322 LLKYNPSERISMRDVMKH 339

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 91/179 (50%), Gaps = 23/179 (12%)

Query: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176
           L DF+  +  +++ E E   I  Q+  GI  +H L   +IHRDIK EN++I ++G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEK-SDIWALGIF 235
           DFGS +     P   Q F         + T  Y SPE++   + +  + K  D+WALGI 
Sbjct: 822 DFGSAAYATNGPF--QVF---------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKLCYYTTPFEKGGDQAILHSRYQFL-AH-PIYSDRLKNLISWMLSQQPMQRPNICQV 292
           LY + +  TPF    +  I+ +  +   AH    SD+ + LI  ML ++   RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 98/202 (48%), Gaps = 37/202 (18%)

Query: 104 EVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           +V++  E+C    L D +   LQ R+     + + +Q+   +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNT------TAQYRSPEMIDL 217
           N+L+  +G  K+ DFG                F +  + K +      T  Y +PE+I  
Sbjct: 159 NILLDKNGNAKLTDFG----------------FTRECMTKTSLETICGTTVYMAPELIKR 202

Query: 218 YRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAH-PIYSDRL----- 271
                   K DIW+LG+ LY +   + PF++  +     + ++ +   P+++D +     
Sbjct: 203 ESYDGF--KIDIWSLGVILYTMLNGSMPFDEDDETK---TEWKIMNEMPVFNDTILSEDA 257

Query: 272 KNLISWMLSQQPMQRPNICQVL 293
           K+L+  +LS+ P +RP++ ++L
Sbjct: 258 KDLLIKLLSKDPNERPSMQEIL 279

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 126/281 (44%), Gaps = 56/281 (19%)

Query: 29  ASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKH--VV 86
           ASGG   VY+A     +      K+  ++   P+K  +      VN + ++K S+H  +V
Sbjct: 575 ASGG---VYTATDVNTEASVAIKKMNFEKQ--PKKELI------VNEILVMKASRHENIV 623

Query: 87  CYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIA 146
            +IDS+       NG   ++++ME+   G L D +   +   L E +I  +  +   G+ 
Sbjct: 624 NFIDSY-----FLNGN--LWVIMEYMKGGSLTDVVTHCI---LTEQQISTVTRETLNGLR 673

Query: 147 AMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTT 206
            +H+    +IHRDIK +NVL+S  G+ K+ DFG               A +    LK TT
Sbjct: 674 FLHS--KGVIHRDIKSDNVLLSLSGDIKLTDFGFC-------------AQINEINLKRTT 718

Query: 207 A----QYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQF- 261
                 + +PE++     +    K DIW+LGI + ++     P+    ++  L + Y   
Sbjct: 719 MVGTPYWMAPEVVSR---KEYGPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIA 772

Query: 262 ------LAHP-IYSDRLKNLISWMLSQQPMQRPNICQVLEE 295
                 L  P   S+ LK  + W L   P +R +  ++L +
Sbjct: 773 TNGTPELKDPDSLSECLKAFLDWCLKVDPHERASATELLND 813

>NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335
          Length = 638

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 105/228 (46%), Gaps = 41/228 (17%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG---LNALRAEVNAMKLLKGSKH 84
           I SG    V      P      T+K+  K+ I  EK     LN L  E+  MK +K  K+
Sbjct: 273 IGSGNSGTVVKTLHVP------TSKIIAKKTIPLEKNNEIILNQLIRELTIMKSVKSHKN 326

Query: 85  VVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLID------------FMNTRLQNRLKEY 132
           ++ +  ++     ++N   E+ +LME+   G L              F++++L+N   + 
Sbjct: 327 IISFYGAYYDN--VKNN--EIIILMEYMDCGSLDKILLTYKRLVNRGFIDSKLKNWFNDS 382

Query: 133 EILNIMSQ-VTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNP 191
            IL+ +S  V  G+  ++     +IHRDIK  N+L+++ G+ K+CDFG     I    N 
Sbjct: 383 LILSKLSYAVLNGLDYLYT-NYKIIHRDIKPSNILVNSKGQVKICDFGVSKKLI----NS 437

Query: 192 QEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239
               FV        T+ Y SPE I   +      K D+W+LG+ + +L
Sbjct: 438 IADTFV-------GTSTYMSPERI---QGNVYSTKGDVWSLGLVIIEL 475

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 109/227 (48%), Gaps = 35/227 (15%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAG--------LNALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+ +         + ALR+EV+ +K L
Sbjct: 1220 IGKGSFGAVY----LCLNVTTG-EMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL 1274

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+         ++  Y +FL  E+   G +   +  R+  R  E  I ++ +
Sbjct: 1275 -DHLNIVQYLGFEN-----KDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLNT 1324

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV +G+A +H+    ++HRD+K +N+L+  DG  K+ DFG +S      R  ++  +   
Sbjct: 1325 QVLRGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG-IS------RKSKDI-YSNS 1374

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+
Sbjct: 1375 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCIVLEMFAGKRPW 1419

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 129/286 (45%), Gaps = 49/286 (17%)

Query: 28   IASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPE--------KAGLNALRAEVNAMKLL 79
            I  G F  VY       +  TG   + +K+V +P+        K  + AL++EV  +K L
Sbjct: 1157 IGKGSFGAVY----LSLNITTG-EMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL 1211

Query: 80   KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
                ++V Y+ S      ++   Y +FL  E+   G +   +  RL  R  E  I ++ +
Sbjct: 1212 -DHLNIVQYLGSE-----IRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNT 1261

Query: 140  QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
            QV  G+  +H+    ++HRD+K +N+L+  DG  K+ DFG +S   +  +N     +   
Sbjct: 1262 QVLSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDFG-IS---KKSKN----IYSNS 1311

Query: 200  DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY 259
            D+    T  + +PEM+D    Q    K DIW+LG  + ++     P+    +  ++ + +
Sbjct: 1312 DMTMRGTVFWMAPEMVDT--KQGYSAKVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMF 1366

Query: 260  QF----LAHPIYSDRL-------KNLISWMLSQQPMQRPNICQVLE 294
            Q      A PI  D +       K+ +S      P +RP    +LE
Sbjct: 1367 QIGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 112/248 (45%), Gaps = 41/248 (16%)

Query: 28  IASGGFAQV---YSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA-LRAEVNAMKLLKGSK 83
           +  G F +V   ++    P + P       ++R  I + A     +  E+NA+K L    
Sbjct: 52  LGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKEVKIYREINALKHLTHPN 111

Query: 84  HVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQ 143
             + Y++      +LQN  Y + +++EF + G    ++  + + RLKE     + +Q+  
Sbjct: 112 --IIYLEE-----VLQNSKY-IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLIS 161

Query: 144 GIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILK 203
           G+  MH     L+HRD+K+EN+L+       + DFG V+             F + + L 
Sbjct: 162 GVNYMHY--KGLVHRDLKLENLLLDKHENLVITDFGFVN------------EFFKDNELM 207

Query: 204 NTTAQ---YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEK------GGDQAI 254
           NT+     Y +PE++   +      K+D+W+ G+ LY +     P++       G D A 
Sbjct: 208 NTSCGSPCYAAPELVVSTKPYEA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIAR 266

Query: 255 LHSRYQFL 262
           L   YQ++
Sbjct: 267 L---YQYI 271

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 131/300 (43%), Gaps = 60/300 (20%)

Query: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68
           +T   +  VG +  KILK +  G F +VY A   P        KV LK      K   N 
Sbjct: 26  FTSNELYEVGNY--KILKQVGEGSFGKVYLAIHRPTHR-----KVVLKS---SSKTDPNV 75

Query: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNR 128
           +R EV   +          Y        ++   T +V++ +E+C    L D++   +  R
Sbjct: 76  VR-EVFYHRQFDHPYITKLY-------EIIITET-KVWMSLEYCPGKELYDYL--LVMRR 124

Query: 129 LKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPP 188
           +   E   + +Q+   +   H+L    +HRD+K+EN+L+   G  K+ DFG         
Sbjct: 125 IPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLENILLDMQGNAKLADFG--------- 173

Query: 189 RNPQEFAFVQHDILKNT------TAQYRSPEMI--DLYRCQAIDEKSDIWALGIFLYKLC 240
                  F +    KN       T  Y +PE++  D Y    I    DIW+LG+ LY L 
Sbjct: 174 -------FTRECATKNQLETICGTTVYMAPELLRRDTYDGFKI----DIWSLGVILYTLI 222

Query: 241 YYTTPFEKGGDQAILHSRYQFL-AHPIYSDRLKN-----LISWMLSQQPMQRPNICQVLE 294
             + PF++  +     + ++ +   P Y++++ N     LI  +L + P +RP++ ++L+
Sbjct: 223 NGSMPFDEEDET---RTEWKIINEEPDYNEKIFNANSIELIKSLLIKDPKKRPSMTEILK 279

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 129/306 (42%), Gaps = 49/306 (16%)

Query: 6    IPTYTPGTVLSVGT-HHAK------ILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRV 58
            IPT+      ++G+  H K      +L+ +  G + +V    M   D      K+  K  
Sbjct: 930  IPTFLATPEANIGSMKHIKKFSDFEVLQKMGEGAYGKV-DLCMHKKDRYIVVIKLIFKER 988

Query: 59   IIPE----KAGLNALRAEVNAMKLLKGSKH--VVCYIDSHAARSLLQNGTYEVFLLMEFC 112
            I+ +       L  + +E+  M  L    H  ++  +D        ++  Y         
Sbjct: 989  ILVDTWVRDRKLGTIPSEIQIMATLNAKPHENILMLLD------FFEDDDYYYIETAVHG 1042

Query: 113  TAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGE 172
            T+G +  F    ++  + E+E + I  Q+  GI  +H     ++HRDIK ENV++  +G 
Sbjct: 1043 TSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGF 1100

Query: 173  YKVCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMI--DLYRCQAIDEK 226
             K+ DFGS     SGP           FV        T  Y +PE++  + Y  +     
Sbjct: 1101 VKIVDFGSAAYVKSGPFD--------VFV-------GTIDYAAPEVLGGEPYEGKP---- 1141

Query: 227  SDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQR 286
             DIWA+G+ LY + Y   PF    +  IL +  +  +    SD    LI  +L++   +R
Sbjct: 1142 QDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKR 1199

Query: 287  PNICQV 292
            P+I ++
Sbjct: 1200 PSIDEI 1205

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 114/244 (46%), Gaps = 43/244 (17%)

Query: 67  NALRAEVNAMKLLKGSKHVVCYIDSH----AARSLLQNGTYEVFLLMEFCTAGGLIDFMN 122
           N  R EV   + +   KH+     SH        +LQN  Y + +++E+   G    ++ 
Sbjct: 89  NDYRKEVKIYREINALKHL-----SHPNIVKLEEVLQNSRY-IGIVLEYACGGEFYKYIQ 142

Query: 123 TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVS 182
            +   RLKE     + SQ+  G+  +H+    L+HRD+K+EN+L+  +    + DFG V+
Sbjct: 143 KK--RRLKEMNACRLFSQLISGVHYIHS--KGLVHRDLKLENLLLDKNENLVITDFGFVN 198

Query: 183 GPIRPPRNPQEFAFVQHDILKNTTAQ--YRSPEMI---DLYRCQAIDEKSDIWALGIFLY 237
                     EF   +++++K +     Y +PE++   + Y  +    K+DIW+ G+ LY
Sbjct: 199 ----------EFC-SRNELMKTSCGSPCYAAPELVISAEPYEAR----KADIWSCGVILY 243

Query: 238 KLCYYTTPFE------KGGDQAILHSRYQF--LAHPIYSDRL-KNLISWMLSQQPMQRPN 288
            +     P++      +G D   L++      L  P Y   + ++L+  ML   P +R N
Sbjct: 244 AILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLRRMLVSDPKKRIN 303

Query: 289 ICQV 292
           + Q+
Sbjct: 304 LKQI 307

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 111/233 (47%), Gaps = 37/233 (15%)

Query: 72  EVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKE 131
           E+NA+KLL     V           +LQN  Y + +++E+ + G    ++  +   RLKE
Sbjct: 112 EINALKLLSHPNIV-------KLEDVLQNSKY-IGIVLEYASGGEFYKYLQRK--KRLKE 161

Query: 132 YEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNP 191
               +  +Q+  G+A +H+    L+HRD+K+EN+L+       + DFG V+         
Sbjct: 162 PLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDKHSNLVITDFGFVN--------- 210

Query: 192 QEFAFVQHDILKNTTAQ--YRSPEMIDLYRCQAID-EKSDIWALGIFLYKLCYYTTPFE- 247
            E +   + ++K       Y +PE++     +  D  K+DIW+ G+ LY +     P++ 
Sbjct: 211 -EIS-TNNKLMKTPCGSPCYAAPELV--LSTKPYDARKADIWSAGVILYAMLAGYLPWDD 266

Query: 248 --KGGDQAILHSRYQF-----LAHPIYSDRL-KNLISWMLSQQPMQRPNICQV 292
             +  D + +   Y++     L  P Y + L ++LI  +L  QP  R NI QV
Sbjct: 267 DPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRKILVIQPKSRLNIVQV 319

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 100/217 (46%), Gaps = 40/217 (18%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQN-RLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++L E+ + G L+D++   +Q+  LKE        Q+   +  +H+    ++HRD+KIEN
Sbjct: 176 YMLFEYVSGGQLLDYI---IQHGSLKESRARTFTRQICSALKYLHSHN--IVHRDLKIEN 230

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRC 220
           ++IS DG  K+ DFG +S         + +     F   ++LK T   Y  PE+      
Sbjct: 231 IMISKDGNIKLIDFG-LSNLYDKCNKLKTYCGSLYFAAPELLKATP--YIGPEI------ 281

Query: 221 QAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRY--------QFLAHPIYSDRLK 272
                  D+W+ G+ LY L     PF+   +  +LH +         QFL+  + S    
Sbjct: 282 -------DVWSFGVVLYVLVCGKVPFD-DENSNVLHEKIKQGKVFYPQFLSIEVIS---- 329

Query: 273 NLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNF 309
            L+S ML   P +R  + QV+     ++    P +++
Sbjct: 330 -LLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSY 365

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 101/220 (45%), Gaps = 32/220 (14%)

Query: 32  GFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA-LRAEVNAMKLLKGSKHVVCYID 90
           G+++  S+ +   + P       ++R  IP+ +     +  E+NA+K L     V     
Sbjct: 56  GWSKAASSSL---EVPKQVAIKLIRRDSIPKNSEKEVKIYREINALKHLSHPNIVKL--- 109

Query: 91  SHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHA 150
                 +LQN  Y + +++E+ + G    ++  +   RLKE     + +Q+  G+  MH+
Sbjct: 110 ----EEVLQNSKY-IGIVLEYASGGEFYKYIQRK--RRLKEAIACRLFAQLVSGVNYMHS 162

Query: 151 LQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQ-- 208
               L+HRD+K+EN+L+       + DFG V+             FV H+ L  T+    
Sbjct: 163 KG--LVHRDLKLENLLLDKHENLVITDFGFVN------------EFVSHNELMKTSCGSP 208

Query: 209 -YRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE 247
            Y +PE++   +      KSD+W+ G+ LY +     P++
Sbjct: 209 CYAAPELVVSTKPYEA-RKSDVWSCGVILYAMLAGYLPWD 247

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 132/291 (45%), Gaps = 56/291 (19%)

Query: 28  IASGGFAQVYSAEMFPADTPTGTN-------KVCLKRVIIPEKAGLNALRAEVNAMKLLK 80
           +  G F +V     +P   P+ +N       +V +K  +I      N  + EV   + + 
Sbjct: 47  LGEGEFGKVKLG--WPKSFPSSSNATLEFPKQVAVK--LIKRDTISNDYKKEVKIYREIN 102

Query: 81  GSKHVVCYIDSH----AARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILN 136
             KH+     SH        +LQN  Y + +++E+   G    ++  R   RLKE     
Sbjct: 103 ALKHL-----SHPNIVKLEEVLQNSRY-IGIVLEYACGGEFYRYIQKR--RRLKEINACR 154

Query: 137 IMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAF 196
           + SQ+  G+  +H+    L+HRD+K+EN+L+  +    + DFG V+          EF  
Sbjct: 155 LFSQLISGVHYIHS--KGLVHRDLKLENLLLDKNENLVITDFGFVN----------EFC- 201

Query: 197 VQHDILKNTTAQ--YRSPEMI---DLYRCQAIDEKSDIWALGIFLYKLCYYTTPFE---- 247
            +++++K +     Y +PE++   + Y  +    K+DIW+ G+ LY +     P++    
Sbjct: 202 SRNELMKTSCGSPCYAAPELVISAEPYEAR----KADIWSCGVILYAMLAGYLPWDDDPN 257

Query: 248 --KGGDQAILHSRYQFLAHPIYSDRL----KNLISWMLSQQPMQRPNICQV 292
             +G D   L++ Y  L    + D +    ++L+  +L   P +R N+ Q+
Sbjct: 258 NPEGSDIGRLYN-YISLTPLKFPDYILPIPRDLLRRILVSDPKRRINLKQI 307

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 132/312 (42%), Gaps = 43/312 (13%)

Query: 23  KILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVI---IPEKAGLNALRAEVNAMKLL 79
           K  + I  G F  VY A          T +V   +V+    PE   +  ++ E+  +  L
Sbjct: 26  KRTEVIGRGKFGVVYKAYH------AKTKQVYAVKVLNLDCPEDE-VEDVQKEIQFLASL 78

Query: 80  KGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMS 139
           K   ++  Y  S+   +       +++++ME+C  G L   +      ++ E  +  I+ 
Sbjct: 79  KQVPNITRYYGSYLYDT-------KLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVR 128

Query: 140 QVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQH 199
           ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG  +         Q  A    
Sbjct: 129 KLLIALVYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMA---- 182

Query: 200 DILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF----EKGGDQAIL 255
                 T  + +PE+I        + K+DIW+LGI  Y++     P+         Q I 
Sbjct: 183 -----GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLIT 235

Query: 256 HSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEE--VSRMQGVSS----PMRNF 309
            S+   L    YS  LK  I+  L + P +RP    +L    V   +G S+     + + 
Sbjct: 236 KSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLLSSKFVKAHKGSSATILKELISR 295

Query: 310 YLLRAMQHTNTS 321
           YLL + +H   S
Sbjct: 296 YLLFSEKHNRES 307

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 94/199 (47%), Gaps = 28/199 (14%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILN------IMSQVTQGIAAMHALQPPLIHR 158
           ++ L+E+   G  +  M        K+Y  LN        +Q+  GI  +H  +  +IHR
Sbjct: 278 LYFLLEYAPNGDFLSIM--------KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHR 327

Query: 159 DIKIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLY 218
           DIK EN+L+    + K+ DFG+     R     +E+           TA+Y SPE+++  
Sbjct: 328 DIKPENILLDKSMKVKLTDFGTAKLLNRKD-GTEEYDLTTRSKSFVGTAEYVSPELLN-- 384

Query: 219 RCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKN 273
               +D K DIWA G  L+++     PF+   +    Q ++  +Y F A  P+    +++
Sbjct: 385 -DSWVDHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRD 440

Query: 274 LISWMLSQQPMQRPNICQV 292
           L+  +L ++P  R  I Q+
Sbjct: 441 LVKQILVKKPEHRLTIPQI 459

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 20/195 (10%)

Query: 105 VFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIEN 164
           ++ L+E+   G  +  M  +    L E       +Q+   I  +H  +  +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM--KRFGTLSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 165 VLISADGEYKVCDFGSVSGPIRPPRN-PQEFAFVQHDILKNTTAQYRSPEMI-DLYRCQA 222
           +L+    + K+ DFG+     R   N P +        +   TA+Y SPE++ D Y    
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY---- 385

Query: 223 IDEKSDIWALGIFLYKLCYYTTPFEKGGD----QAILHSRYQFLA-HPIYSDRLKNLISW 277
           +D + DIWA G  L+++     PF+   +    Q ++  +Y F A  P+    L++LI  
Sbjct: 386 VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQ 442

Query: 278 MLSQQPMQRPNICQV 292
           +L ++P QR  I Q+
Sbjct: 443 LLVKKPEQRLTILQI 457

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 96/207 (46%), Gaps = 28/207 (13%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENI 211

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFA----FVQHDILKNTTAQYRSPEMIDLYRCQ 221
           +IS+ GE ++ DFG +S    P +    F     F   ++LK     Y  PE+       
Sbjct: 212 MISSSGEIRIIDFG-LSNMYDPKKQLHTFCGSLYFAAPELLK--AHPYTGPEV------- 261

Query: 222 AIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWM 278
                 DIW+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S M
Sbjct: 262 ------DIWSFGVVLYVLVCGKVPFDD-ENASVLHEKIKQGKVEYPQHLSIDVISLLSKM 314

Query: 279 LSQQPMQRPNICQVLEEVSRMQGVSSP 305
           L   P +R  + QV+      +G   P
Sbjct: 315 LVVDPYKRATLKQVVHHQWMQKGYDFP 341

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 87/186 (46%), Gaps = 26/186 (13%)

Query: 116  GLIDFMN-TRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYK 174
            G ID  +   L+  + E+E   I  QV  GI  +H  +  ++HRDIK ENV++ + G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  VCDFGSV----SGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIW 230
            + DFGS     SGP           FV        T  Y +PE++     +   +  DIW
Sbjct: 1127 LIDFGSAAYVKSGPFD--------VFV-------GTIDYAAPEVLGGEPYEG--KPQDIW 1169

Query: 231  ALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNIC 290
            A+GI LY + +   PF    +  I+    +F      S+   NLI  +L++   +RP I 
Sbjct: 1170 AVGILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQ 1227

Query: 291  QVLEEV 296
             + ++V
Sbjct: 1228 DIYDDV 1233

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 99/211 (46%), Gaps = 20/211 (9%)

Query: 106 FLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENV 165
           ++L E+ + G L+D++       L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 234

Query: 166 LISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDE 225
           +IS  GE K+ DFG +S    P +    F           +  + +PE++  +    I  
Sbjct: 235 MISTSGEIKIIDFG-LSNMYDPKKQLHTFC---------GSLYFAAPELLKAH--PYIGP 282

Query: 226 KSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQ--FLAHPIY-SDRLKNLISWMLSQQ 282
           + D+W+ G+ LY L     PF+   + ++LH + +   + +P + S  + +L+S ML   
Sbjct: 283 EVDVWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVD 341

Query: 283 PMQRPNICQVLEEVSRMQGVSSPMRNFYLLR 313
           P +R  + QV+      +G   P  ++   R
Sbjct: 342 PSKRATLKQVVSHQWMQRGYDFPAPSYLPYR 372

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 113/252 (44%), Gaps = 34/252 (13%)

Query: 104 EVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIE 163
           E++L++E+   G L D++ +R   +L E E ++   Q+ QG+A  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 164 NVLISADGE-YKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTA---QYRSPEMIDLYR 219
           N+L+    +  K+ DFG               A    D L +T+     Y SPE++    
Sbjct: 229 NLLLDKKNKIIKIADFGMA-------------ALEVSDKLLSTSCGSPHYASPEIVMGKS 275

Query: 220 CQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAH--PIYSDRLKNLISW 277
                  +D+W+ GI L+ L     PF     + +L      + H     S   K+LIS 
Sbjct: 276 YHG--SPTDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMPSDLSPDAKDLISK 333

Query: 278 MLSQQPMQRPNICQVLE-----EVSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMV 332
           +L   P +R    ++L      +  RM G+++   N  L  A   +N++ +FI    ++ 
Sbjct: 334 ILVVDPDKRLTTTEILNHSLITKYDRM-GLTNRNYNNNLSMARDKSNSNLNFIN---NLS 389

Query: 333 NTNTFMAPPAQV 344
           N +  +  P  +
Sbjct: 390 NVDILLQNPCDI 401

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,159,216
Number of extensions: 3156233
Number of successful extensions: 14125
Number of sequences better than 10.0: 2039
Number of HSP's gapped: 12970
Number of HSP's successfully gapped: 2121
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)