Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR153W3.500ON1401407204e-99
Skud_16.4473.500ON1401406832e-93
Smik_16.4053.500ON1391396762e-92
Suva_16.4813.500ON1391396753e-92
CAGL0L08382g3.500ON1401405764e-77
NCAS0F035903.500ON1401405557e-74
TDEL0D056803.500ON1401404984e-65
KNAG0A079803.500ON1471404933e-64
TBLA0C045203.500ON1401404904e-64
TPHA0A057103.500ON1411384776e-62
KAFR0G037303.500ON1441354699e-61
SAKL0F02508g3.500ON1401404637e-60
KLTH0G02354g3.500ON1401404514e-58
ZYRO0D09724g3.500ON1391284411e-56
Kpol_480.93.500ON1411414377e-56
KLLA0E03895g3.500ON1401404021e-50
AFR319W3.500ON1411172788e-32
Kwal_47.189033.500ON113441211e-08
TBLA0C031805.298ON166859720.32
Skud_81.1singletonON255131690.73
Kpol_1016.15.443ON125136681.3
Ecym_43178.254ON60577662.0
Kpol_1023.455.318ON44131634.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR153W
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   281   4e-99
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   267   2e-93
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   265   2e-92
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   264   3e-92
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   226   4e-77
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   218   7e-74
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   196   4e-65
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   194   3e-64
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   193   4e-64
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   188   6e-62
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   185   9e-61
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   182   7e-60
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   178   4e-58
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   174   1e-56
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   172   7e-56
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   159   1e-50
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   111   8e-32
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    51   1e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    32   0.32 
Skud_81.1 Chr81 complement(2..766) [765 bp, 255 aa] {ON} YCR038C...    31   0.73 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    31   1.3  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...    30   2.0  
Kpol_1023.45 s1023 (98232..99557) [1326 bp, 441 aa] {ON} (98232....    29   4.2  

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  281 bits (720), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVVQILFDVVLSYSMVGSVM
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  267 bits (683), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 136/140 (97%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           MRSFVTNNDIPVGYVTPKFPSLYWPIN+S+YN AFLYYISDIWKFSLYWTLIFNGAFYVT
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
            G+YASLTHRKK GS+WIFVMYV+YGGVQGLTTGTVMGFLIGAIYRSGLFSMSTW+PLCC
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVVQILFDV+L YSM+GSVM
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  265 bits (676), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%)

Query: 2   RSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTA 61
           RSFVTNNDIPVGYVTPKFPSLYWPINN +YNTAFLYYISDIWKFSLYWTLIFNGAFY+  
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCA 121
           G+YASLTHRKKAGS+WIF MYV+YGGVQGLTTGTVMGFLIGAIYRSGLFSMSTW+PLCCA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVQILFDVVLSYSMVGSVM 140
           VVQILFDVVL YSMVGSVM
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  264 bits (675), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%)

Query: 2   RSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTA 61
           RSF+TNNDIPVGY+TPKFPSLYWPIN+S+YNTAFLYYISDIWKFSLYWTLIFNGAFYV A
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCA 121
           G+YASLTHRKKAGS+WIFVMYV +GGVQGLT GT+MGFLIGAIYRSGLFSMSTW+PLCCA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVQILFDVVLSYSMVGSVM 140
           VVQILFDVVL YSM+GS+M
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  226 bits (576), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (87%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           M+SF+T+ D+P+GY TP FPSLYWPIN+ +Y+TAFLY+I DIWKF+LYWT IFNGAFY  
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AG+YASLTH K+ G +WIF +Y+LY GVQG+  GTVMGFLIGAIYRSGLFSMSTWVP+CC
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVVQIL DV +SYSMVGS+M
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  218 bits (555), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           MRSF+TNNDIP+GY+TPKFPSLYWPINN KY+  FLY ISDIWKF+LYWTLIFN AFY  
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AG+ AS +HR+  G +WI V+Y+ + GVQGL  GT+MGFLIGAIY +GLF+MSTW+PLCC
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AV QILFDV+++YS V  ++
Sbjct: 121 AVAQILFDVIMAYSSVSGIL 140

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  196 bits (498), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 116/140 (82%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           MRSF+TNND+P+GYVTP FPSL+WPI+N K++ A LY +  IWKF+LYW+LIFNGAFY  
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AG++AS +HR++AG +WI  +Y++YGG+Q +  GTV+GFLIG+IY +GLFSMSTW+P CC
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
            +VQILFD  +SY   G++M
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  194 bits (493), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 113/140 (80%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           +R+FV NN+IPVGY TP FPSLYWPI+N  Y+ AFLY I DIWKF++YW LI NGAFY T
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           +G+ A+++H K   ++ I  +Y+LY G+QG+  G + G L+GAIYR+GLF+MSTW+PLCC
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AV QILFDVV+SYS VGS++
Sbjct: 128 AVAQILFDVVMSYSHVGSLL 147

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  193 bits (490), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 106/140 (75%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           M+SF+TNNDIPVGYVTP FPSLYWPINN KYNT+FLY  +DIWKFS+YW +I N  FY  
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
            G  A ++HR K G +WI  +Y+  G VQG+  GT+MG++I AIY SGLF MSTW+P CC
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVVQILFDVV S+ +    M
Sbjct: 121 AVVQILFDVVQSFPISNLTM 140

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  188 bits (477), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (78%)

Query: 3   SFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAG 62
           +F+T+ND+PVGYVTP FPSLYWPINNSKYNTA+LY    IW F++YW+LI NG FY  AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  VYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAV 122
             A  THRKK G  WI  +Y++ GGVQG+  GT++G++I A Y S LFSMSTW+PLCCAV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 VQILFDVVLSYSMVGSVM 140
            Q+LF+V  SYS+VG++M
Sbjct: 124 AQVLFEVTTSYSLVGNLM 141

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  185 bits (469), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 108/135 (80%), Gaps = 1/135 (0%)

Query: 7   NNDIPVGYVTPKFPSLYWPIN-NSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYA 65
              +P+GY+TPKFPSLYWPI  +  ++ AFLY + DIWKF+LYW+LIFNGAFYV+AG  A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 66  SLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQI 125
            LT +KK+ S+ IF  Y ++GG+QG+  GTVMGFL+G IYR+GLF MS W+P+CCAV QI
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 126 LFDVVLSYSMVGSVM 140
           L+DV++SYS VG +M
Sbjct: 130 LYDVLVSYSTVGRIM 144

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  182 bits (463), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 110/140 (78%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           M+SFVT  D+P+GYVTP FPSLYWP+NN K++ ++LYY SDIW+F++YWTLI    FY +
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AG+ AS +HRK AG +WI   Y++ GG+Q + +GTV+G LI  IY++GLF+MSTWVPL C
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           A++QILF+V  SY M G ++
Sbjct: 121 ALMQILFNVSTSYLMAGVII 140

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  178 bits (451), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 104/140 (74%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           M+SFVT  D+P+GY TPKFPSL+WPINN +Y  ++LYY +DIWKF+++WTLI    FY  
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
           AG++AS++HRKKA  +WI   Y+L GG Q L  GTV G ++   Y++GLF MSTW+PLC 
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVV ILF V  +YSM G ++
Sbjct: 121 AVVLILFHVSTTYSMAGIII 140

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  174 bits (441), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 98/128 (76%), Gaps = 1/128 (0%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           MRSF+T ND+PVGY TP FPSLYWP   S+ +   +Y +S IWKF+LYW+LIFN  FY  
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
            G++AS +HRK+AG +WI  +Y  YGGVQG+  GT+ GFLIG IY SGLFSMSTW+P CC
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 AVVQILFD 128
           AV Q+L+D
Sbjct: 120 AVAQVLYD 127

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  172 bits (437), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 108/141 (76%), Gaps = 1/141 (0%)

Query: 1   MRS-FVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYV 59
           MRS F+T+ DIPVGY  P FPSLYWPI++ KY+ ++LY    IW+F++YW++I NG FY+
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60

Query: 60  TAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLC 119
            +G+ AS THRK+AG +WI V+Y+  G  QG+  GTV G+L+  IY SGLF+MSTW+PLC
Sbjct: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120

Query: 120 CAVVQILFDVVLSYSMVGSVM 140
           CA+ Q+LFD+  S+S+ G VM
Sbjct: 121 CAITQVLFDLCSSFSLGGMVM 141

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  159 bits (402), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 98/140 (70%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60
           M++F    D+PVGY  P FPSLYWP+NN K++ A+LYY+ DIW+F+++WT+I     Y T
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120
            G  A  TH+K     W+  +Y++ G  Q   +GTV+G LI  IY++GLF+MSTW+PLCC
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 AVVQILFDVVLSYSMVGSVM 140
           AVVQILF+V  SYSM   ++
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  111 bits (278), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 11  PVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYASLTHR 70
           P GY++P FPSL W  ++ + N A LYY  DI +F+++WTLI  G  Y   G+ A  +HR
Sbjct: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 71  KKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQILF 127
           +  G V I  +Y+L G +  +  GT  G +  AIYR+ L +MSTW+PL  AVVQ L+
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%)

Query: 57  FYVTAGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFL 100
           FY  AG++AS++HR+ AG +WI   YVL GG Q +  GTV G +
Sbjct: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {ON}
           Anc_5.298 YDR283C
          Length = 1668

 Score = 32.3 bits (72), Expect = 0.32,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 8/59 (13%)

Query: 1   MRSFVTNNDIPVGYVTPKFPSLYWP----INNSKYNTAFLYYISDIWKFSLYWTLIFNG 55
           M S   N  +P    T + P L W      NN+  N+A +Y  +DIW+  + +  I NG
Sbjct: 426 MLSSYPNKHLP----TSELPVLQWRPPELKNNTSTNSAKIYRTTDIWQLGVTFLQIING 480

>Skud_81.1 Chr81 complement(2..766) [765 bp, 255 aa] {ON} YCR038C
           (REAL)
          Length = 255

 Score = 31.2 bits (69), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/131 (19%), Positives = 50/131 (38%), Gaps = 15/131 (11%)

Query: 4   FVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGV 63
            +   +I +     +  S ++ +     + + L  ++  W+F + W    N     T  +
Sbjct: 91  LLIKRNIEIRRARKRLLSDWYRLGADTNHDSVLVVVNSAWRFLVVWRPFINSIQQATQEL 150

Query: 64  YASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVV 123
           +  + H            Y+LYG V       ++  ++G  Y   LFSM   V    A +
Sbjct: 151 FRKIAH------------YLLYGNVDIQRIAALIQIVMGQDY--LLFSMDE-VTQEIAKI 195

Query: 124 QILFDVVLSYS 134
           Q+  D +L + 
Sbjct: 196 QLYLDKMLPHD 206

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 3   SFVTNNDIPVGYVTPKF-PSLYWPIN-NSKYNTAFL 36
           S + NN I  G V PKF PS  WP+  N+  NT +L
Sbjct: 738 SLLLNNYIEYGIVNPKFLPSKSWPVGLNNIGNTCYL 773

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 64  YASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVV 123
           + S + R   G+V +FV+Y L+GGV   T+ ++  F  G  ++  L      +P+   V 
Sbjct: 332 FLSPSARGSLGTV-MFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVT 390

Query: 124 QILFDVVLSYSMVGSVM 140
            +L +  L Y+     M
Sbjct: 391 TVLLNFFLIYAKSSGAM 407

>Kpol_1023.45 s1023 (98232..99557) [1326 bp, 441 aa] {ON}
           (98232..99557) [1326 nt, 442 aa]
          Length = 441

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 44  KFSLYWTLIFNGAFYVTAGVYASLTHRKKAG 74
           +F +   L+ NGA  +  G Y +LT R KAG
Sbjct: 324 EFWILHGLVANGAVIIDEGAYKALTRRNKAG 354

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,258,617
Number of extensions: 638536
Number of successful extensions: 1784
Number of sequences better than 10.0: 40
Number of HSP's gapped: 1780
Number of HSP's successfully gapped: 40
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)