Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0A01804g2.283ON37637619430.0
Skud_14.2982.283ON38938912881e-177
Suva_14.3112.283ON38935512821e-176
YNL035C2.283ON38934112811e-176
KAFR0H033402.283ON36734412721e-175
Smik_14.2962.283ON38936012571e-173
SAKL0E07766g2.283ON39835012351e-169
KLTH0G10296g2.283ON42634212341e-169
TDEL0G021402.283ON39234912151e-166
KNAG0H020402.283ON39934212021e-164
Kpol_1003.342.283ON38838611991e-164
Kwal_27.115502.283ON40735011961e-163
NCAS0G038702.283ON38938711881e-162
NDAI0G006302.283ON39734411841e-162
KLLA0E08449g2.283ON42233611711e-159
TBLA0B059202.283ON40334811651e-159
Ecym_33212.283ON40934211471e-156
ADL218C2.283ON40334611271e-153
TPHA0C033702.283ON41335111101e-150
CAGL0G01628g2.283ON37634710251e-138
TBLA0A071206.9ON4071781382e-08
KLTH0C11550g6.9ON398941256e-07
KNAG0E009806.9ON4141101132e-05
KLTH0E12694g8.548ON418761123e-05
Kpol_1041.202.401ON5151931123e-05
CAGL0B03575g6.9ON4191101089e-05
Skud_5.336.9ON4011061071e-04
KLLA0D00814g6.9ON4081701071e-04
SAKL0E00814g6.9ON3981911061e-04
ZYRO0F00462g6.9ON393591061e-04
ACR017W6.9ON4231231061e-04
Suva_5.126.9ON4011011042e-04
KAFR0L003206.9ON3911871033e-04
TDEL0H003707.534ON465921033e-04
Kwal_27.120708.548ON418741034e-04
ZYRO0A08690g2.401ON5161741024e-04
Smik_5.316.9ON4271191025e-04
KAFR0B003707.534ON4611271025e-04
Smik_13.3292.401ON5091931017e-04
ADR242C2.401ON5211471008e-04
KAFR0H022608.324ON9381131018e-04
TPHA0G026502.401ON5161921008e-04
Kpol_1045.786.9ON392119990.001
Ecym_30126.9ON397180980.001
Kwal_55.220763.22ON128698990.001
KNAG0F038707.534ON46594980.001
TDEL0G033402.401ON514191980.002
TBLA0B092502.401ON526195980.002
SAKL0C13266g3.25ON459100970.002
YMR131C (RRB1)2.401ON511193970.002
Skud_13.2912.401ON509195970.002
Suva_13.3112.401ON510193970.002
YEL056W (HAT2)6.9ON401106960.002
CAGL0G04345g1.247ON711157970.002
AER255C5.429ON467203960.003
SAKL0C13332g3.22ON135366970.003
TPHA0G018408.631ON43169950.003
Ecym_20243.22ON131795960.003
Kwal_26.77362.469ON507121950.003
KLTH0D05346g2.469ON507121950.003
TPHA0P014903.25ON459114950.003
NCAS0F019702.401ON511190950.004
NDAI0H027502.401ON512210940.004
Skud_16.4827.534ON46593940.005
Ecym_70428.548ON41476930.005
SAKL0H07656g8.631ON426178930.005
KLLA0E07085g3.25ON452120930.006
YOR272W (YTM1)8.721ON460117930.006
Ecym_60672.401ON522148930.006
NDAI0K029006.9ON438171930.006
KNAG0C034907.405ON362102920.006
TBLA0B035708.721ON458117920.007
CAGL0M04279g8.324ON940103930.008
KLTH0F19294g3.25ON451106920.008
CAGL0K03861g2.401ON513176920.009
NDAI0G053401.247ON718108920.009
KLLA0F19734g8.288ON1133174920.009
NCAS0B078401.247ON589129910.010
TBLA0H030601.247ON73083910.011
Ecym_42558.324ON937115910.012
KLTH0D11132g8.672ON437156900.013
ZYRO0F10406g8.324ON938100900.015
Kwal_55.220673.25ON451106890.017
KLTH0G13068g8.288ON110141900.017
ZYRO0F09372g8.721ON448111890.018
KLLA0F17237g2.401ON523195890.018
TBLA0A038908.316ON36295880.022
KLTH0F19338g3.22ON129065890.022
TBLA0F005206.363ON663156890.022
TBLA0H036508.548ON419188880.024
KLTH0H02134g7.310ON129978880.026
Kpol_1064.358.721ON453110870.027
TPHA0C008108.324ON937103880.030
Suva_16.5107.534ON46593870.031
KNAG0G024508.324ON942191880.031
Kwal_26.89758.721ON445107870.031
ADL186C3.22ON136162880.033
Kwal_56.236858.288ON110240870.033
KAFR0A003802.401ON516194870.035
KAFR0A041108.721ON460115860.037
Sklu_YGOB_Anc_2.4012.401ON520214860.038
KNAG0E021802.401ON517210860.038
Kpol_1028.546.325ON905191870.039
NCAS0C044503.25ON461103860.041
Suva_7.519na 1ON20562840.042
KLLA0D16390g8.324ON936102860.043
Ecym_24018.672ON42683860.043
Suva_8.3218.721ON460117860.045
Kpol_1045.337.405ON361103850.046
Suva_11.2681.247ON645113860.047
Ecym_42808.288ON113237860.051
CAGL0K09284g6.325ON911141860.053
SAKL0H08932g8.585ON31478840.053
NCAS0F001906.9ON41178850.057
KAFR0A007002.470ON607158850.058
KNAG0G028208.721ON457122850.059
SAKL0E03058g2.470ON613163850.059
Ecym_12931.399ON30398840.061
KLTH0G12276g8.324ON937103850.063
Skud_11.2711.247ON64686850.067
Suva_7.5185.104ON59362840.071
TPHA0K007807.405ON361117840.073
KLLA0E20967g3.22ON132194850.073
Smik_16.795.104ON59362840.073
Kwal_27.122398.585ON316176830.074
Kwal_47.178272.401ON523192840.074
Kwal_56.223456.9ON396114840.075
KNAG0A036708.548ON426134830.080
Smik_11.2981.247ON66299840.080
YGR225W (AMA1)5.104ON59362840.083
ACR137W8.672ON42581830.083
TBLA0I022806.325ON927147840.083
Kwal_56.244787.310ON129678840.087
TPHA0A003803.22ON131082840.093
Kpol_467.202.469ON581139830.095
NDAI0G033108.67ON885131830.10
KAFR0I028403.25ON456100830.10
CAGL0A00561g4.119ON41274820.11
Ecym_25236.363ON64697830.12
KLLA0E04093g8.316ON372112820.12
Kwal_56.239208.324ON937109830.12
KLTH0E09394g2.401ON522192820.12
TBLA0B087303.25ON461110820.13
NDAI0B051901.247ON668131820.13
NCAS0B004808.721ON456105820.14
SAKL0H05456g8.721ON446113820.14
Kpol_1013.377.534ON468103820.14
TBLA0G014904.122ON73299820.14
ACL116W5.139ON80473820.15
ZYRO0D07744g5.49ON1525177820.15
NDAI0E015008.631ON42857810.15
SAKL0H15532g8.324ON941103820.15
YPR178W (PRP4)7.534ON46593810.15
Kwal_56.238958.316ON367159810.15
Kwal_0.2121.399ON303154810.15
AGL190W8.316ON37032800.18
Ecym_28087.534ON46585810.19
SAKL0H15708g8.316ON36839800.19
NCAS0C039908.67ON730126810.19
KLLA0E23541g8.548ON41782800.19
AGL234W6.363ON62997810.20
SAKL0H16390g8.288ON114044810.20
KLTH0A07282g6.363ON72597810.20
KNAG0E024702.469ON509142800.21
YKR036C (CAF4)1.247ON643139800.21
ACR097W8.631ON46767800.21
Kwal_27.107857.405ON367128800.22
YLR129W (DIP2)8.324ON943104800.23
NCAS0A055206.363ON671109800.23
KLTH0H12122g1.399ON303118790.23
Ecym_80901.247ON716115800.23
Kwal_23.64296.363ON75097800.24
ZYRO0D06556g8.288ON114764800.25
TPHA0M020006.363ON699162800.25
Suva_2.2918.288ON115160800.27
NDAI0J011808.288ON113460800.28
Skud_4.3898.288ON115160800.29
YDR128W (MTC5)8.288ON114860800.30
NCAS0B035508.316ON37531790.30
Skud_16.326.276ON522126790.30
KAFR0G019708.631ON42557790.31
Smik_14.143.25ON466106790.31
NDAI0G025808.324ON958110790.32
Suva_16.606.276ON52674790.32
YHR186C (KOG1)5.49ON1557169790.32
AAL009C1.399ON30398780.32
SAKL0H09900g8.548ON42577780.33
ZYRO0F07282g8.672ON427118780.33
NCAS0B036908.288ON114537790.34
Ecym_41348.435ON810113790.34
KNAG0A012503.25ON452120780.35
KLLA0E20703g7.405ON371100780.35
Skud_7.5615.104ON59362790.35
Ecym_74032.469ON51768780.36
NCAS0B021708.548ON414119780.36
KLTH0E13552g8.585ON31649780.37
Smik_4.3748.288ON115237790.38
NCAS0A134307.231ON60887780.38
KLTH0F16192g5.429ON462166780.38
ZYRO0B03652g7.405ON358102780.38
TPHA0E007707.405ON355103770.42
Suva_10.2228.324ON943103780.42
Kwal_26.77382.470ON611112780.43
ZYRO0F03784g8.67ON777128780.43
Smik_16.4427.534ON47093780.43
KAFR0B055808.288ON112063780.43
CAGL0J01265g2.469ON517109780.43
NDAI0A026107.231ON76787780.44
TPHA0G006808.721ON457117770.46
NCAS0A144707.405ON362130770.46
Kpol_1036.698.324ON936113780.46
KLTH0E15576g1.247ON723127780.48
Skud_15.4378.721ON461105770.49
AGR067W8.288ON112537780.49
YNL317W (PFS2)3.25ON465107770.49
TDEL0F022304.122ON556156770.50
YCR057C (PWP2)6.325ON923112780.51
TDEL0F041508.288ON1134117780.52
Suva_14.223.25ON469107770.52
Kpol_1018.1037.405ON359108760.54
Kpol_1033.198.288ON113960770.54
AGL301C7.405ON361103760.56
KNAG0I010508.288ON1159128770.56
CAGL0L03201g1.247ON579107770.56
TBLA0C018408.672ON42388760.58
Skud_12.2617.356ON580127770.59
SAKL0H07150g8.651ON441166760.59
Suva_5.2287.405ON365138760.59
Skud_14.223.25ON467107760.59
TDEL0A024502.469ON51031760.60
KLLA0D04840g1.399ON30398760.61
NDAI0C057708.585ON335107760.61
Smik_12.1928.324ON943103770.61
Kpol_1014.193.25ON452104760.62
Smik_3.1576.325ON924112770.63
Skud_3.1336.325ON916112770.64
NDAI0G038303.25ON510106760.65
Suva_15.223.22ON1336111770.65
TDEL0D013101.247ON709127760.65
CAGL0H08932g6.239ON902182770.66
KLLA0A08822g4.122ON582167760.67
Kpol_1038.203.22ON131355770.68
TBLA0B046805.49ON1549116770.68
KAFR0C047406.363ON665107760.69
TDEL0A057708.631ON43357760.69
Smik_15.4548.721ON461117760.71
TDEL0A068906.276ON447144760.72
Kpol_1072.418.631ON42058750.75
KAFR0I008408.548ON413129750.77
Kpol_1028.236.363ON744128760.77
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0A01804g
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   753   0.0  
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   500   e-177
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   498   e-176
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   498   e-176
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   494   e-175
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   488   e-173
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   480   e-169
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   479   e-169
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   472   e-166
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   467   e-164
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   466   e-164
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   465   e-163
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    462   e-162
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   460   e-162
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   455   e-159
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   453   e-159
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   446   e-156
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   438   e-153
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   432   e-150
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   399   e-138
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    58   2e-08
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    53   6e-07
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    48   2e-05
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    48   3e-05
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    48   3e-05
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    46   9e-05
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    46   1e-04
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    46   1e-04
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    45   1e-04
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    45   1e-04
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    45   1e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   2e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    44   3e-04
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    44   3e-04
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    44   4e-04
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    44   4e-04
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    44   5e-04
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    44   5e-04
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    44   7e-04
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    43   8e-04
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    44   8e-04
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    43   8e-04
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    43   0.001
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    42   0.001
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    43   0.001
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.001
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    42   0.002
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    42   0.002
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    42   0.002
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    42   0.002
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    42   0.002
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    42   0.002
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    42   0.002
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    42   0.002
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    42   0.003
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    42   0.003
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    41   0.003
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    42   0.003
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    41   0.003
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    41   0.003
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    41   0.003
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    41   0.004
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    41   0.004
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    41   0.005
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    40   0.005
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    40   0.005
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    40   0.006
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.006
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    40   0.006
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      40   0.006
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    40   0.006
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    40   0.007
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    40   0.008
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    40   0.008
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    40   0.009
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    40   0.009
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    40   0.009
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    40   0.010
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    40   0.011
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    40   0.012
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    39   0.013
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    39   0.015
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    39   0.017
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    39   0.017
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    39   0.018
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    39   0.018
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    39   0.022
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    39   0.022
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    39   0.022
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    39   0.024
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    39   0.026
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    38   0.027
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    39   0.030
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    38   0.031
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    39   0.031
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    38   0.031
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    39   0.033
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    38   0.033
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    38   0.035
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    38   0.037
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    38   0.038
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    38   0.038
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    38   0.039
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      38   0.041
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    37   0.042
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    38   0.043
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    38   0.043
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    38   0.045
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    37   0.046
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    38   0.047
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    38   0.051
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    38   0.053
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    37   0.053
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    37   0.057
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    37   0.058
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    37   0.059
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    37   0.059
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    37   0.061
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    37   0.063
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    37   0.067
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    37   0.071
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    37   0.073
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    37   0.073
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    37   0.073
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    37   0.074
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    37   0.074
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    37   0.075
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.080
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    37   0.080
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    37   0.083
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    37   0.083
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    37   0.083
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    37   0.087
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    37   0.093
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    37   0.095
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    37   0.10 
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    37   0.10 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    36   0.11 
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    37   0.12 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    36   0.12 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    37   0.12 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    36   0.12 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    36   0.13 
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    36   0.13 
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       36   0.14 
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    36   0.14 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    36   0.14 
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    36   0.14 
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    36   0.15 
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    36   0.15 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    36   0.15 
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    36   0.15 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    36   0.15 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    36   0.15 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    36   0.15 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    35   0.18 
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    36   0.19 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    35   0.19 
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    36   0.19 
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    35   0.19 
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    36   0.20 
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    36   0.20 
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    36   0.20 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    35   0.21 
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    35   0.21 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    35   0.21 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    35   0.22 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.23 
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    35   0.23 
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    35   0.23 
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    35   0.23 
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    35   0.24 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    35   0.25 
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    35   0.25 
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    35   0.27 
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    35   0.28 
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    35   0.29 
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    35   0.30 
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    35   0.30 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    35   0.30 
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    35   0.31 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    35   0.31 
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    35   0.32 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    35   0.32 
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    35   0.32 
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    35   0.32 
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    35   0.33 
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    35   0.33 
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    35   0.34 
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    35   0.34 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    35   0.35 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   0.35 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    35   0.35 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    35   0.36 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    35   0.36 
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    35   0.37 
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    35   0.38 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    35   0.38 
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    35   0.38 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    35   0.38 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    34   0.42 
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    35   0.42 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   0.43 
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    35   0.43 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    35   0.43 
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    35   0.43 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    35   0.43 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     35   0.44 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    34   0.46 
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    34   0.46 
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    35   0.46 
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    35   0.48 
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    34   0.49 
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    35   0.49 
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    34   0.49 
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    34   0.50 
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    35   0.51 
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    35   0.52 
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    34   0.52 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    34   0.54 
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    34   0.54 
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    34   0.56 
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    34   0.56 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    34   0.56 
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    34   0.58 
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    34   0.59 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    34   0.59 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    34   0.59 
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    34   0.59 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    34   0.60 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    34   0.61 
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    34   0.61 
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    34   0.61 
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    34   0.62 
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    34   0.63 
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    34   0.64 
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      34   0.65 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   0.65 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    34   0.65 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    34   0.66 
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    34   0.67 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    34   0.68 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    34   0.68 
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    34   0.69 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    34   0.69 
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    34   0.71 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    34   0.72 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   0.75 
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    33   0.77 
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    34   0.77 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    34   0.79 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    33   0.80 
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    33   0.81 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    33   0.82 
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    33   0.86 
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    33   0.87 
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    33   0.89 
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    33   0.91 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    33   0.91 
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    33   0.93 
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    33   0.94 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    33   0.95 
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    33   0.95 
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    33   0.96 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    33   0.96 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    33   1.0  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    33   1.1  
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    33   1.1  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   1.1  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    33   1.1  
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    33   1.1  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    33   1.1  
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      33   1.1  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    33   1.1  
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    33   1.2  
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   1.2  
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    33   1.3  
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    33   1.3  
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    33   1.3  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     33   1.3  
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    33   1.3  
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    33   1.3  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    33   1.4  
Ecym_2255 Chr2 complement(504404..505567) [1164 bp, 387 aa] {ON}...    33   1.4  
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    33   1.4  
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    33   1.4  
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    33   1.4  
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    33   1.4  
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    33   1.5  
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    33   1.5  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    33   1.5  
SAKL0F15730g Chr6 (1278090..1279715) [1626 bp, 541 aa] {ON} simi...    33   1.5  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    33   1.6  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   1.6  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    33   1.6  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   1.6  
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    33   1.6  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    33   1.6  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    33   1.6  
Ecym_7353 Chr7 (733666..734625) [960 bp, 319 aa] {ON} similar to...    32   1.6  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    33   1.7  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    33   1.7  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    33   1.7  
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    33   1.7  
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    33   1.7  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    33   1.7  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    33   1.7  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    32   1.7  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    32   1.8  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    32   1.8  
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    33   1.8  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    33   1.8  
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    33   1.8  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    32   1.8  
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    33   1.9  
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    33   1.9  
Kwal_27.11124 s27 complement(647446..650835) [3390 bp, 1129 aa] ...    33   1.9  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    32   2.0  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   2.1  
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    32   2.1  
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    32   2.1  
TBLA0B05250 Chr2 (1235961..1240076) [4116 bp, 1371 aa] {ON} Anc_...    33   2.1  
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    32   2.1  
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    32   2.1  
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    32   2.2  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    32   2.2  
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    32   2.2  
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    32   2.3  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   2.3  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    32   2.3  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    32   2.3  
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    32   2.4  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    32   2.5  
CAGL0D00572g Chr4 complement(72970..76083) [3114 bp, 1037 aa] {O...    32   2.5  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    32   2.5  
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    32   2.5  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    32   2.5  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   2.5  
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    32   2.5  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    32   2.6  
ADL248C Chr4 complement(262457..267043) [4587 bp, 1528 aa] {ON} ...    32   2.6  
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    32   2.6  
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    32   2.6  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    32   2.6  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    32   2.7  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    32   2.7  
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    32   2.7  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    32   2.8  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    32   2.8  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    32   2.8  
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       32   2.9  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    32   2.9  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    32   2.9  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    32   3.0  
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    32   3.0  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    32   3.0  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    32   3.0  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    32   3.1  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    32   3.1  
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    32   3.1  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    32   3.1  
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    32   3.1  
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    32   3.1  
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    32   3.2  
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    32   3.2  
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    32   3.3  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    32   3.3  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    32   3.4  
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    32   3.4  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    32   3.4  
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    32   3.5  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   3.6  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   3.6  
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    32   3.6  
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    32   3.6  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    32   3.7  
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...    32   3.7  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    32   3.8  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    32   3.9  
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    32   3.9  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    32   4.0  
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    32   4.0  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    32   4.0  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    32   4.1  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    31   4.2  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   4.3  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    32   4.4  
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    32   4.4  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    31   4.5  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    31   4.5  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    32   4.5  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    31   4.6  
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    32   4.6  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    31   4.7  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    31   4.7  
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    31   4.8  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    31   4.9  
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    31   4.9  
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    31   5.0  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    31   5.0  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    31   5.0  
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    31   5.0  
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               31   5.1  
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    31   5.1  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    31   5.1  
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    31   5.2  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    31   5.2  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    31   5.3  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    31   5.3  
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    31   5.5  
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    31   5.5  
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    31   5.5  
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    31   5.5  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    31   5.6  
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    31   5.7  
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    31   5.7  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    31   5.8  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    31   5.8  
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    31   6.1  
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    31   6.2  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    31   6.2  
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    31   6.3  
NDAI0B06000 Chr2 complement(1455189..1458320) [3132 bp, 1043 aa]...    31   6.4  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    30   6.6  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    30   6.6  
KLLA0D17116g Chr4 (1451064..1452395) [1332 bp, 443 aa] {ON} simi...    31   6.6  
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    31   6.7  
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    31   6.8  
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    31   6.8  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    31   6.9  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    30   7.1  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    30   7.1  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    30   7.2  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    30   7.2  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    31   7.3  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    31   7.3  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    30   7.3  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    31   7.6  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    31   7.6  
KNAG0D02190 Chr4 (372654..374327) [1674 bp, 557 aa] {ON} Anc_8.1...    30   7.6  
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    31   7.8  
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    30   8.1  
SAKL0H25014g Chr8 (2178085..2179431) [1347 bp, 448 aa] {ON} high...    30   8.1  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    30   8.2  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    30   8.4  
TBLA0A04150 Chr1 (1027635..1029005) [1371 bp, 456 aa] {ON} Anc_8...    30   8.7  
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    30   8.8  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    30   8.8  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    30   8.8  
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    30   8.9  
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    30   8.9  
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    30   8.9  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    30   9.0  
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    30   9.4  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    30   9.4  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    30   9.5  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    30   9.5  
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    30   9.5  
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    30   9.6  
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    30   9.6  
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    30   9.8  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    30   9.8  
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    30   9.8  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    30   9.9  
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    30   9.9  

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/376 (96%), Positives = 363/376 (96%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
           SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVEEPKETXXXXX 360
           ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVEEPKET     
Sbjct: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVEEPKETKHSKK 360

Query: 361 XXXXXXXXNKQRFKPY 376
                   NKQRFKPY
Sbjct: 361 KHSKSKKSNKQRFKPY 376

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  500 bits (1288), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 233/389 (59%), Positives = 295/389 (75%), Gaps = 16/389 (4%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYSLV S SFG+ NWCL LQP+Y++ LL  LSNG++  LDW +G+S+  IK  E ++N L
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           K+I++D       ++A++ AVK++DIR+N C+A I N+ N+PF+SLDSRH +LACGTEL 
Sbjct: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           G DA ++IYD+R+WD+PLRS++DSHHDD+T I FHPSD NVL+SGSTDGYTNIYDL+Q E
Sbjct: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182

Query: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241
           EEDALHQVIN+ASIHSCGWL+ +RI+TLSHMETF+IHELNDKSDE KEPRP +F D+RE+
Sbjct: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242

Query: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301
           W CDYVVD++PG +A G +QEG G+LR+LPF+ E+VD  N I I  AHGDEVVRDVF+ A
Sbjct: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302

Query: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE----------QPVVVEE 351
             S LLYSCGEDG VK W+N  GPLN  + FWDYS+ LNVLDE          +P++++ 
Sbjct: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIIIQ- 361

Query: 352 PKETXXXXXXXXXXXXXN----KQRFKPY 376
            KE+             N    K RFKPY
Sbjct: 362 -KESAVTKPRKEKHKKSNKLSTKSRFKPY 389

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  498 bits (1282), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 228/355 (64%), Positives = 289/355 (81%), Gaps = 4/355 (1%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYSLV+  SFG+ NWCL LQPAY+H LL  LSNG++  LDW TGK +  I+  E A+N +
Sbjct: 3   SYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDM 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           K+I++D    +  ++A++ +VK++DIRSN+C+A I+N+ N+PFLSLDSRH +LACGTEL 
Sbjct: 63  KIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           G DA +HIYDVRKWD+PLRSLVDSHHDD+T I FHPSD NVL+SGSTDGYTNIYDL+Q +
Sbjct: 123 GIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDD 182

Query: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241
           EEDALHQVIN+ASIHSCGWL+P+RI+TLSHMETFSIHELNDKSDE KEP+P++F D+R++
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKA 242

Query: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301
           W CDYVVD++PG++A G +QEG G+LR+LPF+ E++DT N I I  AHGDEVVRDVFV  
Sbjct: 243 WNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVSE 302

Query: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLD----EQPVVVEEP 352
           +N+ +LYSCGEDG VK W+N  G LN    FWDYS+ ++VL+    E P  +EEP
Sbjct: 303 QNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLEDENKEAPTSLEEP 357

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  498 bits (1281), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 225/341 (65%), Positives = 281/341 (82%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYSLV S SFG+ NWCL LQP+Y+H LL  LSNG++  LDW TGKS+  IK  E A+N +
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDM 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           K+I +D       ++A++ AVK++DIR+N+ +A I N+ N+PF+SLDSRH +LACGTEL 
Sbjct: 63  KVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           G DA ++IYD+RKWD+PLRSL+DSHHDD+T I FHPSD N+L+SGSTDGYTNIYDL+Q E
Sbjct: 123 GIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241
           EEDALHQVIN+ASIHSCGWL+P+RIFTLSHMETF+IHELNDKSDE KEP+P++F DVRE 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVREI 242

Query: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301
           W CDYVVDI+PG +A G +QE  G+L +LPF+ E+VDT N I I  AHGDEVVRD+F+PA
Sbjct: 243 WNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFIPA 302

Query: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL 342
           ++S +LYSCGEDG VK WENK GPL++ + FWDYS+ +NVL
Sbjct: 303 QHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVL 343

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  494 bits (1272), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 220/344 (63%), Positives = 280/344 (81%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSYSLV  +SFG++NWCL  QP Y H LL SLSNG+V  LDW+T   + + K  +V++N 
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           +KLINND+ N S +ATAT+ +VKI+DI+SN+C+ATI+NDK +PFLSLDSRH+MLACGTEL
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
            G DAEL+IYDVR W SP++S VDSHHDDITDI FHPSD N L+SGSTDGYTN+YDL Q 
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EE+DAL+QVIN+ASIHSCGWL+PRRI+TLSHMETFSI ELND++DE +EP+P++F D+R+
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            W CDYV+DI+PGY+A G SQEG G L+I+P  GE V+++ AI I+ AH DEV+RDVF+P
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344
             +  +LYSCGEDG+VK+W++        +EFWDYSQ  NV ++
Sbjct: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFEQ 344

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  488 bits (1257), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 285/360 (79%), Gaps = 10/360 (2%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYSLV S  FG+ NWCL LQP+Y+H LL  LSNG++  LDW T KS+ +IK  E A+N L
Sbjct: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           K+I++D       ++A++ AVK++DIR+N+C+ATI N+ N+PFLSLDSRH +LACGTEL 
Sbjct: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           G DA +HIYD+RKWD+PLRSL+DSHHDD+T I FHPSD N+L+SGSTDGYTNIYDL+Q E
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241
           EEDALHQVIN+ASIHSCGWL+P+RI+TLSHMETF+IHELNDKSDE +EP+P++F DVR++
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242

Query: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301
           W CDYVVDI+PG +A G +QE  G+LR++PF+ E++ T     I  AHGDEVVRD+F+ A
Sbjct: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302

Query: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLD----------EQPVVVEE 351
             S +LYSCGEDG VK W++  GPLN  + FWDYS+ +NVL           E+P+++++
Sbjct: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLIIQK 362

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  480 bits (1235), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 212/350 (60%), Positives = 278/350 (79%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSYS +++ SFG  NWCL LQP Y   LL SLSNG +H +DW TG+ I        +++ 
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           LK++NN+  N   +A+A+  +VKI+D+R+++C+AT+ NDK+APFLSLDSRH+MLACGTEL
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SG DAELHIYD++K   PLRS VDSHHDDITD  FHP DP VLMSGSTDGY NIYDL  +
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           +EEDALHQVINFAS+HSCGWLAPRRI+TLSHMETF+IHELNDKSD+ +EP+PVEF DVR+
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            WGCDY+++I+PG++A G SQE  G+L+++ F  E+VDT N + I  AHGDE++RDV +P
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVE 350
            + + +LYSCGEDG +  W++++GPLN++ +FWDYS+  NV ++  V V+
Sbjct: 301 DQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTVVEVD 350

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  479 bits (1234), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 219/342 (64%), Positives = 269/342 (78%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSYS + S  FG NNWCL LQP Y   LL SLSNG+V  +DW T KSI  I+T   +VN 
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           + +INND  N S  ATA   AVKI+D++SN+C+AT+ N K+APFLSLDSRH +L CGTEL
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SG DAELH+YD+R W  PLRSLVDSHHDDIT I FHPSDPNVL+SGSTDGY NIYDL Q 
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EE+DALHQVINFASIHSCGWL+P+RI+TLSHMET+ IHELNDK DE  EP+PV+F DVR+
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            W C+YV+D++PG++A G S+EG G+L+++P   E+ +  +AI I +AH DEVVRDV VP
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVP 319

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL 342
            ++  LLYSCGEDGS+K W++ +GPLNV  EFW YS+ ++V 
Sbjct: 320 FQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVF 361

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 213/349 (61%), Positives = 277/349 (79%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYS ++++ FG++NWCL LQP Y H LL SLSNG+VH +DW TGKS+   + G  ++NKL
Sbjct: 3   SYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKL 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           K+I+++    S+YA A+  +V I D+RS + LA++ NDKNAPFLSLDSRH MLACGTELS
Sbjct: 63  KIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTELS 122

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           G DAELHIYDVR W +P+RS VDSHHDD+TDI FHPSD NVL+SGSTDGYTN+YDL+Q E
Sbjct: 123 GVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQE 182

Query: 182 EEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRES 241
           E+DALHQVIN+ASIHSCGWL+P+RIFTLSHMET ++HELNDKSDE +EP+P++F D+RE 
Sbjct: 183 EDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREK 242

Query: 242 WGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPA 301
           WGC YVVD++PGYVA G+SQE    L+++  + EQ++T  ++ I +AHG+EVVRDV +P 
Sbjct: 243 WGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLIPP 302

Query: 302 RNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVE 350
           +N  +LYSCGEDG+VK W+ K    ++   FWDYS+ ++V  E+    E
Sbjct: 303 QNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSEEATTPE 351

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  467 bits (1202), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 212/342 (61%), Positives = 275/342 (80%), Gaps = 1/342 (0%)

Query: 4   SLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKL 63
           S + S  FG+ NWC  +QP Y+  +L SLSNG+VH +DW++ KSI   K+ E A+N L++
Sbjct: 5   SQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQI 64

Query: 64  INNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS 123
           +N D  NE+ + TA+M AVK++D+RSN C+ TI N+  APFLSLDSR++ +ACGTEL G 
Sbjct: 65  VNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGV 124

Query: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           DA+LHI+D+RK D+P +SLVDSHHDDIT I FHPSD NVL+SGSTDGYTNIYDL Q EE+
Sbjct: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEED 184

Query: 184 DALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRESWG 243
           D+LHQVINF SIHSCGW+ P+RI+TLSHMETF+IHELN+KSDE  EP+P++F D+R +WG
Sbjct: 185 DSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWG 244

Query: 244 CDYVVDIHPGYVACGNS-QEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPAR 302
           CDYVVDI+PGYVA G S +EG G+L+++P +GE V  +N I I +AHGDEV+RDVF+P +
Sbjct: 245 CDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQ 304

Query: 303 NSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDE 344
           NS+++YSCGEDG +  W N SGPLNV ++FW+Y   +NVLDE
Sbjct: 305 NSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE 346

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  466 bits (1199), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 288/386 (74%), Gaps = 11/386 (2%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           SYSL++S S G  +WCL LQP Y+H LL+SLSNG V+ LDW TG  I  +K G  ++N++
Sbjct: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62

Query: 62  KLINNDHENESTYATATMGAVKIWDIR--SNNCLATISNDKNAPFLSLDSRHNMLACGTE 119
           +++++D++N S ++ A   AVK+ D+R   N+ +A ++N+K  PFLSLDSRH MLACGTE
Sbjct: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122

Query: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           LSG DAE+HIYD+R +D P+R LVDSHHDD+TDI FHPSDPNVL+SGSTDGYTN+YDL Q
Sbjct: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182

Query: 180 AEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVR 239
            EEEDALHQVIN+ S+HSCGWL+P+RI+TLSHMETF+IHELN+KSDE  EP+P++F D+R
Sbjct: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242

Query: 240 ESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFV 299
            +W CDYVVD++PGY+A G S+E  G L+I+PF  E ++ N++I I  AHGDEVVRDVF+
Sbjct: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302

Query: 300 PARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL----DEQPVV-----VE 350
             ++  ++YSCGEDGSVKTW+ ++  L V   FWDYS  +NVL    DEQ +      + 
Sbjct: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDDNIDEQNIEQSTRNIS 362

Query: 351 EPKETXXXXXXXXXXXXXNKQRFKPY 376
           EP                +K+R+KPY
Sbjct: 363 EPSIEKEKKKSKHKKSKHSKRRYKPY 388

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  465 bits (1196), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 269/350 (76%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSYS V+S +FG +NWCL LQP Y   LLASLSNG V  +DW   K I+ I+     ++ 
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           + ++NND  N    ATA   +VKI+D+RS++ +AT+ N+K+APFLSLDSRH MLACGTEL
Sbjct: 61  MVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SG DAELHIYD++ W  PLRSLVDSHHDDIT+I FHP+DPNVL+SGSTDGY NIYDL Q 
Sbjct: 121 SGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQP 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EE+DALHQVINFASIHS GW AP+RI+TLSHMETF IHELNDK +E  EP P +F D+R+
Sbjct: 181 EEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQ 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
           SWGCDYVVD++PG++A G SQEG G+++++PF GE +D ++A+ I +AHGDEVVRDV VP
Sbjct: 241 SWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVVVE 350
            ++  +LY+CGEDG V  W++  GPLNV  EFW Y+  ++V       VE
Sbjct: 301 FQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGSVAEVE 350

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  462 bits (1188), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/387 (56%), Positives = 287/387 (74%), Gaps = 13/387 (3%)

Query: 2   SYSLVNSESFGNNNWCLNLQPAYQHS---LLASLSNGQVHQLDWQTGKSIAHIKTGEVAV 58
           SYSLVNS SFG+NNW L LQP  QH    LL SLSNG+VH LD  T  +I      E ++
Sbjct: 4   SYSLVNSRSFGSNNWALKLQP-LQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSI 62

Query: 59  NKLKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGT 118
           N L+LIN++  +   + TAT  +VKI+DI S   +ATI +  N PF SLDSRH +LACGT
Sbjct: 63  NDLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGT 122

Query: 119 ELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           EL G DA ++IYD+RKWD P+RSLVDSHHDD+T + +HP+DPN+L+SGSTDGYTN+YDL 
Sbjct: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182

Query: 179 QAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDV 238
           +AEEED+LHQVINFASIHSCGWL+PRRIFTLSHMETF+IHELNDKSD  KEP+P++  DV
Sbjct: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242

Query: 239 RESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVF 298
           RE WGCDYVVD++PG++A G SQE  G+L+++P Q E +D  N+I I  AH DEV+RDV+
Sbjct: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302

Query: 299 VPARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQPVV---------V 349
           +P+ +S ++Y+CGEDG+VK W+N +GPLNV ++ WDYS+ +N+L++  +          V
Sbjct: 303 IPSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLEDTLLAPSEVVTAGEV 362

Query: 350 EEPKETXXXXXXXXXXXXXNKQRFKPY 376
           ++ +E              +KQR+KPY
Sbjct: 363 KQSQEPDTKEKKHKKKKRDHKQRYKPY 389

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  460 bits (1184), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 212/344 (61%), Positives = 279/344 (81%), Gaps = 3/344 (0%)

Query: 3   YSLVNSESFGNNNWCLNLQPAYQ-HSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKL 61
           YSL+NS SFG+NNWC   QP  + + LL SLSNG++H LD+ T +S   I+   +++N L
Sbjct: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNC-LATISNDKNAPFLSLDSRHNMLACGTEL 120
           K++N+D    S ++TAT  +VKI+DI SNN  +AT+ NDKN PFLSLDSRH +LA GTEL
Sbjct: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
            G DA+++IYD+RKWD+PLRSL+DSHHDD+T + FHPSDP VL+SGSTDGYTN+YDL Q 
Sbjct: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           +E+DALHQV+N+ASIHSCGWL+P RIFTLSHMETF+IHELNDKS+E KEP+P++F DVRE
Sbjct: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            WGCDYV+D++PGY+A G SQEG G+L+++P  GE +   +++ I +AHGDEV+RDVF+P
Sbjct: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQ-LLNVLD 343
             +S+L+YSCGEDG V  W+N +G LNV ++FWDYS+  ++VLD
Sbjct: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLD 349

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 256/336 (76%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MS++      F  NNWCL LQP YQH L+ S+S+G VH LDW   K+I+ I+    ++N 
Sbjct: 1   MSFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSIND 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           +K+IN+D +  + +ATA    VK+WDIR+ N +A++ NDK +PF SLDSRHNMLACGTEL
Sbjct: 61  MKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
              DAELHIYD+R W  P+RS VDSHHDDITDI FHP D N+LMSGSTDGY NIYDL Q 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQD 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           +EEDALHQVINFASIHSCGWL P+RI++LSHMETF IHELNDKSDE  EP+P+EF DVR+
Sbjct: 181 DEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRD 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            WGCDYV+DI+P ++A G + E  G+L+I+PFQ EQVD ++A+ I  AHG+EV+RDV +P
Sbjct: 241 KWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYS 336
              + LLYSCGEDG V  W++ +  LNV   FWDY+
Sbjct: 301 KNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYT 336

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  453 bits (1165), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 270/348 (77%), Gaps = 4/348 (1%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MS   +N  SFG+NNWCL  +P Y + LL SLSNG++  LDW+T +    IK GE ++N 
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
            +++NN++   S   TAT  +VKI+D++SN+C+ TI+N+KN+PFLSLDS HNM+ACGTEL
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SG DAEL+IYD+R WD+P+RS VDSHHDDITDI FHP+D  VLMSGSTDGYTNIYDL + 
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EEED+LHQVIN++SIHSCGWL+ RRIFTLSHMETF+IH+LNDKS+  KEP+P+EF D+R 
Sbjct: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDT--NNAIDINAAHGDEVVRDVF 298
            WGC+YV+D++PGY+A G ++E  G+L+I PF  E++D   +N I I  AHGDEV+RDVF
Sbjct: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300

Query: 299 VPARNSKLLYSCGEDGSVKTW--ENKSGPLNVTDEFWDYSQLLNVLDE 344
           +   +   +YSCGEDG+VK W  +  +  L + + F+DYS  LNVLDE
Sbjct: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDE 348

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSY+  ++ SFG++NWCL LQP Y   LL++LSNG VH +DW +  SI  I     +++ 
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           LK+++ND ++ +T+ TA+  +VKI+D+R N C+AT+ N KN+PF+SLDSRH MLACGTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           SG+DAE+H+YD++K D+P+RS  DSHHDDITDI FH SDP+VL+SGSTDGY N+YDL+Q 
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EEE+ALHQVINFASIHSCGWL+P+RI+ LSHMETFSIHELNDKSDE  EP+P+EF D+R+
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            W CDYVVDI PG +  G++QE    L++LPF  E+VDT N+I I  AHGDEVVRD  + 
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQEQ-SMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL 342
              S+L YS GEDG++  W++  G LNV  EFW+Y + LNVL
Sbjct: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 266/346 (76%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MSY L    SFG +NWCL L+P YQ  +LA+LSNG VH +DW TGKS+  +   E ++N 
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           L+++++ H+  + +ATA    VK++DIR+  C+AT+++   AP LSLDSRH MLA GTEL
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
            G DA + ++ + +W  PLR+ VDSHHDD+TD+ FHP+D N+L+SGSTDGY N+YDL+Q+
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240
           EE++ALHQVINFASIHSCGWL+P+RI++LSHMETF+IHELNDKS+ A EP+P  F DVRE
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300
            W CDYVVD++PG++A G+++E  G+LR+LP + E VD  NAI +  AHGDEVVRDV VP
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300

Query: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQP 346
           A + +LLYS GEDG++  W++  GPLNV  +FWDYS+   VL++ P
Sbjct: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLP 346

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 264/351 (75%), Gaps = 7/351 (1%)

Query: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           MS  LVN  +FGN+NWCL L+P Y   LL S SNG V+ +DW +   I   + GE  +N 
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNC-LATISNDKNAPFLSLDSRHNMLACGTE 119
           L++INND EN   +A  ++ +VKI+D+R+ +  +ATI NDKN+ FLSL+SRH+ML CGTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           L+G DAE+ IYDVR +  P+R+ VDSHHDDITDI FHPSD N+L+SGSTDGYTNIYDL Q
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 180 AEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVR 239
            +E++ALHQVIN+ASIHSCGWL+P+RI+TLSHMETF+IHELNDKSDE  EPRP++F D+R
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 240 ESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFV 299
             W CDYVVD++PGYVA G S E  G+L+I  F+ E ++T N I I  AHGDEV+RDVF+
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 300 PARN----SKLLYSCGEDGSVKTWENK--SGPLNVTDEFWDYSQLLNVLDE 344
           P  N    S ++YSCGEDG+V  W     S  LNV+ +FW+ ++ L+VL +
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  399 bits (1025), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 251/347 (72%), Gaps = 7/347 (2%)

Query: 3   YSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLK 62
           YSL  S +FG+NNWCL LQP + + +L S+S+G+VH L     K  +  K GE ++N L 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVH-NGILTSVSSGEVHLLGLDLSKQDS-FKVGETSINALS 59

Query: 63  LINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSG 122
            ++     E+ +A +    VK++D+R N  +AT+  +  A  LSL S H MLA G+E  G
Sbjct: 60  RVDG---QENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQG 116

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
            DA LH++D+R W  P+RS VDSH DDIT IAFHP+D NVL+SGSTDGYTN+YDL + EE
Sbjct: 117 VDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEE 176

Query: 183 EDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRESW 242
           EDALHQVIN+ASIHSCGWLAPRRIFTLSHMETF+IHELNDKS+E +EP+P++F D+R+ W
Sbjct: 177 EDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPW 236

Query: 243 GCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVPAR 302
            C+YVVDI+PGY++ G S+EG G LRI+PF+ E V   + I I+ AHGDE+VRD ++   
Sbjct: 237 DCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 303 NSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL-DEQPVV 348
            S +LYSCGEDG VK W N    L++ + FWDYS  +++L DE P V
Sbjct: 297 QSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSDEVPEV 342

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 14  NNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENEST 73
           N + L   P  +  LL+S  +G V    W   KSI  +   E ++      N  ++N   
Sbjct: 171 NGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFG 228

Query: 74  YATATMGAVKIWDIRSNNC-LATISNDK-------NAPFLSLDSRHNMLACGTELSGSDA 125
           Y T +   + + D+R+NN  L  +SN         NA   S  S + M A     SG D+
Sbjct: 229 YVTES-SCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDS 282

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
            +++YD R  + PL  +   H D +T + FH  +  +++SG +D    ++DL+Q  +E
Sbjct: 283 LIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ- 179
           +G+D+++ +YD+RK ++P+ S+   HHD +T + F P    +L SGS+D    I+DL Q 
Sbjct: 267 AGTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325

Query: 180 ---AEEEDALHQVINFASIHSCGWLAPRRIFTLS 210
               ++EDA   V     +H+ G  +P   F+ S
Sbjct: 326 GAEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 23/112 (20%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTE-------LSGS---DAELHI 129
           G++ IWD+ S          KN P + +D+ HN +    +       L GS   D+ L I
Sbjct: 184 GSIAIWDVCSG---------KNTP-VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLII 233

Query: 130 YDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           +D ++ D P+  ++ S  +    +AF     N+  +  TD    +YDLR+ E
Sbjct: 234 HD-KRIDKPVVKILQS--EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE 282

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWD 136
            +++I D R +  +ATI+  K  PF +L   H   N+LA G    G ++E+++YD R  +
Sbjct: 245 SSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG----GVNSEVYLYDRRYVE 298

Query: 137 SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
            PL  L+  H D +T + F   D  +++S   D    I+D+     E  L
Sbjct: 299 EPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVL 347

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 47/76 (61%), Gaps = 6/76 (7%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTD-G 170
           +ML C  + +G    ++++D+R +  PL++L+  H+D I+ + ++P +P VL +G  D G
Sbjct: 303 DMLLCSADSAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGG 357

Query: 171 YTNIYDLRQAEEEDAL 186
              I+DL Q E ++ +
Sbjct: 358 LVKIWDLSQPEGQELI 373

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 91/193 (47%), Gaps = 19/193 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL    +GQV+     T K +   +   V+ NK ++ I       + +ATA   G +++
Sbjct: 294 ALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRV 353

Query: 85  WDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR- 140
           WD RS      ++T +++ +   +S + +   L    + +G+     ++D+R++ SP   
Sbjct: 354 WDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGT---WGVWDLRQF-SPSNE 409

Query: 141 -----SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFAS 194
                +  D H   IT I+FHP+D +++   S D    ++DL  +A++E+   Q    A 
Sbjct: 410 NAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQT---AE 466

Query: 195 IHSCGWLAPRRIF 207
                 + P+ +F
Sbjct: 467 TKELAQIPPQLLF 479

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 47/110 (42%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHDDI 150
           TI N  N    +LD    ++  G  L+G D    +Y  +    KW +  +    S++  I
Sbjct: 272 TIRNHGNVEGYALD-WSPLIRSGALLTG-DCSGQVYFTQRHTSKWVTDKQPFTVSNNKSI 329

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  ++  V  +   DGY  ++D R  + + A+    +   ++   W
Sbjct: 330 EDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISW 379

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 57/110 (51%), Gaps = 6/110 (5%)

Query: 81  AVKIWDIRSNNCLATISNDKNAPFLSLDS-RHNMLACGTELSGSDAELHIYDVRKWDSPL 139
            +K++D RS+  +  I+  K    L+      N+ A     +G+D  +++YD+R   +PL
Sbjct: 251 TMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA----AGTDNLVYLYDIRDVSNPL 306

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQV 189
            ++   H D +T I F P++  +L S  +D  T ++DL++   E    ++
Sbjct: 307 YAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 120 LSGSD-AELHIYDVRKWDS---PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
           LSGSD + + ++D+  ++    P  +  D+H D I D+ +H S+ ++  S S D    ++
Sbjct: 196 LSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLF 255

Query: 176 DLRQAE 181
           D R ++
Sbjct: 256 DKRSSQ 261

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 11/106 (10%)

Query: 82  VKIWDIRSNNCLATISNDK-NAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWDS 137
           +KI DIR+ N   TI   K   PF +L   H   N+LA     +G D+ +++YD+R    
Sbjct: 233 LKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAA----AGMDSHVYLYDLRNMKE 286

Query: 138 PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           PL  +   H D +T++ F P    V++S  +D    ++DL+Q   E
Sbjct: 287 PLHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAE 331

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 79/170 (46%), Gaps = 15/170 (8%)

Query: 14  NNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINND---HEN 70
           N + L   P     LL++  +G V   D  +  + +  +T +V  +    I ND   HE 
Sbjct: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTD----IVNDCKWHEF 226

Query: 71  EST-YATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSR-HNMLACGTELSGSDAEL 127
           +S+ + T +    + I D  S+  +  +S       L+   R  N+LA     +G+D+ +
Sbjct: 227 QSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAA----AGTDSNV 282

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
           ++YD+R+   PL S+   H D +T + F P    +L S  +D    ++DL
Sbjct: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 95/191 (49%), Gaps = 21/191 (10%)

Query: 4   SLVNSESF-GNNNWCLNLQPAYQHSLLASLSNGQV---HQLDWQTGKSIAHIKTGEVAVN 59
           +LV+  +F  +N + L+  P  +  LL+   +G +   + +   T  S A + T E  VN
Sbjct: 152 ALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKA-VTTHEDIVN 210

Query: 60  KLKLINNDHE-NESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLD-SRH--NML 114
                   HE NE+ + + +    ++I D R+N+ +  ++   ++PF +LD S+H  N+ 
Sbjct: 211 DCTW----HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLF 264

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
           A     +G+D+ +++YD+R     L ++   H D +T + F P    +L S  +D    +
Sbjct: 265 AA----AGTDSLVYLYDLRNTADALHTM-SGHEDSVTSLEFSPHKDGILCSSGSDRRVLL 319

Query: 175 YDLRQAEEEDA 185
           +DL Q   E A
Sbjct: 320 WDLMQIGSEQA 330

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           +G+D+ +++YD R+   PL  ++  H D +T + FHP +  VL+S  +D  T ++DL +
Sbjct: 262 AGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 63/147 (42%), Gaps = 31/147 (21%)

Query: 55  EVAVNKLKLINN-DHENESTYATATMGAVKIWDIRSNNCLATIS-----------NDKNA 102
           EV  + +K+I   +HENE T A         +  + +N +ATIS           N+  +
Sbjct: 93  EVLKSNVKIIKKFEHENEVTRAR--------YMPQDDNLIATISGVGTIYLYNRANEVES 144

Query: 103 PFLSLDSRHNMLACGTE---------LSGSD-AELHIYDVR-KWDSPLRSLVDSHHDDIT 151
             LS    HN    G           LSGSD + + ++DV  K   P+ +  D H D + 
Sbjct: 145 GLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN 204

Query: 152 DIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           D  +H  D N+  S S D    ++D R
Sbjct: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQR 231

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 27/123 (21%)

Query: 85  WDIRSNNCLATISNDKN-------------------APFLSLD-SRH--NMLACGTELSG 122
           W    +N   T+S DK                    +PF +L  S+H  N+LA     +G
Sbjct: 238 WHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAA----AG 293

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
            D+++++YD+R   SPL  ++  H D +T + F P    ++ S  +D    I+DL Q   
Sbjct: 294 VDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGA 352

Query: 183 EDA 185
           E +
Sbjct: 353 EQS 355

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 116 CGTELSGSD-AELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
            G  LSGSD   + ++D+     P +S++ SH D + D+ +H  + NV  + S D    +
Sbjct: 199 SGELLSGSDDTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV 257

Query: 175 YDLR 178
           +D R
Sbjct: 258 HDKR 261

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWDSP 138
           +KI D+R  N   T +     PF +L   H   N+LA     +G+D+ +++YD+R    P
Sbjct: 233 LKINDLRVENT-TTGTAKCPEPFNTLAFSHHSSNLLAA----AGTDSHVYLYDLRNMKEP 287

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           L  +   H D +T++ F P    V++S  +D    ++DL+Q
Sbjct: 288 LHHM-SGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQ 327

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 34/187 (18%)

Query: 13  NNNWCLNLQPAYQHSLLASLSNGQVHQLD-----------WQTGKSIAHIKTGEVAVNKL 61
           +N + L+  P  +  LL++  +G +   D           WQ+        T    +N +
Sbjct: 152 DNGYGLSFNPISKGQLLSAADDGYIAMYDINAESEDPVETWQS--------TDNCIINDI 203

Query: 62  KLINNDHENESTYATAT--MGAVKIWDIRSNNCLATISNDKNAPFLSLD-SRH--NMLAC 116
           K     H + + + T +     + I+D+R+ + + +I  ++  PF SL  S+H  N+ + 
Sbjct: 204 KW---HHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLFSA 258

Query: 117 GTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
                G+D  +++YD+R     L S+   H   +T++ FH S   +L+S S D    I+D
Sbjct: 259 A----GTDQNVYLYDLRNTRKTLHSM-SGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWD 313

Query: 177 LRQAEEE 183
           L +   E
Sbjct: 314 LMEIGSE 320

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 127 LHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
           + I+D    DSP+++    H D+   ++F+P     L+S + DGY  +YD+  AE ED +
Sbjct: 132 VSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI-NAESEDPV 189

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           IWDIRS NC   +S     P  S+D         T  +  D  ++I+D+RK + P   ++
Sbjct: 333 IWDIRSGNCAMVLSG-HTKPIYSVDWSPRGFEVAT--ASGDGTVNIWDIRKTNQP--QVL 387

Query: 144 DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
            +H+  ++ I F   +   LMS   D   N+Y
Sbjct: 388 LAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVL-MSGSTDG 170
           ++L C  + +G    ++++D+R + SP+RSL   HH  ++ + ++P  P +L  +G  DG
Sbjct: 303 DLLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDG 357

Query: 171 YTNIYDLRQAEEED 184
              I+DL Q  +++
Sbjct: 358 LVKIWDLSQPVDQE 371

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATA-TMGAVKI 84
           +LL    +GQ+      T K I   +    A N+ ++ I       + +AT+ T G V+I
Sbjct: 294 ALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRI 353

Query: 85  WDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           WD RS      ++T +++ +   +S + +   L    + +GS     ++D+R++ SP  S
Sbjct: 354 WDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGS---WGVWDLRQF-SPANS 409

Query: 142 -------LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQ 188
                    D H   IT I+F+P D +V+   S D    ++DL    ++D + Q
Sbjct: 410 EGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQ 463

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 6/116 (5%)

Query: 89  SNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVD 144
           S   + TI N  N     LD    ++  G  L+G D    I+  +    KW +  +    
Sbjct: 266 SRKAIHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGQIFLTQRHTSKWITDKQPFTA 323

Query: 145 SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
           +++  + DI + P++  V  +  TDGY  I+D R  + + A+    +   ++   W
Sbjct: 324 ANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW 379

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 12/119 (10%)

Query: 70  NESTYATATMGAV-KIWDIRSNNCLATISNDK-NAPFLSLDSRH---NMLACGTELSGSD 124
           NE  + T +  ++ KI D+R++N   TI   K   PF +L   H   N+LA     +G D
Sbjct: 246 NEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAA----AGMD 299

Query: 125 AELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           + +++YD+R    PL  +   H D +T+I F      V++S  +D    ++DL+Q   E
Sbjct: 300 SHVYLYDLRNMREPLHHM-SGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAE 357

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 12/75 (16%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWD--------SPLRSLVDSHHDDITDIAFHPSDPNVL 163
           N L  G  LSGSD     + V  W+        SP+R+  D H D + DI +H  +  + 
Sbjct: 195 NALVEGQLLSGSDD----HTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLF 250

Query: 164 MSGSTDGYTNIYDLR 178
            + S D    I D+R
Sbjct: 251 GTVSEDSLLKINDVR 265

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           +WDIR    + T+ N  + P   +D   N     T   G D  ++I+D+RK  + L + +
Sbjct: 331 LWDIRCGKSIMTL-NGHSKPVYCVDWSCNGYNVAT--GGGDGLINIWDIRK--TNLVNTI 385

Query: 144 DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD----LRQAEEEDALHQVI------NFA 193
            +H++ I+D+ F   D   L+S S D   NIY     L+    E   H ++      N  
Sbjct: 386 LAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLKVKTLEGHSHNILSVDMTNNAK 445

Query: 194 SIHSCGW 200
           ++ S GW
Sbjct: 446 ALISGGW 452

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 87/193 (45%), Gaps = 18/193 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           SLL+   +GQV+     T + +   +   V+ NK ++ I       + +ATA   G ++I
Sbjct: 287 SLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSESTVFATAGCDGYIRI 346

Query: 85  WDIRSNNCLATIS---NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           WD RS      IS   ++ +   +S   +   L    + +G+     ++D+R++      
Sbjct: 347 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---WGVWDLRQFTPSNAD 403

Query: 142 LV------DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFAS 194
            V      D H   IT IAF+P D +++  GS D    ++DL  +A++E+   Q      
Sbjct: 404 SVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKE 463

Query: 195 IHSCGWLAPRRIF 207
           +     + P+ +F
Sbjct: 464 LQE---IPPQLLF 473

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 47/110 (42%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK----WDSPLRSLVDSHHDDI 150
           T+ N  N     LD    ++  G+ LSG D    +Y  ++    W +  +    S++  I
Sbjct: 265 TVKNHGNVEGYGLD-WSPLIKTGSLLSG-DCSGQVYFTQRHTSRWVTDKQPFTVSNNKSI 322

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  S+  V  +   DGY  I+D R  + + A+    +   ++   W
Sbjct: 323 EDIQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 73/147 (49%), Gaps = 18/147 (12%)

Query: 72  STYATATM-GAVKIWDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
           + +AT  + G V+IWDIRS      L+   +D +   +S + + + L    + +G+    
Sbjct: 346 TVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGT---W 402

Query: 128 HIYDVRKWD------SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QA 180
            ++D+R++       SP+ +  D H   IT I+F+P D +++   S D    ++DL  +A
Sbjct: 403 GVWDLRQFSNQQGGVSPV-AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEA 461

Query: 181 EEEDALHQVINFASIHSCGWLAPRRIF 207
           ++E+   Q    A +     + P+ +F
Sbjct: 462 DDEEIKQQA---AEVKELQQIPPQLLF 485

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 48/110 (43%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHDDI 150
           TI N  N     LD    ++  G  L+G D    ++  +    KW +  +     ++  I
Sbjct: 278 TIKNHGNVEGYGLD-WSPLIKTGALLTG-DCSGRVFLTQRTSSKWITDKQPFTVDNNKSI 335

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI + PS+  V  +   DG+  I+D+R  + + AL   ++   ++   W
Sbjct: 336 EDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSW 385

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 9/113 (7%)

Query: 68  HENESTYATA-TMGAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDA 125
           HE+ +  A   + G +K+WD+ S   L T +  K+A   L+ DS    L  G+    +D+
Sbjct: 83  HEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGS----NDS 138

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           ++ ++D+   +  L  L  SH D+IT I +   D N L+S S DG   ++DL+
Sbjct: 139 DIIVWDLVS-EVGLYKL-RSHKDNITGI-WCSDDENWLISTSKDGLIKVWDLK 188

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G +KIW+++++ C+ T      A          ++  GT     + EL ++D+  
Sbjct: 401 ATASNGLLKIWNLKTHKCIRTFECG-YALCCKFLPGGLLVIVGTR----NGELQLFDLAS 455

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             + L ++ D+H   I  +    SD   L++GS D     +D +  +++
Sbjct: 456 -STQLENIEDAHDAAIWSLDI-TSDGKRLITGSADKTVKFWDFKLDQQK 502

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 85/192 (44%), Gaps = 17/192 (8%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL    +G V+     T K +       V  NK ++ I       + +ATA   G ++I
Sbjct: 295 ALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRI 354

Query: 85  WDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDS---- 137
           WD RS      ++T+ ++ +   +S + +   L    +  G+     I+D+R++      
Sbjct: 355 WDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT---WGIWDLRQFSPNSEK 411

Query: 138 --PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASI 195
             P+ +  D H   IT I+F+P D +++   S D    ++DL    +++ + Q    A I
Sbjct: 412 ALPV-AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQ--QKAEI 468

Query: 196 HSCGWLAPRRIF 207
                + P+ +F
Sbjct: 469 KELEQIPPQLLF 480

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 46/112 (41%), Gaps = 6/112 (5%)

Query: 93  LATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHD 148
           L TI N  N     LD    ++  G  L+G D    +Y  +    KW +        ++ 
Sbjct: 271 LHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGMVYLTQRHTSKWVTDKTPFTVGNNK 328

Query: 149 DITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            I DI +  ++  V  +   DGY  I+D R  + +  +  V++   ++   W
Sbjct: 329 SIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISW 380

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 8/119 (6%)

Query: 68  HENESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSRH--NMLACGTELSGSD 124
           H +E+ + + +    +K+ D RS + +      K A      S+H  N+ A     +G D
Sbjct: 209 HFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA----AGLD 264

Query: 125 AELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             +++YD R+   PL  +   H D IT + FHP +  +L+SG  D    ++DL +   E
Sbjct: 265 TNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAE 322

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 18/180 (10%)

Query: 13  NNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINND--HE- 69
           +N + L   P  +  LL++  +  V   D  +       +   + +N   ++N+   HE 
Sbjct: 161 DNGYGLAFNPQIEGELLSASDDTTVALWDINSTD-----RPVSIVMNHTDIVNDSKWHEF 215

Query: 70  NESTYATATM-GAVKIWDIRS-NNCLATISNDKNAPFLSLDSRH--NMLACGTELSGSDA 125
           +E+ + T +    +++ D RS +N    +  +K    L+  S+H  N++A     +G+D 
Sbjct: 216 DENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAF-SKHSKNLIAA----AGTDT 270

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
            +++YD+R+   PL ++   H D +T I F      +L S  +D    I+DL Q   E A
Sbjct: 271 RVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQA 329

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 13/98 (13%)

Query: 88  RSNNCLATISNDKNAPFLSLDSRHNMLA-CGTELSGSDAELHIYDVRK---WDSPLRSLV 143
           R +N  +TIS+ K       ++  N +A CGT  S     + IYD+ K    + PL +++
Sbjct: 159 RISNKTSTISDVKAG----FNNHKNYIAICGTSTS-----VSIYDINKANTLEGPLTTIL 209

Query: 144 DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
             H   I  + F+ +  ++L+SGS DG   ++DLR ++
Sbjct: 210 SKHTRSINSVDFNMAQSSLLISGSQDGCIKVWDLRSSQ 247

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLD--SRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           +WD+RS   + T+      P   +D  S  + LA G    G D  ++++D+RK + P   
Sbjct: 334 VWDLRSGKNIVTLQGHAK-PVYCVDWSSNSHQLATG----GGDGVVNVWDLRKLEQPATK 388

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
           L+ +H   ++ + F  +  +VL+SG  D   N+Y
Sbjct: 389 LL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 14/191 (7%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL    +GQV+     T K +   +    + NK ++ I       + +AT+   G ++I
Sbjct: 292 ALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRI 351

Query: 85  WDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS--- 141
           WD RS      IS   +A  +++ S +  +         D    ++D+R+  SP  S   
Sbjct: 352 WDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQL-SPNNSENV 410

Query: 142 ----LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFASIH 196
                 D H   IT I+F+P D +++   S D    ++DL  +A++E+   Q      + 
Sbjct: 411 QPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 470

Query: 197 SCGWLAPRRIF 207
               + P+ +F
Sbjct: 471 Q---IPPQLLF 478

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 93  LATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHD 148
           L TI N  N     LD    ++  G  L+G D    +Y  +    KW +  +    S++ 
Sbjct: 268 LHTIRNHGNVEGYGLD-WSPLIKTGALLTG-DCSGQVYLTQRHTSKWVTDKQPFTFSNNK 325

Query: 149 DITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            I DI +  ++  V  +   DGY  I+D R  + + A+    +   ++   W
Sbjct: 326 SIEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISW 377

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 90/195 (46%), Gaps = 23/195 (11%)

Query: 7   NSESFGNNNWCLNLQPAYQH-SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLI 64
           N E FG     L+  P  +  +LL    +G++      T K I   ++  V  NK ++ I
Sbjct: 289 NVEGFG-----LDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDI 343

Query: 65  NNDHENESTYATATM-GAVKIWDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTEL 120
                 ++ +ATA   G ++IWD RS      ++T +++ +   +S + +   L      
Sbjct: 344 QWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLA---- 399

Query: 121 SGSDAEL-HIYDVRKWD------SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTN 173
           SG D  +  ++D+R++       SP+ +  D H   IT I+F+P D + +   S D    
Sbjct: 400 SGDDKGVWGVWDLRQFSPSQENASPV-AQYDFHKGAITSISFNPLDESTVAVASEDNTVT 458

Query: 174 IYDLRQAEEEDALHQ 188
           ++DL    +++ + Q
Sbjct: 459 LWDLSVEADDEEIKQ 473

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 64/167 (38%), Gaps = 25/167 (14%)

Query: 57  AVNKLKLINNDHENESTYATATM---GAVKIWDI----------------RSNNCLATIS 97
             N+LK+      N     TATM   G V I+DI                +S   + TI 
Sbjct: 226 TTNRLKVTPFATNNNQEILTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIR 285

Query: 98  NDKNAPFLSLDSRHNMLACGTELSGSDAELHIY----DVRKWDSPLRSLVDSHHDDITDI 153
           +  N     LD    ++  G  L+G D    I+       KW +  +S    ++  I DI
Sbjct: 286 SHGNVEGFGLD-WSPLIKSGALLTG-DCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDI 343

Query: 154 AFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            +  ++  V  +   DGY  I+D R  + + A+    +   ++   W
Sbjct: 344 QWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISW 390

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 8/100 (8%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLS--LDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           +K+WD RS  C++TI   K+    +    ++ N+LA    +   D    I+D+R+    L
Sbjct: 231 IKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLA----VVAKDKSCKIFDIRQNMKEL 286

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           +S  D    D   + +HP + ++   G  DG    +DL Q
Sbjct: 287 KSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQ 324

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 18/193 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL+   +GQ++     T + +   +   V+ NK ++ I       + +ATA   G ++I
Sbjct: 289 ALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRI 348

Query: 85  WDIRSNNCLATIS---NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           WD RS      IS   ++ +   +S   +   L    + +G+     ++D+R++      
Sbjct: 349 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---WGVWDLRQFTPSNAD 405

Query: 142 LV------DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFAS 194
            V      D H   IT IAF+P D +++  GS D    ++DL  +A++E+   Q      
Sbjct: 406 AVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE 465

Query: 195 IHSCGWLAPRRIF 207
           +     + P+ +F
Sbjct: 466 LQE---IPPQLLF 475

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK----WDSPLRSLVDSHHDDI 150
           T+ N  N     LD    ++  G  LSG D    IY  ++    W +  +    S++  I
Sbjct: 267 TVKNHGNVEGYGLD-WSPLIKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSI 324

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  ++  V  +   DGY  I+D R  + + A+    +   ++   W
Sbjct: 325 EDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 374

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 86/195 (44%), Gaps = 22/195 (11%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL+   +GQ++     T + +   +   V+ NK ++ I       + +ATA   G ++I
Sbjct: 287 ALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRI 346

Query: 85  WDIRSNNCLATIS-----NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           WD RS      IS      D N    S D    +LA G +    +    ++D+R++    
Sbjct: 347 WDTRSKKHKPAISVKASNTDVNVISWS-DKIGYLLASGDD----NGTWGVWDLRQFTPSN 401

Query: 140 RSLV------DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINF 192
              V      D H   IT IAF+P D +++  GS D    ++DL  +A++E+   Q    
Sbjct: 402 ADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAET 461

Query: 193 ASIHSCGWLAPRRIF 207
             +     + P+ +F
Sbjct: 462 KELQE---IPPQLLF 473

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 24/166 (14%)

Query: 57  AVNKLKLINNDHENESTYATATM---GAVKIWDIR-SNNCLAT----ISNDKNAPFLSLD 108
             N+LK+      N+    TATM   G V I+D+   +   +T    IS     P  ++ 
Sbjct: 209 TTNRLKVSPFAASNQEVL-TATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVK 267

Query: 109 SRHN----------MLACGTELSGSDAELHIYDVRK----WDSPLRSLVDSHHDDITDIA 154
           S  N          ++  G  LSG D    IY  ++    W +  +    S++  I DI 
Sbjct: 268 SHGNVEGYGLDWSPLIKTGALLSG-DCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQ 326

Query: 155 FHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
           +  ++  V  +   DGY  I+D R  + + A+    +   ++   W
Sbjct: 327 WSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 88/193 (45%), Gaps = 18/193 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL+   +GQ++     T + +   ++  V+ N+ ++ I       + +ATA   G ++I
Sbjct: 288 ALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRI 347

Query: 85  WDIRSNNCLATIS---NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           WD RS      IS   ++ +   +S   +   L    + +G+     ++D+R++      
Sbjct: 348 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---WGVWDLRQFTPSNAD 404

Query: 142 LV------DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFAS 194
            V      D H   IT IAF+P D +++  GS D    ++DL  +A++E+   Q      
Sbjct: 405 TVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE 464

Query: 195 IHSCGWLAPRRIF 207
           +     + P+ +F
Sbjct: 465 LQD---IPPQLLF 474

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK----WDSPLRSLVDSHHDDI 150
           T+ N  N     LD    ++  G  LSG D    IY  ++    W +  +S   S+++ I
Sbjct: 266 TVKNHGNVEGYGLD-WSPLIKTGALLSG-DCSGQIYLTQRHTSRWVTDKQSFTVSNNESI 323

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  ++  V  + + DGY  I+D R  + + A+    +   ++   W
Sbjct: 324 EDIQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 11/106 (10%)

Query: 82  VKIWDIRSNNCLATISNDK-NAPFLSLDSRH---NMLACGTELSGSDAELHIYDVRKWDS 137
           +KI D+R+NN   TI   K   PF +L   H   N+LA     +G D+ +++YD+R    
Sbjct: 233 LKINDVRANNT--TIDTVKCPQPFNTLAFSHHSSNLLAA----AGMDSYVYLYDLRNMKE 286

Query: 138 PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           PL  +   H D + ++ F      V++S  +D    ++DL+Q   E
Sbjct: 287 PLHHM-SGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAE 331

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 69/157 (43%), Gaps = 23/157 (14%)

Query: 23  AYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATM-GA 81
           ++  +L     +G +   D +TG+ +  ++    A+  LK       + +T  + ++ G 
Sbjct: 572 SFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF------DATTIISGSLDGT 625

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDV---RKWDSP 138
           +++WD+RSNN    IS +K    L  D++H ++A       ++   HIYD     KWD  
Sbjct: 626 IRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVAS------NEHNTHIYDRNDGNKWD-- 677

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
              L D   D  T   F        M G ++G   I+
Sbjct: 678 ---LQDEEQD--TTSLFVKYKERYTMEGRSNGDIGIW 709

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 101 NAPFL-SLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSD 159
           N P + S+ S    LA GT+    D  + ++D+R  +  +  +++ H D IT + F   D
Sbjct: 563 NTPIIGSIQSFDAALATGTK----DGLIRLWDMRTGE--VVRVLEGHMDAITSLKF---D 613

Query: 160 PNVLMSGSTDGYTNIYDLR 178
              ++SGS DG   ++DLR
Sbjct: 614 ATTIISGSLDGTIRLWDLR 632

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 86/203 (42%), Gaps = 28/203 (13%)

Query: 5   LVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGE---VAVNKL 61
           ++N  SF     C+   P  +  LL   S+ ++   D +  K    I+  +    A+N L
Sbjct: 252 IINRLSFKATPNCMTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINAL 311

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKN--APFLSLDSRHNMLACGTE 119
           +      +     +++   +++IW+ + N  +  IS+     AP++ L   HN  A  + 
Sbjct: 312 RYFP---DGSKFISSSDDKSIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQS- 367

Query: 120 LSGSDAELHIYDVR-KWDSPLRSLVDSH----HDDITDIAFHPSDPNVLMSGSTDGYTNI 174
               D  +++Y ++ K+    R     H    ++ + DIA    D   + +G T G   I
Sbjct: 368 ---MDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIA---PDGRYVAAGDTSGRLFI 421

Query: 175 YD------LRQAE--EEDALHQV 189
           +D      LRQ E  + + L QV
Sbjct: 422 WDWKTTKILRQLETTKGETLKQV 444

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 120 LSGSDAELHIYDVRKW---DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           + G+   + +YD+ K    D+PL + +  H   I  + F+ S  N+L+SG  DG   ++D
Sbjct: 199 ICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWD 258

Query: 177 LRQAEE 182
           LR ++ 
Sbjct: 259 LRSSQR 264

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 7/69 (10%)

Query: 110 RHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTD 169
           + NM A G    GSD+ +HI+D R   S  +  +   + D+  + F+ +D N ++SGS D
Sbjct: 246 KTNMFATG----GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDD 298

Query: 170 GYTNIYDLR 178
           G   +YDLR
Sbjct: 299 GIIRLYDLR 307

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 13/95 (13%)

Query: 88  RSNNCLATISNDKNAPFLSLDSRHNMLA-CGTELSGSDAELHIYDVRKWD---SPLRSLV 143
           RS   ++TIS+ K        +  N +A CGT  S     L IYD+ +     SPL +  
Sbjct: 187 RSFRKISTISDVKAG----FHNHKNYIAICGTSTS-----LSIYDINRTSDIGSPLVATY 237

Query: 144 DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
             H   I  + F+    N+++SG  DGY  ++DLR
Sbjct: 238 SEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDLR 272

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 10/121 (8%)

Query: 64  INNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPF-LSLDSRHNMLACGTELSG 122
            N +H N+  +A  +   V+++  R+   + T S  K+  +  S      +LA G     
Sbjct: 47  FNPNHPND--FAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG----D 100

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIA-FHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           +   + +YD     + L S+  S H   T +A FHP+D   L++ S D    ++D+ QA+
Sbjct: 101 ATGRVSVYDSYNPRAQLVSIAASSHP--THVAKFHPADSRTLVTASDDRVVRVWDITQAQ 158

Query: 182 E 182
           E
Sbjct: 159 E 159

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 37/84 (44%), Gaps = 9/84 (10%)

Query: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           D  + ++D+ +   P   L  +  D +  +   P  P+++++GS DG   ++D R  E  
Sbjct: 146 DRVVRVWDITQAQEPQVELTGAS-DYVRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERA 204

Query: 184 DALHQ--------VINFASIHSCG 199
             L Q         ++   + SCG
Sbjct: 205 TTLAQGMPVEDVIAVSATQLVSCG 228

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 10/121 (8%)

Query: 64  INNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPF-LSLDSRHNMLACGTELSG 122
            N  H N+  +A  +   V+++  R+   + T S  K+  +  S      +LA G     
Sbjct: 47  FNPTHPND--FAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMG----D 100

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIA-FHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           +   + IYD     + L S+  S H   T +A FHP+D   L++ S D    ++D+ QA+
Sbjct: 101 ATGRVSIYDSYNPRTQLVSIAASSHP--THVAKFHPADSRTLVTASDDRVVRVWDITQAQ 158

Query: 182 E 182
           E
Sbjct: 159 E 159

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           D  + ++D+ +   P   L  +  D +  +   P  P+++++GS DG+  ++D R  E  
Sbjct: 146 DRVVRVWDITQAQEPQVELTGAA-DYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAA 204

Query: 184 DALHQ 188
             L Q
Sbjct: 205 TTLVQ 209

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 10/114 (8%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLS--LDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           +K+WD RS  C++T+ N K+    +    ++ N+LA  ++    D    ++D+R     L
Sbjct: 236 IKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISK----DKSCRVFDIRYHMKEL 291

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFA 193
             + D    D   + +HP++ ++    S DG    +D+ Q  EE    QVI +A
Sbjct: 292 TVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEP--QQVIPYA 341

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 82/190 (43%), Gaps = 12/190 (6%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL    +GQ++     T K I   +   VA N+ ++ I       + +A+A   G ++I
Sbjct: 289 ALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRI 348

Query: 85  WDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV- 143
           WD RS      IS   +   +++ S    L         +    ++D+R++       V 
Sbjct: 349 WDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQ 408

Query: 144 -----DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFASIHS 197
                D H   IT I+F+P D +++  GS D    ++DL  +A++E+   Q      +  
Sbjct: 409 PVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 468

Query: 198 CGWLAPRRIF 207
              + P+ +F
Sbjct: 469 ---IPPQLLF 475

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHDDI 150
           T+ N  N    +LD    +   G  L+G D    IY  +    KW +  +    +++  I
Sbjct: 267 TVKNHGNVEGYALD-WSPLTKTGALLTG-DCSGQIYFTQRHTSKWITDKQPFTVANNQSI 324

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  ++  V  S   DGY  I+D R  + + A+    +   ++   W
Sbjct: 325 EDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 374

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 93/210 (44%), Gaps = 14/210 (6%)

Query: 9   ESFGN-NNWCLNLQPAYQH-SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLIN 65
           +S GN   + L+  P+ Q  +LL    +GQ++     T K +   +   V+ NK ++ I 
Sbjct: 270 KSHGNVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQ 329

Query: 66  NDHENESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSD 124
                 + +A+A   G ++IWD RS      IS   +   +++ S  + L         +
Sbjct: 330 WSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDN 389

Query: 125 AELHIYDVRKWDSPLRSLV------DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
               ++D+R++     + V      D H   IT I+F+P D +++   S D    ++DL 
Sbjct: 390 GVWGVWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 449

Query: 179 -QAEEEDALHQVINFASIHSCGWLAPRRIF 207
            +A++E+   Q      +     + P+ +F
Sbjct: 450 VEADDEEIKQQAAETKELQQ---IPPQLLF 476

>Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           IWDIRS N + T++   + P  ++    N     T   G D  ++++D+R+ D    S +
Sbjct: 333 IWDIRSGNKVMTLTG-HSKPVYTVAWSTNGYQVAT--GGGDGLINVWDIRQRDGGQVSQI 389

Query: 144 DSHHDDITDIAFHPSD-PNVLMSGSTDGYTNIY 175
            +H + +T + F   D    L+S   D   N+Y
Sbjct: 390 LAHRNIVTQVQFSKGDGGKKLVSSGYDNLINVY 422

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 8/76 (10%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMS-GSTDG 170
           + L C  +   S+  L+I D+R+ + P+++   SH D ++ I ++P  P V+ S G  DG
Sbjct: 298 DFLLCSAD---SEGTLNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDG 352

Query: 171 YTNIYDLRQAEEEDAL 186
              I+DL  A+E+D L
Sbjct: 353 LVKIWDL--AQEDDPL 366

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 78/178 (43%), Gaps = 23/178 (12%)

Query: 13  NNNWCLNLQPAYQHSLLAS--LSNG----QVHQLDWQTGKSIAHIKTGEVAVNKLKLINN 66
           ++ W L    +   +L+AS  LSN     ++ Q +    K ++  K     V+ L+ INN
Sbjct: 129 DSQWVLACAISPSRNLVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINN 188

Query: 67  DHENESTYATATMGAVKIWDIRSNNCLATISN------DKNAPFLSLDSRHNMLACGTEL 120
               ES    +      +WDI  +  ++  S+        + P     S  +M A G   
Sbjct: 189 ----ESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASG--- 241

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
            GSD  ++++D R   S     V     DI+ + F  SD N +++GS DG   ++DLR
Sbjct: 242 -GSDGYVYLWDTRSPSSVQNFFV--SDSDISTVRFF-SDGNSIITGSDDGIARLFDLR 295

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 20/120 (16%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLAC------GTELS--GSDAELHIYDVR 133
           +K WD RS +C++T+          L  +H +++       G  LS    D    +YD+R
Sbjct: 231 IKFWDPRSGSCVSTM----------LGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFA 193
           +    L S+ D    D   + +HP D  V   G  DG    +DL Q  + +     I +A
Sbjct: 281 QQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIPYA 338

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           ++I +  +N   Y+ +    +K WD+ +  C+ T +   +   ++  S  N+LACG+  S
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGS--S 349

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                LH   V       +  +  H + ++ +   P +  +L SGS DG   ++D+R
Sbjct: 350 ARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVR 406

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 72/148 (48%), Gaps = 19/148 (12%)

Query: 72  STYATATM-GAVKIWDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
           + +AT  + G ++IWD RS      L+ + +D +   +S + +   L    + SG+    
Sbjct: 346 TVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGT---W 402

Query: 128 HIYDVRKWD-------SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-Q 179
            ++D+R++        +P+ +  + H   IT I+F+P D +++   S D    ++DL  +
Sbjct: 403 GVWDLRQFSAQNTEKTTPV-AQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVE 461

Query: 180 AEEEDALHQVINFASIHSCGWLAPRRIF 207
           A++E+   Q    A +     + P+ +F
Sbjct: 462 ADDEEIKQQTAETAELQQ---IPPQLLF 486

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%), Gaps = 13/171 (7%)

Query: 14  NNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAH--IKTGEVAVNKLKLINN---DH 68
           N + L+  P  +  LL+   +G +   D Q   ++A   +K  +   N +  +N+   + 
Sbjct: 198 NGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI--VNDCKWNE 255

Query: 69  ENESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLD-SRHNMLACGTELSGSDAE 126
            N + +A+ +    +++ D R  N +   S     PF +L  S+H+        +G+D+ 
Sbjct: 256 FNSNVFASVSEDSTLQLHDQREQNTIIN-SIKTTDPFNTLAFSKHSQYLMAA--AGTDSL 312

Query: 127 LHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
           +++YD R    PL S+ + H D IT++ F P    VL+S   D    ++D+
Sbjct: 313 VYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 137 SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           S L S +  H ++   ++F+P+D   L+SGS DG   ++D+++
Sbjct: 186 SALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQE 228

>KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.405
           YER107C
          Length = 362

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 2/102 (1%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           G V+IWD++S         +  AP LS  +R +         G D  + I+DV    S  
Sbjct: 56  GKVRIWDVQSGTAQGRSQYEHAAPVLS--TRWSNDGTKVASGGCDNAIKIFDVATGQSQQ 113

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
             L D+    +  +   P++  +L++GS D     +D RQ +
Sbjct: 114 LGLHDAPVKAVRFVNCGPTNTEMLVTGSWDKSIKYWDFRQPQ 155

>TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {ON}
           Anc_8.721 YOR272W
          Length = 458

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 2/117 (1%)

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           ++I +  +    Y+ +   A+K WD+ ++ C+ T S   +   ++   + N+LACG+  S
Sbjct: 290 QVIFDSQDQTVGYSVSQDHAIKTWDLITSRCVDTKSTSYSLLSIAQLPKLNLLACGS--S 347

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                LH   V       +  +  H + +  +   P +  +L SGS DG   ++D+R
Sbjct: 348 ARHITLHDPRVNSSSKITQQQLIGHKNFVVSLDTCPENDYMLCSGSHDGTVKVWDVR 404

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +KIWD+ S   L + +  K+A   L+ D+    L   ++    D+++ ++D+   +S 
Sbjct: 101 GVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASK----DSDIIVWDLVG-ESG 155

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           L  L  SH D IT       D N L+S S DG   I+DL+  +
Sbjct: 156 LYKL-RSHKDAIT--GLWCEDENWLISTSKDGLVKIWDLKSQQ 195

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLS--LDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           +K+WD RS  C++TI   K+    +    ++ NMLA  ++    D    ++D+R+    L
Sbjct: 233 IKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISK----DKSCRVFDIRQNMKEL 288

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
               D    D   + +HP + ++   G  DG    +DL Q  ++ +
Sbjct: 289 AVYRD--ESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSS 332

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 83/176 (47%), Gaps = 17/176 (9%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL+   +GQ++     T K +   +   V  NK ++ I       + +ATA   G +++
Sbjct: 291 ALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRV 350

Query: 85  WDIRSNNCLATIS---NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD----- 136
           WD RS      IS   ++ +   +S + +   L    + +GS     ++D+R++      
Sbjct: 351 WDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGS---WGVWDLRQFTPDNAA 407

Query: 137 --SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQV 189
              P+ +  + H   IT IAF+P + +++  GS D    ++DL  +A++E+   Q 
Sbjct: 408 NIQPV-AQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQT 462

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 59/148 (39%), Gaps = 25/148 (16%)

Query: 76  TATM---GAVKIWDI----------------RSNNCLATISNDKNAPFLSLDSRHNMLAC 116
           TATM   G V I+DI                +S   + TI N  N     LD    ++  
Sbjct: 231 TATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLD-WSPLIKS 289

Query: 117 GTELSGSDAELHIYDVR----KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYT 172
           G  LSG D    IY  +    KW +  ++    ++  I DI +  ++  V  +   DGY 
Sbjct: 290 GALLSG-DCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYI 348

Query: 173 NIYDLRQAEEEDALHQVINFASIHSCGW 200
            ++D R  + + A+    +   ++   W
Sbjct: 349 RVWDTRSKKHKPAISVKASNTDVNVISW 376

>NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON}
           Anc_1.247
          Length = 718

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 11/108 (10%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVK 83
           +  +++    +G V   D +TGK + H++    ++  LK      ++++    +T   V+
Sbjct: 571 FDAAVVTGTKDGIVRFWDLRTGKVVRHLEGHTSSITCLKF-----DSKNIITGSTDKTVR 625

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYD 131
           +WDIR       +S D   P LSLD   + +A GT     D  + +YD
Sbjct: 626 VWDIRMGTLAGLLSFD--TPVLSLDFDTDKIAIGT----YDESVKVYD 667

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 17/174 (9%)

Query: 16  WCLNLQPAYQHSLLASLSNGQ--VHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENEST 73
           WC    PA +H  + S SN +  V  L   + K++ H+  G      +  IN        
Sbjct: 75  WCP--HPA-KHHWVISTSNQKAIVWNLSRSSSKAVEHVLHGHFRA--ITDINFHPLQPEI 129

Query: 74  YATATMGAVKI-WDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTELSGSDAELHI 129
            AT+++    + WD+RS       +++  +    +   H   N+LA     +     +++
Sbjct: 130 LATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLA-----TSHSNIVYV 184

Query: 130 YDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           +DVRK  SPL S+++ H   +  I F+P +   +MS   DG    +D  + E+E
Sbjct: 185 WDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 63/129 (48%), Gaps = 18/129 (13%)

Query: 68  HENESTYATATMGAVKIWDIRSNNCLATI---------SNDKNAPFLSLDSRHNMLACGT 118
           ++NE   + +   +++ WD+ + NC+ T+         +N K++   +L S    LA G+
Sbjct: 399 YDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGS 458

Query: 119 ELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +    D  + ++D+R     +R+L+  H   IT + F   D   +++GSTD   ++ DLR
Sbjct: 459 K----DGIIRLWDLRSG-KVVRTLL-KHQGPITSLQF---DSTKIITGSTDANISVSDLR 509

Query: 179 QAEEEDALH 187
                +  H
Sbjct: 510 TGNILETYH 518

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 100 KNAPFL-SLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPS 158
           +N P + +L    + LA GT+    D  + ++D+R  +   R L+  H D IT + F   
Sbjct: 579 ENKPIIGALQCFDSALATGTK----DGIIRLWDLRSGEIA-RKLI-GHQDAITSLKF--- 629

Query: 159 DPNVLMSGSTDGYTNIYDLRQAE 181
           D N ++SGS DG T I+DLRQ +
Sbjct: 630 DTNNIISGSLDGSTRIWDLRQDQ 652

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 20/115 (17%)

Query: 76  TATMGAVKIWDIRSNNCLATISN-----------DKNAPFLSLDSRH--NMLACGTELSG 122
           T+++  +  WDI++ N L T+S+           +K A    L+  H  N+LA G     
Sbjct: 40  TSSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGY---- 95

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
           +D  + I+D++     +  + +SH   IT + F PS    L+SGS D    I+DL
Sbjct: 96  ADGVIKIWDMQT--QTVLIIFNSHTAAITFLKFDPSGTR-LISGSRDSNIIIWDL 147

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 51/115 (44%), Gaps = 9/115 (7%)

Query: 68  HENESTYATATMGAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAE 126
           HE     A    G +KIWD+++   L   ++   A  FL  D     L  G+     D+ 
Sbjct: 86  HETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSR----DSN 141

Query: 127 LHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           + I+D+       +  + SH D IT I F   D   L+S S DG   ++D++  +
Sbjct: 142 IIIWDLVGEVGLCK--LRSHKDSITGIWFENDDW--LISTSKDGLIKVWDIKSQQ 192

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 288 AHGDEVVRDVFVPARNSKLLYSCGEDGSVKTWE 320
           AH D ++   FVP  ++   +SCG+DG +K W+
Sbjct: 608 AHQDAIMNVKFVPQSHN--FFSCGKDGVIKYWD 638

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 21/156 (13%)

Query: 44  TGKSIAHIKTGEVAVNKLKLINNDH-----------ENESTYATATMGAVKIWDIRSNNC 92
           TG +   IK  ++A  KLKL    H            +   ++ +    VK WD+  N  
Sbjct: 143 TGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQRHPLMFSASEDKLVKCWDLEKN-- 200

Query: 93  LATISNDKNAPFLSLDSR--HNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDI 150
             T+  D +  F  + +   H  L      +G DA + ++D+R    P+ +L   H   I
Sbjct: 201 --TVVRDYHGHFSGVHTVDVHPTLDLIAS-AGRDAVVRLWDIRT-RVPVMTLA-GHKGPI 255

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             +   P DP + MSGS D    ++D+R  +    L
Sbjct: 256 NQVKCFPVDPQI-MSGSADSTVRLWDIRAGKAMKIL 290

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 83/205 (40%), Gaps = 25/205 (12%)

Query: 28  LLASLSNGQVHQL-DWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWD 86
           L+AS     V +L D +T   +  +   +  +N++K    D +  S  A +T   V++WD
Sbjct: 224 LIASAGRDAVVRLWDIRTRVPVMTLAGHKGPINQVKCFPVDPQIMSGSADST---VRLWD 280

Query: 87  IRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKW---DSPLRSLV 143
           IR+   +  +++          S+      G     S A     D+R W   D  L  L 
Sbjct: 281 IRAGKAMKILTHH---------SKSVRAIAGNPSESSVATASTSDIRSWRLQDGQL--LT 329

Query: 144 DSHHDDITDIAFHPSDPN-VLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWLA 202
           +   +D   I     +P+ VL +G  DG+ + YD +        H+  +  +I   G L 
Sbjct: 330 NFRSEDTGIINCLSVNPDGVLFAGGDDGHLSFYDYKTG------HKFQDLPTIKVPGSLE 383

Query: 203 PRRIFTLSHMETFSIHELNDKSDEA 227
             R    +  +   +  +  +SD++
Sbjct: 384 SERGILSASFDQTGLRLITGESDKS 408

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 9/100 (9%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPF-LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +KIWD+ S   L + +  ++A   L  DS    L  G+     D+ + ++D+   +  
Sbjct: 99  GVIKIWDMFSKTVLLSFNGHRSAVTQLLFDSTGTRLISGSR----DSNIIVWDLVS-EVG 153

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           L  L  SH D IT ++    D N LMS S DG   ++DL+
Sbjct: 154 LYKL-RSHKDSITGLSL--PDENWLMSVSKDGLIKLWDLK 190

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLS--LDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK+WD R+  C++TI   K+    +    ++ NMLA  ++    D    I+D+R+    L
Sbjct: 233 VKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISK----DKSCRIFDIRQNMKEL 288

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
               D    D   + +HP + ++   G  DG    +DL Q  ++ +
Sbjct: 289 AVYRD--ESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSS 332

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
           ++  H   ITDI FHP++P +L + S D Y + +D+R +  
Sbjct: 109 VLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRR 149

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 4/130 (3%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSG 122
           IN    N    AT ++ A V  WD+RS+      ++  +A   +   + N        S 
Sbjct: 120 INFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAG--AAQVKWNFKNPNVMASA 177

Query: 123 SDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
              ++ I+D+RK   PL  ++  H + +  I F   +   +MS S DG    +D    ++
Sbjct: 178 HSNDIFIWDLRKGCMPLH-ILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYSVNDK 236

Query: 183 EDALHQVINF 192
           E     V +F
Sbjct: 237 EPLRTVVTDF 246

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 51/111 (45%), Gaps = 2/111 (1%)

Query: 68  HENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
            +N   Y+ +    VK WD+ ++ C+ T +   +   L+     ++LACG+  S     L
Sbjct: 286 RDNTVGYSVSQDHTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLHLLACGS--SARHITL 343

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           H +         +  +  H + +  +   P +  +L+SGS DG   ++D+R
Sbjct: 344 HDFRANSSSKITQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDIR 394

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 88/195 (45%), Gaps = 22/195 (11%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           ++L+   +GQV      T K I   +   VA NK ++ +       + +A+  + G ++I
Sbjct: 301 AMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRI 360

Query: 85  WDIRSNNCLATIS---NDKNAPFLSLDSRHN-MLACGTELSGSDAELHIYDVRKWDSPLR 140
           WD RS      IS   ++ +   +S   +   +LA G +    D    ++D+R++ +P  
Sbjct: 361 WDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDD----DGTWGVWDLRQF-TPQN 415

Query: 141 SLVDS-------HHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINF 192
           +   S       H   IT I+F+P D +++   S D    ++DL  +A++E+   Q    
Sbjct: 416 ASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAET 475

Query: 193 ASIHSCGWLAPRRIF 207
             +     + P+ +F
Sbjct: 476 KELQQ---IPPQLLF 487

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 20/95 (21%)

Query: 112 NMLACGTELSGS-DAELHIYDVRKWDSPL-----RSLVDS--------------HHDDIT 151
           NML   T +SGS D ++ I+D  + +S L     RSL  +              + D I 
Sbjct: 113 NMLTRRTFISGSWDGKVKIWDCARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIY 172

Query: 152 DIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
              F P DPN+ M  S + Y   +DLRQ  +++++
Sbjct: 173 QALFSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSI 207

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 120 LSGSDAELHIYDVRKW---DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           + G+   + IYD+ +    D P   ++  H   I  + F+ +  ++L+SGS DG   ++D
Sbjct: 183 ICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWD 242

Query: 177 LRQAE 181
           LR ++
Sbjct: 243 LRSSQ 247

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 63/156 (40%), Gaps = 30/156 (19%)

Query: 44  TGKSIAHIKTGEVAVNKLKLINNDHENE-----------STYATATMGAVKIWDIRSNNC 92
           TG     I+  ++ + K+ +I N HE +              + +    V+IWD+ +  C
Sbjct: 383 TGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNTGQC 442

Query: 93  LATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVD-------- 144
           L T+S +     +++      +A G+             VR WD+    LV+        
Sbjct: 443 LLTLSIEDGVTTVAVSPDGKFIAAGSLDRA---------VRVWDAETGFLVERLDSNELG 493

Query: 145 -SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
             H D +  + F     NV +SGS D    +++L+Q
Sbjct: 494 TGHEDSVYSVVFTKDGKNV-VSGSLDKTVKLWNLKQ 528

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 83/188 (44%), Gaps = 26/188 (13%)

Query: 17  CLNL--QPAYQHSLLASLSNGQVHQLDWQ---------TGKSIAHIKTGEVAVNKLKLIN 65
           CL++   P  +  LL+  SNG +H  D+Q            +I      ++  N++  +N
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCNEVTWMN 257

Query: 66  NDHENESTYAT-ATMGAVKIWDIRSNNCLATI-SNDKNAPFLSLDSRHN---MLACGTEL 120
               + S +AT      + ++D R    + +I   + N    S    +    +LA G   
Sbjct: 258 G---HNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGD-- 312

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGST-DGYTNIYDLRQ 179
             S+  ++++D+RK + P+R+L   H   I+ I + P    ++ SG   DG   ++D+  
Sbjct: 313 --SNGIINLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDISN 368

Query: 180 AEEEDALH 187
            EE   +H
Sbjct: 369 EEEPIFIH 376

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 110 RHNMLACGTELSGSDAELHIYDVRKWDSP-----LRSLVDSHHDDITDIAFHPSDPNVLM 164
           +HN+L  G    GS  E++I+D  K ++P     +     +  D+I  +A++ +  +V  
Sbjct: 116 QHNVLCSG----GSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFA 171

Query: 165 SGSTDGYTNIYDLRQAEE 182
           S  + GY +I+DL+  +E
Sbjct: 172 SAGSSGYASIWDLKAKKE 189

>Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON}
           (64223..65584) [1362 nt, 454 aa]
          Length = 453

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 69  ENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELH 128
           +N   Y+ +    +K WD+ ++ C+ T +   +   L+     N+LACG+  S     LH
Sbjct: 292 DNTVGYSISQDHTIKTWDLVTSRCIDTKTTSYSLLSLAQLPTLNLLACGS--SARHITLH 349

Query: 129 IYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
              +       +  +  H + +  +   P +  +L SGS DG   ++D+R
Sbjct: 350 DPRIGSTSKITQQQLVGHKNFVVSLDTCPENEYMLCSGSHDGTVKVWDVR 399

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +KIWD+ S   L + S  K+    L  DS    L  G+     D+++ I+D+      
Sbjct: 99  GVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSR----DSDIIIWDLVSEVGV 154

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
            +  + SH D IT I     D   L+S + DG   ++DL+  +
Sbjct: 155 FK--LRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQ 193

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           IWDIRS N + +++   + P  ++D   N     T   G D  ++++D+R+ D      +
Sbjct: 333 IWDIRSGNKVMSLTG-HSKPVYTVDWSPNGYQVAT--GGGDGLINVWDIRQRDGGQVHQI 389

Query: 144 DSHHDDITDIAFHPSD-PNVLMSGSTDGYTNIY 175
            +H + +T + F   D    L+S   D   N+Y
Sbjct: 390 LAHRNIVTKVQFSKDDNGKKLISCGYDNLINVY 422

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 87/191 (45%), Gaps = 26/191 (13%)

Query: 3   YSLVNSESFGNNNWCLNLQPAYQHS----LLASLSNGQVHQLDWQTGKSIAHIKTGEVAV 58
           + +++SE+  NN W   L+     S    + ++L N  V+  D +TG+ IA ++ G    
Sbjct: 14  FGVISSEA--NNVWLPPLKGRSSGSPGQIITSALEN--VNIWDIKTGELIAQLQDGITPG 69

Query: 59  NKLKLINND---------HENESTYATATM-GAVKIWDIRSNNCLATISNDKNA-PFLSL 107
           +    +N           H + S  A     G +K+WD+ S   L  ++  K++   L  
Sbjct: 70  SADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGHKSSITVLKF 129

Query: 108 DSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGS 167
           D     L  G+    SD+ + I+D+       +  + SH D I+D+ +   D N L+S S
Sbjct: 130 DVNCTRLVSGS----SDSNIIIWDLVSEVGICK--LRSHKDRISDL-YVDDDFNWLLSVS 182

Query: 168 TDGYTNIYDLR 178
            DG   ++DL+
Sbjct: 183 KDGLIKVWDLK 193

>Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR272W
           (YTM1) - microtubule-associated protein [contig 68] FULL
          Length = 445

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR 133
           Y+ +    +K WD+ +  C+ T S   +   L+   + N+LACG+  S     LH   V 
Sbjct: 290 YSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLACGS--SARHITLHDPRVG 347

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
                 +  ++ H + +  +   P    +L SGS DG   ++D+R +
Sbjct: 348 SSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSS 394

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 120 LSGSDAELHIYDVRKW---DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           + G+   + IYD+ +    DSPL + +  H   I  + F+    ++L+SG  DG   ++D
Sbjct: 201 ICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWD 260

Query: 177 LR 178
           LR
Sbjct: 261 LR 262

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +  ++  H   ITDI FHP+ P +L + S D Y + +D+R
Sbjct: 106 IEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMR 145

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           S    +++I+D+RK  +PL  L   H + +  I F   D   +MS S DG    +D   +
Sbjct: 176 SAHSNDVYIWDLRKGCTPLHVL-QGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYSLS 234

Query: 181 EEE 183
           ++E
Sbjct: 235 DKE 237

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 88/194 (45%), Gaps = 20/194 (10%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENESTYATATM-GAVKI 84
           +LL    +GQ++     T K +   +   V  NK ++ I       + +A+    G V+I
Sbjct: 294 ALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYVRI 353

Query: 85  WDIRSNN---CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD----- 136
           WD RS      L+  +++ +   +S + +   L    + +GS     ++D+R++      
Sbjct: 354 WDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGS---WGVWDLRQFTPDNIN 410

Query: 137 --SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFA 193
              P+ +  D H   IT I+F+P + +++   S D    ++DL  +A++E+   Q     
Sbjct: 411 NVQPV-AQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK 469

Query: 194 SIHSCGWLAPRRIF 207
            + S   + P+ +F
Sbjct: 470 ELES---IPPQLLF 480

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 48/116 (41%), Gaps = 6/116 (5%)

Query: 89  SNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIY----DVRKWDSPLRSLVD 144
           S   + TI N  N    +LD    ++  G  L+G D    IY    +  KW +  +    
Sbjct: 266 SKRPVHTIKNHGNVEGYALD-WSPLIKTGALLTG-DCSGQIYLTQRNTSKWVTDKQPFTV 323

Query: 145 SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            ++  + DI +  ++  V  S   DGY  I+D R  + + AL    +   ++   W
Sbjct: 324 GNNKSVEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

>KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.721
           YOR272W
          Length = 460

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 52/115 (45%), Gaps = 2/115 (1%)

Query: 64  INNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS 123
           I +  +N   Y+ +    +K WD+ ++ C+ T +   +   ++     N+LACG+  S  
Sbjct: 294 IFDTKDNTVGYSVSQDHTIKTWDLVTSRCVDTKTTSYSLLSIAQIPTLNLLACGS--SAR 351

Query: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
              LH   V       +  +  H + +  +   P +  +L SGS DG   ++D+R
Sbjct: 352 HITLHDPRVDSSSKITQQQLIGHKNFVVSLDTCPENDYILASGSHDGTVKVWDIR 406

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 9   ESFGN-NNWCLNLQPAYQH-SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLIN 65
           +S GN   + L+  P  +  +LL    +GQV+     T K I+  +   VA N+ ++ I 
Sbjct: 278 KSHGNVEGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQ 337

Query: 66  NDHENESTYATATM-GAVKIWDIRSNNCLATIS---NDKNAPFLSLDSRHNMLACGTELS 121
                 + +A+    G +++WD RS      IS   ++ +   +S   +   L    + +
Sbjct: 338 WSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDN 397

Query: 122 GSDAELHIYDVRKWD-------SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
           G+     ++D+R++        SP+ +  D H   IT I+F+P D +++   S D    +
Sbjct: 398 GT---WGVWDLRQFSPSNSNNTSPV-AQYDFHKGAITSISFNPLDESIVAVASEDNTVTL 453

Query: 175 YDLR-QAEEEDALHQVINFASIHSCGWLAPRRIF 207
           +DL  +A++E+   Q      +     + P+ +F
Sbjct: 454 WDLSVEADDEEIKQQAAETKELQQ---IPPQLLF 484

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 93/210 (44%), Gaps = 29/210 (13%)

Query: 16  WCLNLQPAYQH-SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLINNDHENEST 73
           + L+  P  ++ +LL    +GQ++     T K I   +      NK ++ I       + 
Sbjct: 283 YALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTV 342

Query: 74  YATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTEL-----SGSD 124
           +A+A   G ++IWD RS          K+ P LS+ + +   N+++   ++     SG D
Sbjct: 343 FASAGCDGYIRIWDTRSK---------KHKPALSVKASNTDVNVISWSEKIGYLLASGDD 393

Query: 125 AEL-HIYDVRKW------DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
             L  ++D+R++      D    +  D H   IT I F+P D +++   S D    ++DL
Sbjct: 394 NGLWGVWDLRQFSPDNINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDL 453

Query: 178 RQAEEEDALHQVINFASIHSCGWLAPRRIF 207
               +++ + Q I  A       + P+ +F
Sbjct: 454 SVEADDEEIKQQI--AETKELEKIPPQLLF 481

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 6/110 (5%)

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR----KWDSPLRSLVDSHHDDI 150
           T+ N  N    +LD    M+  G  L+G D    IY  +    KW +  +     ++  +
Sbjct: 273 TVRNHGNVEGYALD-WSPMIKNGALLTG-DCSGQIYFTQRHTSKWITDKQPFTAENNKSV 330

Query: 151 TDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGW 200
            DI +  ++  V  S   DGY  I+D R  + + AL    +   ++   W
Sbjct: 331 EDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISW 380

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 80/191 (41%), Gaps = 18/191 (9%)

Query: 2   SYSLVNSESFGNNNW-CLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60
           S++LV   S G N    +++    +     S + GQ+   +WQ   S ++I   +   + 
Sbjct: 284 SFTLVQQLSMGQNAVNTVSINNTGEWLAFGSSALGQLLVYEWQ---SESYILKQQGHFDS 340

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120
           L  +    +       A  G +K+WD+ S  CLAT S   ++      ++   +   + L
Sbjct: 341 LNGLTYSPDGARVVTAANDGKIKVWDVVSGFCLATFSEHTSSVTAVQFAKRGQVLFSSSL 400

Query: 121 SGSDAELHIYDVRKWD----SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY-TNIY 175
            G+        VR WD       R+   +       +A  PS   V+ +GS+D +  +++
Sbjct: 401 DGT--------VRAWDLIRFRNFRTFTSTQRIPFNCLAVDPSG-EVVCAGSSDSFEIHVW 451

Query: 176 DLRQAEEEDAL 186
            ++  +  D+L
Sbjct: 452 SVQTGQLLDSL 462

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK+WD RS  C++TI   K+    +    +R N+LA  ++    D    ++D+R     L
Sbjct: 240 VKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISK----DKSCRVFDIRHSMKEL 295

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
             + D    D   + ++P + ++   G+ DG    +DL Q  E
Sbjct: 296 MCVRD--EVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLE 336

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +SL+   N+LA G    G+D    ++D+   D P++  V  H   +  IAF P   ++L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 165 SG 166
           +G
Sbjct: 64  TG 65

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (50%), Gaps = 12/102 (11%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +K+WD+ S + L   +  K+    L LDS    L  G++    D++L I+D+      
Sbjct: 95  GVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSK----DSDLIIWDLVGEVGL 150

Query: 139 LRSLVDSHHDDITDIAFHPSDPNV--LMSGSTDGYTNIYDLR 178
           ++  + SH D IT I     D N+  L+S + DG   ++DL+
Sbjct: 151 MK--LRSHKDAITGIWI---DHNMDWLISVAKDGLIKVWDLK 187

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 13/83 (15%)

Query: 81  AVKIWDIRSNNCLATISNDK----NAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD 136
            V+IWDIRS  C+ T++  K     A  L++D +  +++C T     DA + ++D+    
Sbjct: 222 VVRIWDIRSRTCVMTLAGHKGPINKARCLAVDPQ--VVSCST-----DATVRLWDITA-G 273

Query: 137 SPLRSLVDSHHDDITDIAFHPSD 159
             +++L   H  ++ DI F+P++
Sbjct: 274 KTIKTLT-HHKRNVRDITFNPAE 295

>Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W
           (REAL)
          Length = 460

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           ++I +  +N   Y+ +    +K WD+ +  C+ T +   +   ++     N+LACG+  S
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRATSYSLLSIAQLPSLNLLACGS--S 349

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                LH   +       +  +  H + ++ +   P +  +L SGS DG   ++D+R
Sbjct: 350 ARHITLHDPRLGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDIR 406

>Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON}
           (77284..78369) [1086 nt, 362 aa]
          Length = 361

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWDI+  N       + +AP L   +R +         G D  + +YD+   +S    
Sbjct: 58  VRIWDIQGGNPQGKAQYEHSAPVLC--TRWSFDGTKVASGGCDNVVKVYDL---NSGQNQ 112

Query: 142 LVDSHHDDITDIAF---HPSDPNVLMSGSTDGYTNIYDLRQAE 181
            V SH   +  + F    P++   L++GS D     +DLRQ +
Sbjct: 113 QVGSHDSAVQSLRFVQCGPTNAECLVTGSWDKTLKYWDLRQPQ 155

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 12/113 (10%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFL-SLDSRHNMLACGTELSGSDAELHIYDVR 133
            T T    K+    +NN  + + ++  AP + +L   ++ LA GT+    D  + ++D+R
Sbjct: 466 VTPTYNDTKVSARSANNSTSVLGSE--APMIGALQCYNSALASGTK----DGVVRLWDLR 519

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
               P+R+L + H D IT + F   D   L++GS D    I+DLR +   D +
Sbjct: 520 -IGKPVRAL-EGHTDGITSLKF---DSEKLVTGSMDNSVRIWDLRTSSIIDVI 567

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVK 83
           Y  +L +   +G V   D + GK +  ++     +  LK      ++E     +   +V+
Sbjct: 500 YNSALASGTKDGVVRLWDLRIGKPVRALEGHTDGITSLKF-----DSEKLVTGSMDNSVR 554

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSG 122
           IWD+R+++ +  I+ D   P  SLD    ++  G   +G
Sbjct: 555 IWDLRTSSIIDVIAYD--LPITSLDFDDKLITVGANETG 591

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 146 HHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
           H   ITDI FHPS P +L + S D Y + +D+R  + 
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQR 149

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 3/102 (2%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V  WD+RS       ++D +A   +   + N+       S     + I+D+RK  +PL  
Sbjct: 139 VHAWDMRSPQRPYYSTSDWSAG--ASQVKWNLQNANVLASSHANSVFIWDIRKGCTPLYK 196

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           L   ++  + +I F+    N +MS S DG    +D  ++  E
Sbjct: 197 L-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKSSTE 237

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 53/141 (37%), Gaps = 16/141 (11%)

Query: 35  GQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIRSNNCLA 94
           GQ+   +WQ+   I   +    A N L       +       A  G +K+WD+ S  CLA
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNSLTY---SPDGSRVVTAAEDGKIKVWDVASGFCLA 377

Query: 95  TISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD----SPLRSLVDSHHDDI 150
           T     +A      ++   +     L G+        VR WD       R    +     
Sbjct: 378 TFEEHTSAVTAVQFAKKGQVLFSASLDGT--------VRAWDLIRYRNFRVFTATERVQF 429

Query: 151 TDIAFHPSDPNVLMSGSTDGY 171
           T +A  PS   V+ +GSTD +
Sbjct: 430 TCLAVEPSG-EVVSAGSTDSF 449

>SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar to
           uniprot|P38123 Saccharomyces cerevisiae YBR175W SWD3
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 314

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 101 NAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPS 158
            AP LSL   S+ N+L C   +   D  + I+DV      L   + +H + +  I     
Sbjct: 97  TAPVLSLVYTSKGNLL-CSASM---DESIKIWDVLT--GTLLKTISAHSEPVVSIDMPVC 150

Query: 159 DPNVLMSGSTDGYTNIYD 176
           DP++L SGS DG   I+D
Sbjct: 151 DPSILSSGSYDGLIRIFD 168

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 101 NAPFLSLD-SRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSD 159
           +APF +L  S+H+        +G+D+ ++++D R    PL S+   H   +T++ F P  
Sbjct: 261 DAPFNTLAFSKHSQYLFAA--AGTDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQ 317

Query: 160 PNVLMSGSTDGYTNIYDL 177
             +LM+   D    I+D+
Sbjct: 318 DGILMTSGEDRRAIIWDI 335

>KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.470
           YMR092C
          Length = 607

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 78/158 (49%), Gaps = 17/158 (10%)

Query: 18  LNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATA 77
           +   P     +++  S+ ++   D +TG+ I +++  E  +N   +      +E+ +ATA
Sbjct: 207 VEFSPNTGEFVVSVGSDRRIVCYDGKTGEFIKYVEDSEEKING-GIFAISWLDEAKFATA 265

Query: 78  TMGA-VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLAC----GTELSGSDAELHIYDV 132
           +  A ++IWD++ + C+   S     P  SL+++   +      G      D  L++Y++
Sbjct: 266 SADACIRIWDVKGSKCVQKWS----LPEASLENQLVGIVATKNNGVISLSLDGSLNMYEI 321

Query: 133 RKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDG 170
            K D  +R+ +  H+  IT +A +P     L++GS DG
Sbjct: 322 GKNDC-IRT-IRGHNKGITALAVNP-----LITGSYDG 352

>KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.721
           YOR272W
          Length = 457

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 68  HENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
           ++N   Y+ +   ++K WD+  + C+ T +   +   +      N+LACG+  S     L
Sbjct: 295 NDNTVGYSVSQDHSIKTWDLVMSRCVDTKTTSYSLLSMVQLPTLNLLACGS--SARHITL 352

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALH 187
           H   V       +  +  H + +  +   P +  ++ SGS DG   ++D+R    +DA++
Sbjct: 353 HDPRVDSSSKITQQQLVGHKNFVVSLDTCPENEYIICSGSHDGTVKVWDIRS---QDAMY 409

Query: 188 QV 189
            +
Sbjct: 410 TI 411

>SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {ON}
           similar to uniprot|P46680 Saccharomyces cerevisiae
           YMR092C AIP1 Actin cortical patch component probable
           binding site on actin lies on front surface of
           subdomains 3 and 4
          Length = 613

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 81/163 (49%), Gaps = 24/163 (14%)

Query: 18  LNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK-LKLIN--NDHENESTY 74
           +   P      ++  S+ ++   D +TG+ I +I+  +  +N  L  I+  ++ EN + +
Sbjct: 208 VKFSPGTGKYAISVGSDRKIVCYDGKTGEFIKYIEDTKENINGGLFAISWIDEGENSNKF 267

Query: 75  ATATMG-AVKIWDIRSNNCLA------TISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
            T++    +K+WD+ S+ CL       T+SN +    ++ D  H ++A        D  L
Sbjct: 268 VTSSADCTLKLWDVESSKCLQSWSLENTLSNQQVGVAVTKD--HEIVALSL-----DGTL 320

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDG 170
           +I+ + + DS +R  ++ H+  IT +  +P     L+SGS DG
Sbjct: 321 NIFKIGE-DSLVRR-IEGHNKGITALVVNP-----LVSGSYDG 356

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score = 37.0 bits (84), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 7/98 (7%)

Query: 82  VKIWDIRSNNCLATISN-DKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++ W+  +  C  TI + D     L + S    LA G  L      + +YD+R  +    
Sbjct: 14  IRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAGGHL-----HVRLYDIRTTNPNPV 68

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +  + H  ++T IAF   D   ++S S DG   ++D+R
Sbjct: 69  TSFEGHRGNVTSIAFQ-QDNKWMVSSSEDGTIKVWDVR 105

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G VKIWD+ S + L   +  K+A   L  DS    L  G++    D+++ ++D+      
Sbjct: 97  GVVKIWDLLSKSVLINFNGHKSAITVLKFDSTGTRLISGSK----DSDIIVWDLVGEVGL 152

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
            +  + SH D IT +     D   L+S S DG   ++DL+  +
Sbjct: 153 FK--LRSHKDSITGLWCEGED--WLVSTSKDGLIKVWDLKTQQ 191

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 288 AHGDEVVRDVFVPARNSKLLYSCGEDGSVKTWEN 321
           AH D +++  F+P  ++   +SCG+DG VK W+ 
Sbjct: 607 AHSDSIMKVAFLPESHN--FFSCGKDGLVKYWDG 638

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G++KIW+I++ +C+ T      A          ++  GT+      +L+++D+  
Sbjct: 401 ATASNGSLKIWNIKTKSCIRTFECG-YALACKFLPGGALVVIGTK----TGDLNLFDLA- 454

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             S L S +++ H          +D   L++GS D     +D  Q E+E
Sbjct: 455 -SSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSADKSVRFWDF-QVEQE 501

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 10/86 (11%)

Query: 102 APFL-SLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDP 160
           AP + +L   ++ LA GT+    D  + ++D+R    P+RSL + H D IT + F   D 
Sbjct: 492 APMIGALQCYNSALATGTK----DGVVRLWDLR-IGKPVRSL-EGHTDGITSLKF---DS 542

Query: 161 NVLMSGSTDGYTNIYDLRQAEEEDAL 186
             L++GS D    I+DLR +   D +
Sbjct: 543 EKLVTGSMDNSVRIWDLRTSSIVDVI 568

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 53/118 (44%), Gaps = 14/118 (11%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVK 83
           Y  +L     +G V   D + GK +  ++     +  LK      ++E     +   +V+
Sbjct: 501 YNSALATGTKDGVVRLWDLRIGKPVRSLEGHTDGITSLKF-----DSEKLVTGSMDNSVR 555

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK---WDSP 138
           IWD+R+++ +  I+ D   P  SLD    ++  G    G    ++I+++ +   W +P
Sbjct: 556 IWDLRTSSIVDVIAYD--LPVTSLDFDDKLITVGANERG----VNIFNMERDEHWMTP 607

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +SL+   N+LA G    G+D    ++D+   D P++  V  H   +  IAF P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7.405
           YER107C
          Length = 361

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 9/117 (7%)

Query: 69  ENESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
           +NE  ++ ++  G VKIW+I + N  A      +AP LS  +R +         G D  +
Sbjct: 44  QNEFVFSASSWDGKVKIWNINNGNPQAVAQYSHSAPVLS--TRWSGDGTKVASGGCDNIV 101

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAF---HPSDPNVLMSGSTDGYTNIYDLRQAE 181
            ++D+    +     V +H   I ++ F    P++   L++GS D     +DLRQ +
Sbjct: 102 KLFDL---TTNQEQQVGTHDSAIKNLRFVNCGPTNSQCLVTGSWDKTIKYWDLRQQQ 155

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 9/81 (11%)

Query: 50  HIKTGEVAVNKLKLINNDHENESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLD 108
            + T + A+  L+ +N    N     T +    +K WD+R    +AT++        ++D
Sbjct: 113 QVGTHDSAIKNLRFVNCGPTNSQCLVTGSWDKTIKYWDLRQQQPIATLAMPDRV--YAMD 170

Query: 109 SRHNMLACGTELSGSDAELHI 129
           S + +L  GT      AE HI
Sbjct: 171 SSNQLLVVGT------AERHI 185

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 11/94 (11%)

Query: 88  RSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKW---DSPLRSLVD 144
           R+   ++TIS D  A F   + ++ +  CGT  S     + IYD+ K    D+P+ + + 
Sbjct: 171 RTTKKISTIS-DVKAGFY--NHKNYVAICGTSTS-----VAIYDINKTSAIDNPVVTSLS 222

Query: 145 SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
            H   I  + F+    ++L+SG  DG   I+DLR
Sbjct: 223 EHTRSINSVDFNMVQTSLLISGGQDGCIKIWDLR 256

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +SL+   N+LA G    G+D    ++D+   D P++  V  H   +  IAF P   ++L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 80/176 (45%), Gaps = 32/176 (18%)

Query: 25  QHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKI 84
           Q  L+++L + Q   + +   K   + K   + V+ + ++  + E++S+   +T+ +  +
Sbjct: 3   QFELISTLRSAQGSDILYTACKISPNGKYVAICVD-VDIVVFNLEDQSSTTFSTLHSRPL 61

Query: 85  WDI---RSNNCLATISND------------------KNAPFLSLDSRHNM---LACGTEL 120
            D+     + C+AT S+D                    AP  S+  ++ M   L C   +
Sbjct: 62  SDLCWSPDSQCIATASDDFTIIITHIVFGELHRLVGHTAPVTSV--KYTMKGNLLCSCSM 119

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
              D  + I+D+    + LR+L  +H + +  I   P DP++L SGS DG   I+D
Sbjct: 120 ---DESIKIWDILS-GTLLRTL-SAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFD 170

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 16/192 (8%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKL--INNDHENESTYATATM-GAVK 83
           SLL    +G+V+     T K I   KT   A N   +  I       + +AT    G ++
Sbjct: 301 SLLTGDCSGRVYLTQRHTSKWITD-KTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIR 359

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD------- 136
           IWD RS      IS   ++  +++ S +  +         +    ++D+R++        
Sbjct: 360 IWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASV 419

Query: 137 SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFASI 195
           SP+ +    H   IT IAF+P D +++   S D    ++DL  +A++E+   Q      +
Sbjct: 420 SPV-AQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKEL 478

Query: 196 HSCGWLAPRRIF 207
                + P+ +F
Sbjct: 479 QQ---IPPQLLF 487

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 13/114 (11%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSL----DSRHNMLACGTELSGSDAELHIYDVRKW 135
           G++ IWDI+S   + T  N  ++  ++     +S  N+    +E    D+ L I+D R  
Sbjct: 182 GSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSE----DSFLMIHDKRS- 236

Query: 136 DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQV 189
           + PL+ L+    +    IAF     N+  +  TD    ++D R+  E  ALH +
Sbjct: 237 EKPLQKLL--QKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTE--ALHSM 286

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
            S+ S   +++C       D  + I+D++   +   S+   H D + +  +H SDPN+  
Sbjct: 167 FSVASPGELISCS-----DDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYG 221

Query: 165 SGSTDGYTNIYDLRQAEEEDALHQVINFASI 195
           S S D +  I+D R  +    L Q   F +I
Sbjct: 222 SVSEDSFLMIHDKRSEKPLQKLLQKEPFNTI 252

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 36.6 bits (83), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 17/134 (12%)

Query: 67  DHENESTYATA-TMGAVKIWDIRSNNCLATISNDKNAPFLSLDSR----------HN--M 113
           +H  E T A A + GAVK+WD++  N   T  ++      + DSR          H+  +
Sbjct: 205 NHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDVSWMSQHDSIL 264

Query: 114 LACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTN 173
            ACG E S S   L ++D R  ++  +       + I    F+  +  +L S  + G TN
Sbjct: 265 AACG-ERSDS---LALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTGRTN 320

Query: 174 IYDLRQAEEEDALH 187
           ++D+R+   E  +H
Sbjct: 321 LWDVRKLSAEPIVH 334

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVK 83
           Y+ +L     +G V   D + GK +  ++     +  LK      ++E     +   +V+
Sbjct: 517 YKSALATGTKDGIVRLWDLRVGKPVRLLRGHTDGITSLKF-----DSEKLVTGSMDNSVR 571

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSG 122
           IWD+R+++ +  I+ D   P  SLD    ++A G    G
Sbjct: 572 IWDLRTSSVVDVIAYD--LPVTSLDFDDKLIAVGANERG 608

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 10/89 (11%)

Query: 99  DKNAPFL-SLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHP 157
           D +AP + +L    + LA GT+    D  + ++D+R    P+R L+  H D IT + F  
Sbjct: 505 DTDAPMIGALQCYKSALATGTK----DGIVRLWDLR-VGKPVR-LLRGHTDGITSLKF-- 556

Query: 158 SDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
            D   L++GS D    I+DLR +   D +
Sbjct: 557 -DSEKLVTGSMDNSVRIWDLRTSSVVDVI 584

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +SL+   N+LA G    G+D    ++D+   D P++  V  H   +  IAF P   ++L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 81  AVKIWDIRSNNCLATISNDKNA--PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
            V++WDIRS +C+ T++  +        L     +++C T     DA + ++D+     P
Sbjct: 221 VVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCST-----DATVKLWDLVA-GKP 274

Query: 139 LRSLVDSHHDDITDIAFHPSD 159
           +++L   H  ++ D+AF+P++
Sbjct: 275 MKTLT-HHKRNVRDLAFNPTE 294

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 56/147 (38%), Gaps = 16/147 (10%)

Query: 29  LASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIR 88
             S + GQ+   +WQ   S ++I   +   + L  +    +       +  G +KIWD+ 
Sbjct: 315 FGSKTLGQLLVYEWQ---SESYILKQQGHFDTLNGLTYSPDGSRVVTASEDGKIKIWDVV 371

Query: 89  SNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD----SPLRSLVD 144
           S  CLAT     +A      S+   +     L G+        VR WD       R+   
Sbjct: 372 SGFCLATFEEHTSAVSAVQFSKRGQVLFSASLDGT--------VRAWDLIRYRNFRTFTA 423

Query: 145 SHHDDITDIAFHPSDPNVLMSGSTDGY 171
           +       +A  PS   V+ +GS D Y
Sbjct: 424 AERIQFNSLAVDPSG-EVVCAGSIDNY 449

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 110 RHNMLACGTELSGSDAELHIYDVRKWDSP-----LRSLVDSHHDDITDIAFHPSDPNVLM 164
           +HN+L  G    GS  E++I+D  K ++P     +     +  D+I  +A++ +  +V  
Sbjct: 116 QHNVLCSG----GSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFA 171

Query: 165 SGSTDGYTNIYDLRQAEE 182
           S  + G+ +I+DL+  +E
Sbjct: 172 SAGSSGFASIWDLKAKKE 189

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 127 LHIYDVRKWDSPLRSLVDS---HHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           + IYD+ K +   ++L+ S   H   +    F+  D N+L+SG  DG   I+DLR     
Sbjct: 205 ISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGSLN 264

Query: 184 DALHQVINFA----SIHSCGWL 201
            +    IN      SI    W+
Sbjct: 265 GSTRSDININTASDSIRDVKWM 286

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 5/139 (3%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR 133
           +A  +   V+I+  R+   + T S  K+  + +       L C  + +G  +    Y+ R
Sbjct: 55  FAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA-EEEDALHQVINF 192
                +++   +H   +T   FH  DP  L++ S D  T ++D+  A E +  L    ++
Sbjct: 115 VLLLSIKA--STHPTHVTK--FHTQDPKTLITASDDRVTRLWDISHAYEPQIELTGASDY 170

Query: 193 ASIHSCGWLAPRRIFTLSH 211
               SC   AP  I T S+
Sbjct: 171 VRTVSCIPSAPHLISTGSY 189

>NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {ON}
           Anc_8.67
          Length = 885

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 24/131 (18%)

Query: 67  DHENESTYATATMGAVKIWDIRS--NNCL-------ATISNDKNAPFLSLDSRHNMLACG 117
           DH+ +   + +    +KIWD+ +  NN +       AT     N P ++L   H  L   
Sbjct: 667 DHQRKRCISASMDSTIKIWDLENIWNNGVCSVVTISATPCTRINGPMMTLQG-HTALVGL 725

Query: 118 TELS-------GSDAELHIYDVRKWDSPLRSLVDS-HHDDITDIAFHPSDPNVLMSGSTD 169
             LS        +D  L     R WDS   S   S HH++++ I     + N+L+SGS +
Sbjct: 726 LRLSDKYLVSAAADGSL-----RGWDSNDYSRKFSYHHNNLSAITTFFMNDNILVSGS-E 779

Query: 170 GYTNIYDLRQA 180
           G  NIY+LR  
Sbjct: 780 GQFNIYNLRTG 790

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 8/100 (8%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           +K+WD RS NC++TI   K+    +    ++ N+L   ++    D    ++D+R     L
Sbjct: 231 IKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISK----DKSCRVFDIRHSMKEL 286

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
             + D    D   + +HP + +V   G+ DG    +D+ Q
Sbjct: 287 MVVRD--EVDYMTLLWHPINESVFTVGNYDGSLKHFDILQ 324

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 104 FLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVL 163
            +S D+  + +  G     S  ++++YD  +W S L SLV +H  D+T +   PS+  VL
Sbjct: 104 LISCDASTDKIVIGD----SGGDINVYD-HEWMSKL-SLVGAHVSDVTTVKIFPSNA-VL 156

Query: 164 MSGSTDGYTNIYDL 177
           +SGSTD    ++ L
Sbjct: 157 LSGSTDMQLKVWSL 170

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL-SGS-DAELHIYDVRKWDSPL 139
           ++IWD+ S   L T+   +   + SLD        G +L SGS D  + I+D+R      
Sbjct: 393 IRIWDLSSKKILMTLQGHEQDIY-SLD----YFPAGDKLVSGSGDRTVRIWDLRTGQC-- 445

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            SL  S  D +T +A  P D   + +GS D    ++D
Sbjct: 446 -SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 481

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 16/112 (14%)

Query: 80  GAVKIWDIRSNNCLATIS-NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G VK+W +     L T+S ND NA   S  SR + +A    +  S+ + H +        
Sbjct: 127 GKVKLWSLMRPQSLMTMSPNDTNAA--STLSRTSAVA-PVRVPMSNQKEHQH-------- 175

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVI 190
                D + + I    F P DPN+++  S + + ++YDLR        HQ +
Sbjct: 176 ----ADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFL 223

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G +KIW+I++N+C+ T      A          ++  GT+      +LH+YD+  
Sbjct: 401 ATASNGTLKIWNIKTNSCIRTFECG-YALACKFLPGGALVVLGTK----TGDLHLYDLA- 454

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             S L + ++  H          +D   L++GS D     +D  Q E+E
Sbjct: 455 -SSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDF-QVEQE 501

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 9/100 (9%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           GA+KIWD+ S + L + +  K+A   L+ D     L  G+     D+++ ++D+   +  
Sbjct: 97  GAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSR----DSDIIVWDLVG-EVG 151

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           L  L  SH D IT +     +   L+S S DG   ++DL+
Sbjct: 152 LYKL-RSHKDSITGLWCEGEE--WLISTSKDGLIKVWDLK 188

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 288 AHGDEVVRDVFVPARNSKLLYSCGEDGSVKTWE 320
           AH D +++ VFVP  ++   +SC +D  VK W+
Sbjct: 607 AHNDSIMKVVFVPESHN--FFSCSKDALVKYWD 637

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 16/192 (8%)

Query: 27  SLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKL--INNDHENESTYATATM-GAVK 83
           SLL    +G+V+     T K I   KT   A N   +  I       + +A+    G ++
Sbjct: 300 SLLTGDCSGRVYLTQRHTSKWITD-KTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIR 358

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD------- 136
           IWD RS      IS   +A  +++ S +  +         +    ++D+R++        
Sbjct: 359 IWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAAST 418

Query: 137 SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR-QAEEEDALHQVINFASI 195
           SP+ +  + H   IT I+F+P D +++   S D   +++DL  +A++E+   Q    A  
Sbjct: 419 SPV-AQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQA---AET 474

Query: 196 HSCGWLAPRRIF 207
                + P+ +F
Sbjct: 475 RELQEIPPQLLF 486

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 9/110 (8%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK WD RS  C++TI N K+    +    +R N L   ++    D    ++D+R     L
Sbjct: 233 VKFWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISK----DKSCRVFDIRNHTKEL 288

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQV 189
            ++ D    D   +++HP + +V    + DG    +D+ + + E  +H +
Sbjct: 289 LTVRD--EVDFMTLSWHPINESVFTLANYDGSIKHFDILE-DLEKPIHTI 335

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 25/131 (19%)

Query: 81  AVKIWDIRSNNCLATISNDK-NAPFLSLDSRHNMLACGTELSGSDAELHIYDV------- 132
            VKIWD+ +   L + S  K     L + + +++L  G++    DA + ++++       
Sbjct: 375 TVKIWDLSTTEQLGSFSGHKATINCLQMSNNNSLLMTGSK----DATVKVWNIDLGIELA 430

Query: 133 --------RKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEED 184
                    K +SP     DSH D+IT ++F   D   L+S S D     YD+   +   
Sbjct: 431 KKENNQLEEKDESPCVLTFDSHSDEITALSF---DGEYLISASRDKTVRQYDIISGKCFQ 487

Query: 185 ALHQVINFASI 195
            L    NF SI
Sbjct: 488 TL--ATNFGSI 496

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 34/134 (25%)

Query: 81  AVKIWDIRSNNCLATISND--------------KNAPFL-SLDSRHNMLACGTELSGSDA 125
            V+ +DI S  C  T++ +              +N+P + +L   +  L  G+    SD 
Sbjct: 474 TVRQYDIISGKCFQTLATNFGSISKTNGDMLMSRNSPVVGALQYYNTALITGS----SDG 529

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
              ++D+R     +RS+ + H+  IT + F   DP  L + STDG   ++DLR A     
Sbjct: 530 IARLWDLR-IGKVVRSM-EGHNGAITSLQF---DPIKLTTSSTDGDIRVWDLRTA----- 579

Query: 186 LHQVINFASIHSCG 199
                 +  +H CG
Sbjct: 580 -----GWLELHPCG 588

>NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721
          Length = 456

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR 133
           Y+ +    +K WD+ +  C+ T +   +   L+     N+LACG+  S     LH   + 
Sbjct: 300 YSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQLPTLNLLACGS--SARHITLHDPRMG 357

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                 +  +  H + +  +   P +  +L SGS DG   ++D+R
Sbjct: 358 ASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVR 402

>SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {ON}
           highly similar to uniprot|Q12024 Saccharomyces
           cerevisiae YOR272W YTM1 microtubule-associated protein
          Length = 446

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 70  NEST--YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAEL 127
           N+ST  Y+ +    ++ WD+ +  C+ T +   +   L+   + N+LACG+  S     L
Sbjct: 284 NDSTVGYSVSQDHTIRTWDLVTARCVDTKTTSYSLLSLAQLPKLNLLACGS--SARHITL 341

Query: 128 HIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           H   V       +  +  H + +  +   P +  +L S S DG   ++D+R +
Sbjct: 342 HDPRVGSSSKITQQQLIGHKNFVVSLDTCPENEYMLCSASHDGTVKVWDIRSS 394

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 11/103 (10%)

Query: 77  ATMGAVK---IWDIRS-NNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDV 132
           AT GA K   IWD+RS  N L+ + + K  P    D   N        SG D  + I+D+
Sbjct: 326 ATAGADKVGIIWDLRSGKNILSLVGHAK--PIYCSDWSQN--GYQXXXSG-DGTIKIWDL 380

Query: 133 RKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
           RK D     L  +H + +TD+ F   +   L+S S D   N++
Sbjct: 381 RKVDDVETIL--AHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 11/99 (11%)

Query: 80  GAVKIWDIRSNNCLATIS--NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDS 137
           G ++I+D+    C+ T+S   D+ A  LS +S  ++L  G+     D  +   DVR  D 
Sbjct: 490 GIIEIYDVTKRKCIRTLSGHTDRTA-CLSWNS--HILTSGSR----DRTILHRDVRMKD- 541

Query: 138 PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           P    + SH  ++  + ++ SD N L+SG  D   NIYD
Sbjct: 542 PFFERIKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYD 579

>ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR200C (ELP2)
          Length = 804

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 120 LSGSDAELHIYDV---RKWDSPLRSLVDSHHDDITDIAFHPSDPN--VLMSGSTDGYTNI 174
           +SG+  +L +Y V      D  L + V+ H D I D+AF  + P   +L SG+ D Y  +
Sbjct: 185 VSGTSTDLMVYSVCVAATVDVELSATVEGHEDWIKDLAFRSNGPGDWMLASGAQDRYIRL 244

Query: 175 YDLRQ---AEEED 184
           + ++     EEED
Sbjct: 245 WRIKANNNIEEED 257

>ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1525

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 20/177 (11%)

Query: 24   YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGE---VAVNKLKLINNDHENESTYATATMG 80
            +++ L++     +V   DW + ++++    G      V  LK +N D +     A ++ G
Sbjct: 1191 FENHLVSVDERDEVTVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNED-DAALLLAGSSDG 1249

Query: 81   AVKIW-DIRSNNCLATISNDKNAPFLSLDSRHNMLAC------GTELSGSDAELHIYDVR 133
             VKI+ +I SN+ L  IS  +    + L  R + L        G+ L+  D ++    +R
Sbjct: 1250 IVKIYKNIHSNDDLELISAWRGLTDMLLTPRSSGLLTEWQQIRGSLLTTGDVKI----IR 1305

Query: 134  KWDSPLRSL-VD---SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             WD+   ++ VD        IT I       N++++G  DG   +YD R+ +  D++
Sbjct: 1306 AWDAHTETVEVDIPAKTSSLITSITSDQLAGNLVVAGFADGSLRVYD-RRVDPRDSM 1361

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           GSD   +I+D R   +  +  V     D+T I F   D N +++GS DG  N++DLR
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVS--DSDVTSIKFF-KDGNSIITGSDDGIINMFDLR 304

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 49/103 (47%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +KIWD+ S   L   +  K+A   L  D     L  G++    D+++ I+D+   +  
Sbjct: 97  GVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSK----DSDIIIWDLVG-EVG 151

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           L  L  SH D IT I     D   L+S S DG   I+DL+  +
Sbjct: 152 LYKL-RSHKDSITGIWCENEDW--LISTSKDGLIKIWDLKTQQ 191

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           +WDIRS + + T++   + P  ++    N     T   G D  ++++D+RK D    + +
Sbjct: 333 LWDIRSGSKVMTLAG-HSKPIYTVAWSPNGYQVAT--GGGDGIINVWDIRKRDEGQLNQI 389

Query: 144 DSHHDDITDIAFHPSD-PNVLMSGSTDGYTNIY 175
            +H + +T + F   D    L+S   D   N+Y
Sbjct: 390 LAHRNIVTQVRFSKEDGGKKLVSCGYDNLINVY 422

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 9/114 (7%)

Query: 83  KIWDIRSNN-CLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           ++WD  ++   L    +DK    LS     +++  G    G D+   ++D+R   S + +
Sbjct: 290 RLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSG----GMDSLSMLWDIRS-GSKVMT 344

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASI 195
           L   H   I  +A+ P+   V  +G  DG  N++D+R+  +E  L+Q++   +I
Sbjct: 345 LA-GHSKPIYTVAWSPNGYQV-ATGGGDGIINVWDIRK-RDEGQLNQILAHRNI 395

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 64/159 (40%), Gaps = 26/159 (16%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGK---SIAHIKTGEVAVNKLKLINNDHENESTYATATMG 80
           +++ +L +  +G +   D Q      +I H    EV      LIN      S++     G
Sbjct: 72  HENQVLVAQGDGSLRLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWD----G 127

Query: 81  AVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
            VK+W       LAT++    A         N L    ++  S+ + H            
Sbjct: 128 TVKVWSPTRPKSLATLTPKPMAA-------QNPLMPSKDIPMSNQQNH------------ 168

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           + +  + + I    F P DPNV+MS + + Y  ++DLRQ
Sbjct: 169 TSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLRQ 207

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 67/154 (43%), Gaps = 18/154 (11%)

Query: 82  VKIWDIRSNNCLATIS-NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++ W+  +  C  TI  +D     L + S    LA    L+     + +YD+R  +    
Sbjct: 14  IRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLN-----VRLYDIRTTNPNPV 68

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ-AEEEDALHQ-VINFASIH-- 196
           +  + H  ++T IAF   +   ++S S DG   ++D+R  + + +  HQ  +N   IH  
Sbjct: 69  TSFEGHRGNVTSIAFQQEN-KWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPN 127

Query: 197 -----SCGWLAPRRIFTLSHMETFSIHELNDKSD 225
                SC      RI+ L   E   +H+L  + D
Sbjct: 128 QGELISCDQDGNVRIWDLG--ENQCVHQLAPEDD 159

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 148 DDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           D I    F P DPN++MS S + Y +++DLRQ
Sbjct: 177 DCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQ 208

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 11/85 (12%)

Query: 74  YATATM---GAVKIWDIRSNNCLATISNDKNAPF-LSLDSRH-NMLACGTELSGSDAELH 128
           Y  AT    G++KIWD+R  + ++T+   +N  F +  D  + + L  G    G D EL 
Sbjct: 362 YQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSG----GYDRELK 417

Query: 129 IYDVRKWDSPLRSLVDSHHDDITDI 153
           I++   W+  L   ++ H D I  +
Sbjct: 418 IFNADNWE--LIKTLEGHTDKILSV 440

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           S++  + D I    F P DPN++M  + + Y  ++DLRQ
Sbjct: 170 SIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQ 208

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 67  DHENESTYATATMGAVKIWDIRS--NNCLATISNDKNAPFLSLDSRHNMLACGTELSG-- 122
           DH+ +   + +    +K+WD+ +  NN   TI  +   P   +      L   T L G  
Sbjct: 548 DHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKITGSMLTLQGHTALVGLL 607

Query: 123 --SDAELHIY----DVRKWDSPLRSLVDS-HHDDITDIAFHPSDPNVLMSGSTDGYTNIY 175
             SD  L        +R WDS   S   S HH++++ I     + N+L+SGS +G  N+Y
Sbjct: 608 RLSDKYLVSAAADGSLRGWDSNDYSRKFSYHHNNLSAITTFYMNDNILVSGS-EGQFNVY 666

Query: 176 DLRQAE 181
           +LR  +
Sbjct: 667 NLRTGK 672

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +  + +++M+ C  +   S  +L I+D+R +  P++       D I+ I ++P  P +L 
Sbjct: 287 IEFNYKNDMILCTGD---SQGQLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILA 343

Query: 165 SG-STDGYTNIYDLRQAEEEDA 185
           +     G   I+D    E+ED+
Sbjct: 344 TADQQSGLVKIWDA-SGEQEDS 364

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 10/97 (10%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL-SGS-DAELHIYDVRKWDSPL 139
           ++IWD+ +   L T+   +   + SLD        G +L SGS D  + I+D+R      
Sbjct: 376 IRIWDLTTKKILMTLQGHEQDIY-SLD----YFPAGDKLVSGSGDRTVRIWDLRTGQC-- 428

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            SL  S  D +T +A  P D   + +GS D    ++D
Sbjct: 429 -SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
           +  ++  H   ITDI FHP  P +L + S D Y   +D+R  + 
Sbjct: 106 IEHILHGHFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQR 149

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 129 IYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           I+D+RK  +PL +L   H   + +I F+ +    +MS S DG    +D
Sbjct: 184 IWDLRKGCTPLYTL-QGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 10/97 (10%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL-SGS-DAELHIYDVRKWDSPL 139
           ++IWD+ +   + T+   +   + SLD        G +L SGS D  + I+D+R      
Sbjct: 472 IRIWDLTTRRIVMTLQGHEQDIY-SLD----YFPSGDKLVSGSGDRTVRIWDLRAGQC-- 524

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            SL  S  D +T +A  P D  ++ +GS D    I+D
Sbjct: 525 -SLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 560

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 61/142 (42%), Gaps = 11/142 (7%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAE--LHIYD 131
           +A  +   V+I+  R+   + T S  K+  + +     N  A G  L   DA   + +YD
Sbjct: 55  FAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCA-----NFRADGKLLVAGDATGLVSVYD 109

Query: 132 VRKWDSPLRSL-VDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA-LHQV 189
                + L S+   +H   +T   FHP D   L++ S D  T ++D+  A E    L   
Sbjct: 110 SYNPRNVLVSIQASTHPTHVTK--FHPMDSKTLITSSDDRVTRLWDISHAYEPTLELGGA 167

Query: 190 INFASIHSCGWLAPRRIFTLSH 211
            ++    +C   AP  + T S+
Sbjct: 168 TDYVRSLTCVPSAPHLVATGSY 189

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 29/139 (20%)

Query: 85  WDIRSNNCLATIS-------NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYD------ 131
           WD+ +  C+  +        +D   P  SL++   +L     + G+   L  Y+      
Sbjct: 449 WDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGA---LQCYNSALATG 505

Query: 132 -----VRKWD----SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
                VR WD     P+R L++ H D IT + F   D   L++GS D    I+DLR +  
Sbjct: 506 TKDGIVRLWDLRVGKPVR-LLEGHTDGITSLKF---DSEKLVTGSMDNSVRIWDLRTSSI 561

Query: 183 EDALHQVINFASIHSCGWL 201
            D +   +  +S+   G L
Sbjct: 562 LDVIAYDLPVSSLDFDGKL 580

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 66/157 (42%), Gaps = 14/157 (8%)

Query: 24  YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVK 83
           Y  +L     +G V   D + GK +  ++     +  LK      ++E     +   +V+
Sbjct: 498 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKF-----DSEKLVTGSMDNSVR 552

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK---WDSPLR 140
           IWD+R+++ L  I+ D   P  SLD    ++  G    G    ++++++ +   W +P  
Sbjct: 553 IWDLRTSSILDVIAYD--LPVSSLDFDGKLITVGANEGG----VNVFNMERDEHWMTPEP 606

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
                  +    IA        L++G  DG  N++ L
Sbjct: 607 PHSLDGDELSRRIAIVKYKDGFLINGHNDGDINVWTL 643

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY 171
           N+ A G    GSD  L+I+D R   S     V     D++ + F   + N + +GS DG 
Sbjct: 275 NVFASG----GSDGYLYIWDKRVPTSVQSFFVS--DSDVSKVKFF-RNGNTIATGSDDGC 327

Query: 172 TNIYDLR 178
           TN+YDLR
Sbjct: 328 TNLYDLR 334

>Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107C
           (GLE2) - homologous to S. pombe RAE1 gene; 2-hybrid
           analysis demonstrates an interaction with Srp1p and
           Rip1p; copurifies with Nup116p [contig 33] FULL
          Length = 367

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 16/128 (12%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V++WD+              AP L+  +R +         G D  + ++DV    S    
Sbjct: 60  VRVWDVNGGQAQCRAEYQHQAPVLA--TRWSTDGTKIASGGCDNAVMVFDVSSGQSQQVG 117

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWL 201
             D+    +  +   PS+   L++GS D     +DLRQ +    L               
Sbjct: 118 AHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLRQPQPVSTL--------------A 163

Query: 202 APRRIFTL 209
            P R++T+
Sbjct: 164 MPERVYTM 171

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G++KIW+I+++ C+ T          +L  +         L   + EL ++D+  
Sbjct: 407 ATASNGSLKIWNIKTHKCIRTFECG-----YALTCKFLPGGLLVILGTRNGELQLFDLAS 461

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
             S L ++ D+H   I  +    SD   L++GS D     +D +
Sbjct: 462 -SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFK 503

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +K+WD+ S   L   +  K A   L  D     L  G++    D+ + ++D+   +  
Sbjct: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSK----DSNIIVWDLVG-EVG 155

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           L  L  SH D IT   F     + L+S S DG   ++DL+
Sbjct: 156 LYKL-RSHKDSIT--GFWCQGEDWLISTSKDGMIKLWDLK 192

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 45/109 (41%), Gaps = 19/109 (17%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD+R+  C  T+S +     +++            L  +        VR WDS    
Sbjct: 453 VRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRA--------VRVWDSTTGF 504

Query: 142 LVD----------SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
           LV+           H D +  + F   D N ++SGS D    ++++R +
Sbjct: 505 LVERLDSENELGTGHRDSVYSVVFT-RDGNEVVSGSLDKTVKLWNMRHS 552

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 9/118 (7%)

Query: 82  VKIWDIRSNNCLATIS-NDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++ W+  +  C  TI  +D     L + S    LA    L+     + +YD+R  +    
Sbjct: 14  IRFWEALTGVCSRTIQHSDSQVNRLEITSDKRFLAAAGHLN-----VRLYDIRTTNPNPV 68

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR--QAEEEDALHQVINFASIH 196
           +  + H  ++T IAF   +   ++S S DG   ++D+R    +     H  +N   IH
Sbjct: 69  TSFEGHRGNVTSIAFQQEN-KWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVNEVVIH 125

>Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AEL314W
          Length = 716

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 18/115 (15%)

Query: 71  ESTYATATM-GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELH 128
           ++  AT T  G V++WD+RS   + T+    +A   L  DS H  L  G+ L  S     
Sbjct: 578 DAALATGTKDGVVRLWDLRSGRVVRTLDGHSDAITSLEFDSLH--LVTGS-LDKS----- 629

Query: 129 IYDVRKWDSPLRSLVDSHHDD--ITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
              +R WD    +L D+   D  +T + F   D N +++ + +G   IYD ++ +
Sbjct: 630 ---IRIWDLRTGALADAFAYDHSVTSLQF---DLNKIVAANREGTVKIYDRKEKK 678

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 10/97 (10%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL-SGS-DAELHIYDVRKWDSPL 139
           ++IWD+ +   + T+   +   + SLD        G +L SGS D  + I+D+R      
Sbjct: 494 IRIWDLATRRIVMTLQGHEQDIY-SLD----YFPSGDKLVSGSGDRTVRIWDLRTGQC-- 546

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            SL  S  D +T +A  P D  ++ +GS D    I+D
Sbjct: 547 -SLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 582

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F P  P++L + S D Y + +DLR
Sbjct: 86  VSTSNQKAIIWNLAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVHAWDLR 145

Query: 179 QAEE 182
             + 
Sbjct: 146 SPQR 149

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 129 IYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
           I+D+RK  +PL  LV  H   +  + F+      LM+GS DG    +D  ++  E
Sbjct: 184 IWDLRKGSTPLGKLV-GHGSSVNSVDFNRFKRTELMTGSNDGSVKFWDYSKSCNE 237

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 62/162 (38%), Gaps = 30/162 (18%)

Query: 44  TGKSIAHIKTGEVAVNKLKLINNDHEN-----------ESTYATATMGAVKIWDIRSNNC 92
           TG     I+  ++A  K+ ++   HE            E   + +    V+IWD+R+  C
Sbjct: 444 TGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQC 503

Query: 93  LATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVD-------- 144
             T+S +     +++            L  +        VR WDS    LV+        
Sbjct: 504 SLTLSIEDGVTTVAVSPEDGKYIAAGSLDRA--------VRVWDSETGFLVERLDSENEL 555

Query: 145 --SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEED 184
              H D +  + F   D N ++SGS D    +++L  A  +D
Sbjct: 556 GTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLNDANNKD 596

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F+P  P+VL + S D Y + +D+R
Sbjct: 85  VSTSNQKAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 144

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
           ++ ++D+RK  +PL SL   H   +  I F+      LMS S DG    +D  ++  E  
Sbjct: 180 DVFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWDYSKSTTESK 238

Query: 186 LHQVINF 192
                NF
Sbjct: 239 RTVTTNF 245

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F+P +P++L + S D Y + +D+R
Sbjct: 85  VSTSNQKALIWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDMR 144

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 58/158 (36%), Gaps = 26/158 (16%)

Query: 32  LSNGQVHQLDWQTGKS----IAHIKTGEVAVNKLKLINNDHENESTYATATMGA-VKIWD 86
           +S      L W   KS    I H+  G      +  IN + EN    AT ++   V  WD
Sbjct: 85  VSTSNQKALIWNLAKSSSDAIEHVLHGHSRA--ITDINFNPENPDILATCSIDTYVHAWD 142

Query: 87  IRSNNCLATISNDKNAPFLSLDS--------RHNMLACGTELSGSDAELHIYDVRKWDSP 138
           +RS           + PF S  +        + N        S    ++ I+D+R   +P
Sbjct: 143 MRS----------PHKPFYSTSAWRSSASQVKWNFKDSNILASSHGNDVFIWDLRNGSTP 192

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           L  LV  H   +  I F       +MS S DG    +D
Sbjct: 193 LCQLV-GHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F+P  P+VL + S D Y + +D+R
Sbjct: 85  VSTSNQKAIIWNLAKHSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 144

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 20/138 (14%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDS--------RHNML 114
           IN + ++    AT ++   V  WD+RS           + PF S  S        + N  
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRS----------PHRPFYSTSSWRSAASQVKWNYK 168

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
                 S    ++ ++D+RK  +PL SL   H   +  I F+      +MS S DG    
Sbjct: 169 DPNVLASSHGNDIFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKF 227

Query: 175 YDLRQAEEEDALHQVINF 192
           +D  ++  E       NF
Sbjct: 228 WDYSKSTTESKRTVTTNF 245

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F+P  P+VL + S D Y + +D+R
Sbjct: 86  VSTSNQKAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 145

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 20/138 (14%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDS--------RHNML 114
           IN + ++    AT ++   V  WD+RS           + PF S  S        + N  
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRS----------PHRPFYSTSSWRSAASQVKWNYK 169

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
                 S    ++ ++D+RK  +PL SL   H   +  I F+    + +MS S DG    
Sbjct: 170 DPNVLASSHGNDIFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKYSEIMSSSNDGTVKF 228

Query: 175 YDLRQAEEEDALHQVINF 192
           +D  ++  E       NF
Sbjct: 229 WDYSKSTTESKRTVTTNF 246

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 148 DDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           D I    F P DPN+L+  S D YT I+DLR
Sbjct: 185 DCIYQSQFSPHDPNLLICCSGDSYTTIFDLR 215

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 67/166 (40%), Gaps = 25/166 (15%)

Query: 112 NMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY 171
           N+L C +     D+   I+D+R   +  R+ +     ++    F+   PNVL +   D  
Sbjct: 198 NLLICCS----GDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRPNVLATAGVDNS 253

Query: 172 TNIYDLRQAEEEDA---LHQVINF--ASIHSCGWLAPRRIFTLSHMETFSIHELNDKS-D 225
             I+D R     DA   +++++N    ++    W        LS     S    ND S D
Sbjct: 254 IRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSCKIWNDLSYD 313

Query: 226 EAKEPRPVEFNDVRESW-GCDYVVDIH--------------PGYVA 256
             ++ +  + N +  +  GC ++++ H              PGYVA
Sbjct: 314 PIQQRKTGKTNSLDFTGNGCRFIMNQHTEFVFGADWSMWGQPGYVA 359

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 27/126 (21%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELH----------- 128
           G+V+++D+RS      I    ++P     S  N  A    L GSDA L            
Sbjct: 310 GSVRVFDLRSLAHSTIIYEPPSSPA----SGPNAGATTPSLKGSDALLRLEPSPYDPNVL 365

Query: 129 -----------IYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
                      I D+R  +SP+ +L + H   + +I +HP+  NVL+S S D     +DL
Sbjct: 366 ATFAADSNKIIILDMRNPESPILNL-EGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

Query: 178 RQAEEE 183
             +  E
Sbjct: 425 NNSFME 430

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 20/93 (21%)

Query: 251 HPGYVACGNSQEGIGKLR-ILPFQGEQVDTNNAI-----------DINAAH--------G 290
           HP   A  +  + IG    I  F    VDTN  I           D+ ++H         
Sbjct: 227 HPTSPATADDMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAH 286

Query: 291 DEVVRDVFVPARNSKLLYSCGEDGSVKTWENKS 323
           D  V DV    ++++L  SCG DGSV+ ++ +S
Sbjct: 287 DSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS 319

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           GSD   +I+D+R   S     V +   D+  + F   D N + +GS DG  N+YDLR
Sbjct: 247 GSDGYTYIWDIRTPGSVQNFFVSNR--DVNTLQFF-KDGNSIATGSDDGMVNLYDLR 300

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 6/106 (5%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS-DAELHIYDVRKWDSPLR 140
           VK+WD RS NC+++I   K+     L +R   +     ++ S D    ++D+R     L 
Sbjct: 243 VKLWDPRSGNCISSILKFKHT---VLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELM 299

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
            + D    D   + +HP + ++      DG    +DL Q   E  L
Sbjct: 300 CVRDE--TDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPVL 343

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query: 75  ATATMGAVKIWDIRSNNCLATI--SNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDV 132
           ATA+ G +KIW+I++ +C+ T          FL       ++  GT       EL ++D+
Sbjct: 419 ATASNGLLKIWNIKTKSCIRTFECGYSLTCKFL---PGGTLVIVGTR----GGELQLFDL 471

Query: 133 RKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
               + L ++ D+H   I  +    SD   L++GS D     +D +  +E
Sbjct: 472 AS-STLLETIEDAHDAAIWSLDL-TSDGKRLVTGSADKSVKFWDFQLEQE 519

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 71/170 (41%), Gaps = 28/170 (16%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +K+WD+ S   L  ++   +A   L  DS    L  G+     D+ + ++D+   +  
Sbjct: 101 GVIKVWDLYSKTVLCNLNGHSSAITVLKFDSTGTRLISGSR----DSNIIVWDLVS-EVG 155

Query: 139 LRSLVDSHHDDITDIAFHPSDPNV---------LMSGSTDGYTNIYDLRQAEEEDALHQV 189
           L  L  SH D IT I  +    N          L+S S DG   I+DL+       + Q 
Sbjct: 156 LYKL-RSHKDAITGIWCNEMQNNGEDDENELDWLISTSKDGLIKIWDLK-------IQQC 207

Query: 190 INFASIHS--CGWLAPRR--IFTLSHMETFSIHELN-DKSDEAKEPRPVE 234
           I     H+  C  +A R   + T S      I ELN D  D+ K  + +E
Sbjct: 208 IETHIAHTGECWSVAVRNDLLITTSSDSQIKIWELNLDNDDDGKNKKLIE 257

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
           ++ I D+R  +SP+ +L + H   + +I +HP+  NVL+S S D     +DL  +  E  
Sbjct: 376 KIIILDMRNPESPILTL-EGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME-- 432

Query: 186 LHQVINFASIHSCG 199
               IN  S+ S G
Sbjct: 433 ----INGGSVKSPG 442

>YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON}
            KOG1Subunit of TORC1, a rapamycin-sensitive complex
            involved in growth control that contains Tor1p or Tor2p,
            Lst8p and Tco89p; contains four HEAT repeats and seven
            WD-40 repeats; may act as a scaffold protein to couple
            TOR and its effectors
          Length = 1557

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 71/169 (42%), Gaps = 19/169 (11%)

Query: 24   YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGE---VAVNKLKLINNDHENESTYATATMG 80
            ++  L+ +     +   DW+ GK+++    G      V  LKLIN D ++      ++ G
Sbjct: 1220 FEDQLITADDRSTITVFDWEKGKTLSKFSNGTPFGTKVTDLKLINED-DSALLLTGSSDG 1278

Query: 81   AVKIW-DIRSNNCLATISNDKNAPFLSLDSRHNMLAC------GTELSGSDAELHIYDVR 133
             +KI+ D +  +    +S  +    + L  R   L        G+ L+  D ++    +R
Sbjct: 1279 VIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGDVKV----IR 1334

Query: 134  KWDSPLRSL-VD---SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
             WD+   ++ VD        IT +       N+ ++G  DG   +YD R
Sbjct: 1335 VWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRR 1383

>AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL006W
           (LST8)
          Length = 303

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 82  VKIWDIRSNNCLATISN-DKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++ W+  +  C  TI + D     L + S    LA    L      + +YD+R  +    
Sbjct: 14  IRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHL-----HVRMYDIRTTNPNPV 68

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +  + H  ++T IAF   D   ++S S DG   ++D+R
Sbjct: 69  TSFEGHRGNVTSIAFQ-QDNKWMVSSSEDGTIKVWDVR 105

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 111 HNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSG-STD 169
           ++ML C  + +G    ++++D+R  ++PL+SL   H   I+   ++P+   +L +   +D
Sbjct: 309 NDMLLCSGDSTG---RVNLWDIRDLETPLKSL--DHGSSISKTQWNPNLSTILATADQSD 363

Query: 170 GYTNIYDLRQAEEEDAL 186
           G   ++D+ Q   E+ L
Sbjct: 364 GLVKLWDIAQEPGEELL 380

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 59/118 (50%), Gaps = 19/118 (16%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL--SGSDAELHIYDVRKWDS 137
           G VK+WDIRS   + T+   K +P     ++ + L    ++  S +DA + ++DV    S
Sbjct: 222 GVVKLWDIRSRTAVMTLIGHK-SPI----TKVHCLPVNPQVVSSSTDATVRLWDVTAGKS 276

Query: 138 PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE-EEDALHQVINFAS 194
               ++  H   + D + HPS+ + ++S  TD      D+R  +  E AL  + NFAS
Sbjct: 277 --YKILTHHKRSVRDFSLHPSEFS-MVSACTD------DIRSWKLPEGAL--LTNFAS 323

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           ++  H   ITDI F+P +P++L + S D Y + +D+R
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMR 148

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 53/128 (41%), Gaps = 20/128 (15%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDS--------RHNML 114
           IN + EN    AT ++   V  WD+RS           + PF +  +        + N  
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRS----------PHRPFYTTSAWRSGASQVKWNYK 172

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
                 S    +++I+D+R   +PL  LV  H   +  I F+    + +MS S DG    
Sbjct: 173 DSNILASAHSNDIYIWDLRMGSTPLHKLV-GHDSSVNSIDFNRFKSSEIMSSSNDGTVKF 231

Query: 175 YDLRQAEE 182
           +D+ +  +
Sbjct: 232 WDISKGSD 239

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 55/113 (48%), Gaps = 7/113 (6%)

Query: 70  NESTYATATM-GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELH 128
           N+S +ATA+     KIWD+ +   +AT++N K   +     +H+ L         D  + 
Sbjct: 498 NDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIAT---CSGDKTIK 554

Query: 129 IYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           I+ +  ++  +++ ++ H + +  I+F   +  ++  G+ DG   I+D    E
Sbjct: 555 IWSLENYN--IKATLEGHTNAVQRISFINKNKQLVSCGA-DGLVKIWDCSTGE 604

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 22/120 (18%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS--------DAELHIYDVR 133
           VK+WD R+ NC++TI          L  +H +L    +  G         D    ++D+R
Sbjct: 232 VKLWDPRTGNCVSTI----------LKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDIR 281

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFA 193
           +  + L    D    D   + +HP + +    G+ DG    +D+ Q   +     VI FA
Sbjct: 282 QNMTELMVFRDD--VDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQDITKPV--HVIPFA 337

>KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]
           {ON} similar to uniprot|P40066 Saccharomyces cerevisiae
           YER107C GLE2 Component of the nuclear pore complex
           required for polyadenylated RNA export but not for
           protein import homologous to S. pombe Rae1p
          Length = 371

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD++S +       D  AP L+  +R ++        G D  L ++DV    +    
Sbjct: 60  VRIWDVQSGSPQGRAQYDHQAPVLT--TRWSIDGTKVASGGCDNVLKVFDVTTGQAQQIG 117

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
             +S    +  ++  P++   + +GS D     +DLR  +
Sbjct: 118 QHNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQ 157

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 105 LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLM 164
           +SL+    +LA G    G+D    ++D+   D P++  V  H   +  IAF P   ++L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 111 HNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDG 170
           H M +     +  D  + ++D+     P+  L  +  D +  I F P  P++++SGS DG
Sbjct: 133 HPMDSKSLTTANDDRVVRLWDISHAYQPILELTGAS-DYVRSICFLPGTPHMVVSGSYDG 191

Query: 171 YTNIYDLR 178
              +YD R
Sbjct: 192 VIRLYDTR 199

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 24/119 (20%)

Query: 80  GAVKIWDIR--SNNCLATISNDKNAPFLSLD-------------SRHNMLACGTELSGSD 124
           G +++WD++  SN+ L     + + P L++D             S  ++LA     SG  
Sbjct: 215 GQIQLWDLKKYSNSKL-----EMDTPLLNVDFDALGVNDVNWHPSHDSILAA----SGES 265

Query: 125 AELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             + ++D R     LRS    H+  I    F+    ++L+SG ++G  N++DLR+ + E
Sbjct: 266 NIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLDGE 324

>KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa]
           {ON} similar to uniprot|P38123 Saccharomyces cerevisiae
           YBR175W SWD3 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 316

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 132 VRKWD----SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           ++ WD    + LR+L  +H + +  I   P DP++L SGS DG   I+D
Sbjct: 123 IKVWDILTGTLLRTL-SAHSEPVVSIDIPPFDPSILSSGSYDGLIRIFD 170

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           ++  H   ITDI F+P  P+VL + S D Y + +D+R
Sbjct: 109 VLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 145

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 53/138 (38%), Gaps = 20/138 (14%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDS--------RHNML 114
           IN + ++    AT ++   V  WD+RS           + PF S  S        + N  
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRS----------PHRPFYSTSSWRSAASQVKWNYK 169

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
                 S    ++ ++D+RK  +PL SL   H   +  I F+      +MS S DG    
Sbjct: 170 DPNVLASSHGNDIFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKF 228

Query: 175 YDLRQAEEEDALHQVINF 192
           +D   +  E       NF
Sbjct: 229 WDYSTSTTESKRTVTTNF 246

>NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa]
           {ON} Anc_7.231
          Length = 608

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 16/87 (18%)

Query: 22  PAYQHSLLASLSNGQVHQLDWQTGKSI----AHIK-TGEVAVNKLKLINNDHENESTYAT 76
           P   H L  SL N  +   D QTG+ I     H++   ++A +  ++I+  H+       
Sbjct: 475 PYPTHLLSCSLDN-TIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHD------- 526

Query: 77  ATMGAVKIWDIRSNNCLATISNDKNAP 103
              G++KIWD++S  C+ T    +  P
Sbjct: 527 ---GSIKIWDLQSGKCMHTFHGKRLQP 550

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/166 (19%), Positives = 69/166 (41%), Gaps = 8/166 (4%)

Query: 17  CLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENESTYAT 76
           C    PA  + L+  LSN +V   D +       ++  +  ++ +  +    +     ++
Sbjct: 259 CAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFISS 318

Query: 77  ATMGAVKIWDIRSNNCLATISNDK--NAPFLSLDSRHNMLACGTELSGSDAELHIYDVR- 133
           +   +++IWD + N  +  IS+    + PF+ +   H+  A  +     D  ++ + ++ 
Sbjct: 319 SEDKSMRIWDNQVNIPIKQISDTAQYSMPFIDIHPEHHYFATQS----MDNAIYAFSMKP 374

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPS-DPNVLMSGSTDGYTNIYDLR 178
           K+    +   + H      I F  S D   L SG T G   I+D +
Sbjct: 375 KYRRNPKKRFEGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWDWK 420

>ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P40066 Saccharomyces
           cerevisiae YER107C GLE2 Component of the nuclear pore
           complex required for polyadenylated RNA export but not
           for protein import homologous to S. pombe Rae1p
          Length = 358

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL--SGSDAELHIYDVRKWDSPL 139
           V+IWD++          +  AP L     ++    GT++   G+D  + ++DV    +  
Sbjct: 54  VRIWDVQGGIPQGRAQFEHQAPVLCTKWSND----GTKVVAGGADNVVSMFDVATGQTKQ 109

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
             L D     ++ + F  S+ +VL++GS D     +D RQA+
Sbjct: 110 LGLHDGPVKSMSYLQFGGSNTDVLVTGSWDKTLKYWDARQAQ 151

>TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.405
           YER107C
          Length = 355

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 8/103 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD +  N       +  AP L   +R +         G D  + IYDV    S    
Sbjct: 56  VRIWDAQGGNPQGRAQYEHAAPVLC--TRWSSDGTKVASGGCDNAIKIYDVA---SGQNQ 110

Query: 142 LVDSHHDDITDIAF---HPSDPNVLMSGSTDGYTNIYDLRQAE 181
            + +H+  +  + F    PS+   L++GS D     +DLRQ +
Sbjct: 111 QLGTHNAAVKSLRFVNCGPSNQECLVTGSWDKTLKYWDLRQPQ 153

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +K+WD+ S   L   +  K A   +  DS    L  G++    D+ + ++D+   +  
Sbjct: 101 GVIKVWDLVSKTVLLNFNGHKAAITLMQFDSTGTRLISGSK----DSNIIVWDLVG-EVG 155

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           L  L  SH D IT   F     + L+S S DG   I+DL+  +
Sbjct: 156 LYKL-RSHKDAIT--GFWCQGEDWLVSTSKDGLIKIWDLKTQQ 195

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G++KIW+++++ C+ T          +L  +         L     EL ++D+  
Sbjct: 407 ATASNGSLKIWNVKTHKCIRTFECG-----YALTCKFLPGGLLVILGTRSGELQLFDLAS 461

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
             S L ++ D+H   I  +    SD   L++GS D     +D +
Sbjct: 462 -SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFQ 503

>Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C
           (AIP1) - actin cortical patch component [contig 55] FULL
          Length = 611

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 21/112 (18%)

Query: 66  NDHENESTYATATM-GAVKIWDIRSNNCL------ATISNDKNAPFLSLDSRHNMLACGT 118
           ++ EN   + TA+   A+++WD+ S  CL      AT+ N +       D+    ++   
Sbjct: 257 DEGENSKKFVTASADAAIRLWDVESGACLEKWSLEATLPNQQVGVAAISDTEFVSVSL-- 314

Query: 119 ELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDG 170
                D  L+I+ V +  SP R  ++ H+  IT +A  P     L+SGS DG
Sbjct: 315 -----DGCLNIFKVGQ-KSPSRR-IEGHNKAITALAAGP-----LVSGSYDG 354

>ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} similar
           to uniprot|P07834 Saccharomyces cerevisiae YFL009W CDC4
           F-box protein required for G1/S and G2/M transition
           associates with Skp1p and Cdc53p to form a complex
           SCFCdc4 which acts as ubiquitin-protein ligase directing
           ubiquitination of the phosphorylated CDK inhibitor Sic1p
          Length = 777

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 18/128 (14%)

Query: 67  DHENESTYATATMGAVKIWDIRS--NNCLATISNDKNAPFLSLDSRHNMLACGTELSGSD 124
           DH+     + +    +K+WD+++  NN   T+  +   P   +    + L   T L G  
Sbjct: 588 DHKRSRCISASMDSTIKVWDLQNIWNNGTCTVIRNSITPCTKITGSMSTLQGHTALVG-- 645

Query: 125 AELHIYD-----------VRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTN 173
             L + D           +R WDS   S   ++H+      F+ SD N+L+SGS   + N
Sbjct: 646 -LLRLSDKFLVSGGADGFLRCWDSNDYSRRFAYHNMSAITTFYLSD-NLLVSGSESQF-N 702

Query: 174 IYDLRQAE 181
           +Y+LR  +
Sbjct: 703 VYNLRSGK 710

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 84  IWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLV 143
           +WDIRS + + T++   + P  ++    N     T   G D  ++++D+R+ D    + +
Sbjct: 338 LWDIRSGSKVMTLAG-HSKPVYTVAWSPNGYQVAT--GGGDGLINVWDIRQRDEGQLNQI 394

Query: 144 DSHHDDITDIAFHPSD-PNVLMSGSTDGYTNIY 175
            +H + +T + F   D    L+S   D   NIY
Sbjct: 395 LAHRNIVTQVKFSNDDGGKKLVSCGYDNLINIY 427

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 83  KIWDIRSNNCLATISNDKNAPF-LSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           ++WD  ++  L          F LS     +++  G    G D+   ++D+R   S + +
Sbjct: 295 RLWDASTHQELLLQEGHSKGVFSLSFQCDGSLVCSG----GMDSLTMLWDIRS-GSKVMT 349

Query: 142 LVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASI 195
           L   H   +  +A+ P+   V  +G  DG  N++D+RQ  +E  L+Q++   +I
Sbjct: 350 LA-GHSKPVYTVAWSPNGYQV-ATGGGDGLINVWDIRQ-RDEGQLNQILAHRNI 400

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 120 LSGSDAELHIYDVRKWDS-PLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+++ K  S  +  ++  H   ITDI F P  P++L + S D Y + +D+R
Sbjct: 86  VSTSNQKAIIWNLTKTSSNAIEYVLHGHSRAITDINFSPQHPDILATCSIDTYVHAWDMR 145

Query: 179 QAE 181
             +
Sbjct: 146 SPQ 148

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 4/109 (3%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR 133
           +A  +   V+++  R+   + T S  K+  + +   +   L C  + +G    + +YD  
Sbjct: 55  FAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYDSY 111

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
              + L S+  S H       FH  D   L+S S D  T ++D+  A E
Sbjct: 112 NPRTLLVSVAASQHPTHV-TKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231
          Length = 767

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 16/87 (18%)

Query: 22  PAYQHSLLASLSNGQVHQLDWQTGKSI----AHIK-TGEVAVNKLKLINNDHENESTYAT 76
           P   H L  SL N  +   D +TGK I     H++   ++A +  ++I+  H+       
Sbjct: 591 PYPTHLLSCSLDN-TIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHD------- 642

Query: 77  ATMGAVKIWDIRSNNCLATISNDKNAP 103
              G++KIWD++S  C+ T    K  P
Sbjct: 643 ---GSIKIWDLQSGKCMHTFHGKKLQP 666

>TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {ON}
           Anc_8.721 YOR272W
          Length = 457

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 53/117 (45%), Gaps = 2/117 (1%)

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           ++I + ++N   Y+ +    +K WD+ +  C+ T +   +   ++     N+LACG+  S
Sbjct: 289 QVIFDANDNTVGYSVSQDHTIKTWDLVTARCVDTKTTSYSLLSVTQMKSLNLLACGS--S 346

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                LH   V       +  +  H + +  +     +  +L SGS DG   ++D+R
Sbjct: 347 ARHITLHDPRVDSSSKITQQQLVGHKNFVVSLDTCAENEYLLSSGSHDGTVKVWDIR 403

>NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa]
           {ON} Anc_7.405 YER107C
          Length = 362

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 16/130 (12%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           G V+IWD++          +   P LS  +R +         G D  + ++DV    S  
Sbjct: 57  GKVRIWDVQGGVAQGRSQYEHAGPVLS--TRWSNDGSKVASGGCDNIVKLFDVASGQSQQ 114

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCG 199
             + D+    +  +   PS+   L++GS D     +D+RQ +   A+  VI         
Sbjct: 115 IGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQ---AISTVI--------- 162

Query: 200 WLAPRRIFTL 209
              P R++T+
Sbjct: 163 --MPDRVYTM 170

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 10/113 (8%)

Query: 68  HENESTYATATM-GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDA 125
           H+  +  A   M G +K+WD+ S + L T +  K+A   +  D     L  G+     D+
Sbjct: 86  HDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKSAITVMKFDVTGTRLISGSR----DS 141

Query: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
            + ++D+   +  L  L  SH D I+ I     D   L+S S DG   I+DL+
Sbjct: 142 NIIVWDLVS-EVGLYKL-RSHKDAISGIWCEGED--WLVSTSKDGLIKIWDLK 190

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 50/127 (39%), Gaps = 24/127 (18%)

Query: 81  AVKIWDIRSNNCLATI--------------SNDKNAPFLSLDSRHNMLACGTELSGSDAE 126
            ++ WD+R+  CL TI              +   N P  S+   HN       L   DA 
Sbjct: 525 TIRQWDLRTGKCLQTIDINFTNRGTSDGFSTISSNNPRSSVLLTHNDPPVIGALQCYDAA 584

Query: 127 LHIYD----VRKWDSPLRSLV---DSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
           +        VR WD  +  +V   + H D +T + F   D   L++GS D    I+DLR 
Sbjct: 585 MATGTKDGIVRLWDLRMGQVVRTLEGHTDAVTGLQF---DAVNLVTGSLDRSIRIWDLRT 641

Query: 180 AEEEDAL 186
               DA 
Sbjct: 642 GTLADAF 648

>Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272W
           (REAL)
          Length = 461

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 74  YATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVR 133
           Y+ +    +K WD+ +  C+ T     +   ++     N+LACG+  S     LH   + 
Sbjct: 305 YSVSQDHTIKTWDLVTARCIDTRVTSYSLLSIAQLPSLNLLACGS--SARHITLHDPRLG 362

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                 +  +  H + ++ +   P +  +L SGS DG   ++D+R
Sbjct: 363 ASSKVTQQQLIGHKNLVSSLDTCPENEYILCSGSHDGTVKVWDVR 407

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 146 HHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEE 182
           H   ITDI FHP  P +L + S D Y + +D+R ++ 
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMRCSQR 149

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK+WD RS NC+++I   K+    +    ++ N+L   ++    D    ++D+R     L
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISK----DKSCRVFDIRYSMKEL 298

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             + D    D   + +HP + ++      DG    +DL Q   E  L
Sbjct: 299 MCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPIL 343

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 72/156 (46%), Gaps = 18/156 (11%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           G V+I+D+    C+ T+S  K+     L   +++L  G+     D  +   DVR  DS  
Sbjct: 314 GLVEIYDVVKRKCIRTLSGHKDR-VACLSWNNHILTSGSR----DRRILHRDVRVPDS-F 367

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD------LRQAEEEDALHQVINFA 193
              +++H  ++  + ++P + N L SG  D    +YD      + + EE  A  + + ++
Sbjct: 368 FERIETHSQEVCGLKWNP-ESNKLASGGNDNMVYVYDGTSRSPVLKFEEHTAAVKALAWS 426

Query: 194 S-----IHSCGWLAPRRIFTLSHMETFSIHELNDKS 224
                 + S G  A R++ T +    F ++E++  S
Sbjct: 427 PHKRGILASGGGTADRKLKTWNVNTGFKVNEVDTGS 462

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 14/112 (12%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD--- 136
           G +K+WDI S  CLAT     ++      ++   +   + L G+        VR WD   
Sbjct: 367 GKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLIR 418

Query: 137 -SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY-TNIYDLRQAEEEDAL 186
               R+   +       +A  PS   V+ +GS D +  +++ ++  +  DAL
Sbjct: 419 YRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 469

>TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8.288
           YDR128W
          Length = 1134

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 10/117 (8%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLD---SRHNMLACGTE 119
           IN +H++    AT ++   V  WD+RS +     + +  A    +       N+LA    
Sbjct: 120 INFNHQHPDILATCSIDTYVHAWDMRSPSRPFYTTREWVAGASQVKWSFKDQNVLA---- 175

Query: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            S    E+ I+D+RK  +PL  L+  H   +  I F+    + +M+GS DG    +D
Sbjct: 176 -SAHGNEVSIWDLRKGSTPLGKLL-GHESGVNSIDFNRFKNDEIMTGSNDGTVKFWD 230

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK+WD RS NC+++I   K+    +    ++ N+L   ++    D    ++D+R     L
Sbjct: 245 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISK----DKSCRVFDIRYSMKEL 300

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             + D    D   + +HP + ++      DG    +DL Q   E  L
Sbjct: 301 MCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPIL 345

>Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]
           {ON} complement(268887..269966) [1080 nt, 360 aa]
          Length = 359

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 8/108 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWDI+          +   P L   +R ++        G D  +++YDV   +S    
Sbjct: 59  VRIWDIQGGVAQGRAQFEHAKPVLC--TRWSLDGSKVASGGCDNIVNMYDV---NSGQSQ 113

Query: 142 LVDSHHDDITDIAF---HPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
            + +H   I  + F    PS+   L++GS D     +DLRQ +    L
Sbjct: 114 QIGTHSSAIKSLRFVQCGPSNQECLVTGSWDKTIKYWDLRQPQPITTL 161

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
           (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 120 LSGSDAELHIYDV-RKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           +S S+ +  I+D+ R   + +  ++ +H   ITDI F+   P++L + S D Y + +DLR
Sbjct: 86  VSTSNQKAIIWDLARSSSNSIEHVIHAHFRAITDINFNRQHPDILATCSIDTYIHAWDLR 145

>AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER107C
           (GLE2)
          Length = 361

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 45/103 (43%), Gaps = 8/103 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD+++         +  AP L+  +R +         G D  L +YDV    S    
Sbjct: 58  VRIWDVQNGMTQGRAQYEHQAPVLT--TRWSSDGTKVASGGCDNILKLYDVA---SGQAQ 112

Query: 142 LVDSHHDDITDIAF---HPSDPNVLMSGSTDGYTNIYDLRQAE 181
            + SH   +  + F    PS+   +++GS D     +D+RQ +
Sbjct: 113 QIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQ 155

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 53/128 (41%), Gaps = 20/128 (15%)

Query: 64  INNDHENESTYATATMGA-VKIWDIRSNNCLATISNDKNAPFLSLDS--------RHNML 114
           IN + ++    AT ++   V  WD+RS           + PF +  S        + N  
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRS----------PHRPFYTTSSWRSSASQVKWNFK 170

Query: 115 ACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
                 S    ++ I+D+R   +PL  L   H+  +  I F   + N +MS S DG    
Sbjct: 171 DSNILASSHGNDVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKF 229

Query: 175 YDLRQAEE 182
           +DL + E+
Sbjct: 230 WDLSKEEK 237

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 146 HHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           H   ITDI F+   P++L + S D Y + +D+R
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMR 146

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 20/107 (18%)

Query: 82  VKIWDIRSNNCLATISNDK---NAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKW--- 135
           +K+WDI +  CL  +S  +   N      D+R  +LA     +G DA + ++DV      
Sbjct: 305 IKLWDISTTQCLGVLSGHRATVNTTRFIDDTR--LLAS----AGKDASVKVWDVDNIVDK 358

Query: 136 -----DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDL 177
                D+   +  D H D +T +A   +  N ++SGS D     +DL
Sbjct: 359 DGNANDNLCLATFDGHKDSVTALA---TTGNAIVSGSNDKTLRHWDL 402

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 63/159 (39%), Gaps = 38/159 (23%)

Query: 57  AVNKLKLINNDHENESTYATATMG----------AVKIWDIRSNNCLATI---------- 96
           A + L L   D   +S  A AT G           ++ WD+ S  C+ +I          
Sbjct: 362 ANDNLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVP 421

Query: 97  --------SNDKNAPFLS-LDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHH 147
                   +   N P +   D   N L  GT+    D  ++++D+R     +   ++ H 
Sbjct: 422 QSVSKLDITPSFNTPLIGGADCIDNALVTGTK----DGIVYLWDLRI--GRVVGSLEGHR 475

Query: 148 DDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             IT + +  S+   L++GS D  T I+DLR     + L
Sbjct: 476 GPITSLKYMGSE---LITGSMDKSTRIWDLRMGSVAELL 511

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 12/88 (13%)

Query: 77  ATMG---AVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS-DAELHIYDV 132
           AT G    VK+WDIRS   + T+   K+     ++  H +      +S S DA + ++D+
Sbjct: 212 ATAGRDSVVKLWDIRSRVPVVTLIGHKSP----INKVHCLPVNPQVISSSVDATIRLWDI 267

Query: 133 RKWDSPLRSLVDSHHD-DITDIAFHPSD 159
               +   S V +HH   I DIAFHPS+
Sbjct: 268 VAGKA---SKVLTHHKRSIRDIAFHPSE 292

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 12/127 (9%)

Query: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNC---LATISNDKNAPFLSLDSRHNMLACG 117
           L + +N H      +T+    VK+WD+ S N    LA+I ++KN       S  +ML   
Sbjct: 294 LSMAHNKHFRSVLASTSADHTVKLWDLNSGNAARSLASIHSNKNVS----SSEWHMLNGS 349

Query: 118 TELSGS-DAELHIYDVRKWDSPLRSLVDS--HHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
             L+G  D+ + + DVR  D    S   S    ++I  + F  ++ N+++ G+  G    
Sbjct: 350 VLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTF--ANENIILCGTDSGNVYS 407

Query: 175 YDLRQAE 181
           +D+R  E
Sbjct: 408 FDIRNNE 414

>SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [1326
           bp, 441 aa] {ON} weakly similar to uniprot|Q12206
           YOR229W Saccharomyces cerevisiae WTM2 WD repeat
           containing transcriptional modulator 2
          Length = 441

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 33/166 (19%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSR---HNMLACGTELSGSDAELHIYDVRK---- 134
           ++ WD+RS+  + ++S+ KN      D       +   GT    S   L ++D+R     
Sbjct: 247 LRFWDVRSDKPVWSLSDPKNGSLTCFDVSPVIDTLFVTGT----STGVLKLWDLRAVAAS 302

Query: 135 ------WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR------QAEE 182
                   + + SL  S  D + D+ F  + P   +S    G    +DL         E+
Sbjct: 303 SGHDDDCTTEIVSLYHSGGDSVADVQFGFTSPTQFLSVGGSGNVYHWDLEYLFASGSGED 362

Query: 183 EDAL------HQVINFASIHSCGWLAPRRIFTLSHMETFSIHELND 222
           ++ L       Q + F  +H+ G    R I  L+   T S HE+ D
Sbjct: 363 DEVLDSEELQQQCLKF--MHTGG--GRRSIGNLNKRGTVSWHEIID 404

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 124 DAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           D  L  +DVR  D P+ SL D  +  +T     P    + ++G++ G   ++DLR
Sbjct: 244 DNRLRFWDVRS-DKPVWSLSDPKNGSLTCFDVSPVIDTLFVTGTSTGVLKLWDLR 297

>Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON}
           YER107C (REAL)
          Length = 365

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/138 (17%), Positives = 56/138 (40%), Gaps = 16/138 (11%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           G V+IWD+++         + ++P L   +R +       + G D  L +YDV    +  
Sbjct: 59  GKVRIWDVQNGVPQGRAQYESSSPVLC--TRWSNDGAKVAIGGCDNALKLYDVASGQTQQ 116

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCG 199
             +  +    +  +   PS+   +++GS D     +D+RQ +    +             
Sbjct: 117 VGMHTAPIKVLRYVQCGPSNAECIVTGSWDKTIKYWDMRQPQPVSTV------------- 163

Query: 200 WLAPRRIFTLSHMETFSI 217
            + P R++++   ++  +
Sbjct: 164 -MMPERVYSMDSKQSLLV 180

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           VK+WD RS NC+++I   K+    +    ++ N+L   ++    D    ++D+R     L
Sbjct: 243 VKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISK----DKSCRVFDIRYSMREL 298

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDAL 186
             + D    D   + +HP + ++      DG    +DL Q   E  L
Sbjct: 299 MCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPIL 343

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 148 DDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           D +    F PS P+++M+GS DG+  +YD R
Sbjct: 169 DYVRTACFVPSAPHLVMTGSYDGFLRLYDTR 199

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 7/98 (7%)

Query: 82  VKIWDIRSNNCLATISN-DKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++ W+  +  C  TI + D     L + S    LA    L      + +YD+R  +    
Sbjct: 14  IRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHL-----HVRLYDIRSNNPNPV 68

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           S  + H  ++T IAF   +   ++S S DG   ++D+R
Sbjct: 69  SSFEGHKGNVTSIAFQQEN-RWMVSSSEDGTIKVWDVR 105

>NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa]
           {ON} Anc_8.585 YBR175W
          Length = 335

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 26/107 (24%)

Query: 90  NNCLATISND------------------KNAPFLSL--DSRHNMLACGTELSGSDAELHI 129
           N C+AT S+D                    AP +SL  + + N+L      S  D  + +
Sbjct: 76  NQCIATASDDFTLEIRHLTYGPLHRLVGHTAPVVSLCYNGKGNLLYS----SSMDESIKV 131

Query: 130 YDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           +DV   +  L   + +H + +  +   P D  VL SGS DG   ++D
Sbjct: 132 WDVL--NGILMKTISAHSESVVSVDICPEDSTVLSSGSFDGLIRLFD 176

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 9/103 (8%)

Query: 80  GAVKIWDIRSNNCLATISNDKNA-PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSP 138
           G +K+WD+ S   L   +  K A   L  D     L  G++    D+ + ++D+   +  
Sbjct: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSK----DSNIIVWDLVG-EVG 155

Query: 139 LRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181
           L  L  SH D IT   F     + L+S S DG   ++DL+  +
Sbjct: 156 LYKL-RSHKDSIT--GFWCQGEDWLISTSKDGMIKLWDLKTQQ 195

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 7/104 (6%)

Query: 75  ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRK 134
           ATA+ G++KIW+++++ C+ T          +L  +         L   + EL ++D+  
Sbjct: 407 ATASNGSLKIWNVKTHKCIRTFECG-----YALTCKFLPGGLLVILGTRNGELQLFDLAS 461

Query: 135 WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
             S L ++ D+H   I  +    SD   L++GS D     +D +
Sbjct: 462 -SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFQ 503

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSL--DSRHNMLACGTELSGSDAELHIYDVRKWDSPL 139
           +++WD RS  C++++ N K+    +    ++ N+L   ++    D    ++D+R   S  
Sbjct: 232 IRLWDPRSGQCISSLLNFKHTVLKTRFQPTKGNLLTAISK----DKSCRVFDIRH--SMR 285

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183
             +V     D   + +HP++  +    S DG    +D+ Q  E+
Sbjct: 286 ELMVYRDEVDYMTLEWHPTNETMFTVASYDGSLKHFDILQDLEK 329

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 14/112 (12%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD--- 136
           G +K+WDI S  CLAT     ++      ++   +   + L G+        VR WD   
Sbjct: 365 GKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLIR 416

Query: 137 -SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY-TNIYDLRQAEEEDAL 186
               R+   +       +A  PS   V+ +GS D +  +++ ++  +  DAL
Sbjct: 417 YRNFRTFTGTERIQFNCLAVDPS-GEVVCAGSLDNFDIHVWSVQTGQLLDAL 467

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 14/112 (12%)

Query: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWD--- 136
           G +K+WDI S  CLAT     ++      ++   +   + L G+        VR WD   
Sbjct: 362 GKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGT--------VRAWDLIR 413

Query: 137 -SPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGY-TNIYDLRQAEEEDAL 186
               R+   +       +A  PS   V+ +GS D +  +++ ++  +  DAL
Sbjct: 414 YRNFRTFTGTERIQFNCLAVDPSG-EVVCAGSLDNFDIHVWSVQTGQLLDAL 464

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 20/106 (18%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGS--------DAELHIYDVR 133
           +K+WD RS NC++TI          L  +H +L    + +G         D    ++D+R
Sbjct: 229 IKLWDPRSGNCVSTI----------LKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIR 278

Query: 134 KWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
                L  + D    D   + ++P + ++   G+ DG    +DL Q
Sbjct: 279 HSMKELLCVRD--EVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQ 322

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 18/111 (16%)

Query: 87  IRSNNCLATISNDKNAPFLSLDSRHNMLA--------------CGTELSGSDAELHIYDV 132
           IR NN  +T       P LS  +R N  +              C    + S A + IYD+
Sbjct: 185 IRPNNNTSTKLGTSLLPKLSKRTRQNKFSTIADVKTGFNNYKNCIAVCNNSTA-ISIYDL 243

Query: 133 RK---WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180
            K    D+PL + +  H   I    F+  + N+++SG  D    I+DLR +
Sbjct: 244 NKSSSLDNPLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDLRSS 294

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 50/127 (39%), Gaps = 30/127 (23%)

Query: 81  AVKIWDIRSNNCLATI---------------------SNDKNAPFLSLDSRHNMLACGTE 119
            V+ WD+ S  CL TI                     S D +    +L      LA GT 
Sbjct: 519 TVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGALQCFDAALATGTR 578

Query: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179
               D  + ++D+R     +R+L + H   +T + F   D   L++GS D    I+DLR 
Sbjct: 579 ----DGAVRLWDLRSG-KIIRTL-EGHTGAVTSLKF---DSKNLITGSLDRSVRIWDLRT 629

Query: 180 AEEEDAL 186
               DA 
Sbjct: 630 GTLADAF 636

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 32/182 (17%)

Query: 18  LNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDH-------EN 70
           ++L P+ +  +L +L +G+V   +++T + +  I+  +  V   K I   +       +N
Sbjct: 19  IDLHPS-EPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDN 77

Query: 71  ESTYATATMGAVKIWDIRSN-NCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHI 129
           +        G  K+ D  ++ + + +I+   + P++              L+GSD     
Sbjct: 78  KVRVFNYNTGE-KVADFVAHPDYIRSIAVHPSKPYI--------------LTGSDD---- 118

Query: 130 YDVRKW----DSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDA 185
             V+ W    D  L      H   +  +AF+P DPNV  SG  D    ++ L Q+     
Sbjct: 119 LTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFT 178

Query: 186 LH 187
           LH
Sbjct: 179 LH 180

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 21/167 (12%)

Query: 44  TGKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIRSNNCLATISN--DKN 101
           T   + H+ T E     L  +++           + G V+I+D+  N C+ T+S   D+ 
Sbjct: 307 TTNDVTHLATSESDFTSLSWVDS---GSHLAVGLSSGIVEIYDVLKNKCIRTLSGHVDRV 363

Query: 102 APFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPN 161
           A    L   +++L+ G+     D ++   DVR  + P    +D+H  ++  + ++ ++ N
Sbjct: 364 A---CLSWNNHVLSSGSR----DRKILHRDVRAPE-PFFEQIDTHSQEVCGLKWNVNE-N 414

Query: 162 VLMSGSTDGYTNIYD--LRQA----EEEDALHQVINFASIHSCGWLA 202
            L SG  D    +YD  LRQ     EE  A  + + + S H+ G LA
Sbjct: 415 KLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMAW-SPHTRGVLA 460

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 127 LHIYDVRK---WDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           + IYD+ K    D+PL +    H   +    F+ +  ++L+SG  DG   I+DLR
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLR 262

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 47/116 (40%), Gaps = 20/116 (17%)

Query: 75   ATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRH---NMLACGTELSGSDAELHIYD 131
            AT  +  ++IWD  + +    I    ++   S+ S     N+  CG     +D  L +YD
Sbjct: 1301 ATGDVKVIRIWDAHTESMEVDIPAKTSSLITSITSDQLSGNIFVCGF----TDGSLRVYD 1356

Query: 132  ---------VRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                     VR W    R         IT++         L+SGS++G   ++D+R
Sbjct: 1357 RRVDVRDAMVRVW----RGNGGRQGSSITNVHLQRGGYRELVSGSSNGVVELWDIR 1408

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 79/180 (43%), Gaps = 20/180 (11%)

Query: 24   YQHSLLASLSNGQVHQLDWQTGKSIAHIKTGE---VAVNKLKLINNDHENESTYATATMG 80
            +++ L+ +     +   DW++ +  +    G      +  L+LIN D +N      ++ G
Sbjct: 1195 FENYLITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINED-DNALLLTGSSNG 1253

Query: 81   AVKIW-DIRSNNCLATISNDKNAPFLSLDSRHNMLAC------GTELSGSDAELHIYDVR 133
             VK++ ++  +  +  I++ +    + L  R + L        G  L+  D ++    +R
Sbjct: 1254 IVKVFKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDVKV----IR 1309

Query: 134  KWDSPLRSL-VD---SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQV 189
             WD+   S+ VD        IT I       N+ + G TDG   +YD R+ +  DA+ +V
Sbjct: 1310 IWDAHTESMEVDIPAKTSSLITSITSDQLSGNIFVCGFTDGSLRVYD-RRVDVRDAMVRV 1368

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 19/107 (17%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD+++  C  T+S +     +++            L  +        VR WDS    
Sbjct: 449 VRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA--------VRVWDSETGF 500

Query: 142 LVD----------SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           LV+           H D +  + F   D N ++SGS D    +++LR
Sbjct: 501 LVERLDSENELGTGHKDSVYSVVF-TKDGNKVVSGSLDRSVKLWNLR 546

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%), Gaps = 8/96 (8%)

Query: 82  VKIWDIRSNNCLATI-SNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLR 140
           ++IWDI+    +  +  +D++   L      + L  G+     D  + I+D++       
Sbjct: 407 IRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGS----GDRTVRIWDLKTGQC--- 459

Query: 141 SLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
           SL  S  D +T +A  P D   + +GS D    ++D
Sbjct: 460 SLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 495

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           GSD  ++++DVR         V     DI  + F   D N L SGS DG   ++DLR
Sbjct: 256 GSDGYIYLWDVRTGSVAQTFFV--SDSDINAVQFFK-DGNALASGSDDGIIRLFDLR 309

>Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272W
           (REAL)
          Length = 461

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 62  KLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELS 121
           ++I +  +N   Y+ +   ++K WD+ +  C+ T +   +   ++     N+LA G+  S
Sbjct: 293 QVIFDSSDNTVGYSVSQDHSIKTWDLVTARCIDTRTTSYSLLSIAQLPSLNLLAYGS--S 350

Query: 122 GSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
                LH   +       +  +  H + ++ +   P +  +L SGS DG   ++D+R
Sbjct: 351 ARHITLHDPRIGASSKVTQQQLIGHKNFVSSLDSCPENEYILCSGSHDGTVKVWDVR 407

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 63/144 (43%), Gaps = 30/144 (20%)

Query: 60  KLKLINNDHE-------NESTYATATMG---AVKIWDIRSNNCLA--TISNDKNAP---- 103
           K +LI +D E        +ST   A+ G   +V+++D+R   CLA  TI  +   P    
Sbjct: 247 KTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLR---CLAHSTIIYEPTIPDGAP 303

Query: 104 ----------FLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDI 153
                      L L+            +   +++ I D+R   SPL +L ++H   I  I
Sbjct: 304 DLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLTL-EAHTAPINQI 362

Query: 154 AFHPSDPNVLMSGSTDGYTNIYDL 177
            +HP+  NVL+S S D     +DL
Sbjct: 363 KWHPTRRNVLLSASDDCQVLYWDL 386

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLR 178
           SGSD   +I+DVR   S     V   + D+  + F   D N +++GS DG   ++DLR
Sbjct: 244 SGSDGYTYIWDVRSAASVQSFFV--SNSDVNTVKFFK-DGNSIVTGSDDGTLRMFDLR 298

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 9/54 (16%)

Query: 135 WDSP----LRSLVDSHHDDITDIAFHPS----DPNVLMSGSTDGYTNIYDLRQA 180
           WD P    +R   D H  D+  I+  P+      N+  S  +DGYT I+D+R A
Sbjct: 206 WDIPKAKRVREYAD-HLGDVLSISLPPAHTENSANLFASSGSDGYTYIWDVRSA 258

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 59/129 (45%), Gaps = 14/129 (10%)

Query: 66  NDHENESTYATATMGAVKIWDIRSNNCL--ATISNDKNAPF-------LSLDSRHNMLAC 116
           N  +N +  ++ + G++KIWDI   +C       N+   PF       ++    H+ +  
Sbjct: 197 NLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDSIFA 256

Query: 117 GTELSGSDAELHIYDVRKWDSPLRSL--VDSHHDDITDIAFHPSDPNVLMSGSTDGYTNI 174
               S    +L ++DVR  +  L+    + +H   I    F+  +  +L S  + G  N+
Sbjct: 257 ACSESN---KLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKINM 313

Query: 175 YDLRQAEEE 183
           +D+R+ ++E
Sbjct: 314 WDIRKLDKE 322

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 19/128 (14%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRS 141
           V+IWD+R+  C  T+S +     +++            L  +        VR WDS    
Sbjct: 528 VRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA--------VRVWDSETGF 579

Query: 142 LVD----------SHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEEDALHQVIN 191
           LV+           H D +  + F   D N ++SGS D    +++LR    +D    V  
Sbjct: 580 LVERLDSENELGTGHKDSVYSVVFT-RDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPG 638

Query: 192 FASIHSCG 199
              +   G
Sbjct: 639 TCEVTYTG 646

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 10/97 (10%)

Query: 82  VKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL-SGS-DAELHIYDVRKWDSPL 139
           ++IWDI     +  +   +     SLD        G +L SGS D  + I+D+R      
Sbjct: 486 IRIWDIAQKKIVMVLQGHEQD-IYSLD----YFPSGDKLVSGSGDRTVRIWDLRNGQC-- 538

Query: 140 RSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYD 176
            SL  S  D +T +A  P D   + +GS D    ++D
Sbjct: 539 -SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 574

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,400,477
Number of extensions: 1996836
Number of successful extensions: 6893
Number of sequences better than 10.0: 606
Number of HSP's gapped: 6773
Number of HSP's successfully gapped: 758
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)