Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR152C (URN1)3.498ON46546521320.0
Smik_16.4043.498ON46046715830.0
Skud_16.4463.498ON45646115030.0
Suva_16.4803.498ON45245012811e-174
KAFR0G037203.498ON4094465584e-66
TPHA0A056903.498ON4784755339e-62
KNAG0A079703.498ON3883865242e-61
Kpol_480.113.498ON4634765223e-60
Kwal_47.188953.498ON4433755152e-59
KLTH0G02398g3.498ON4624614971e-56
SAKL0F02552g3.498ON4785034753e-53
TDEL0D056603.498ON4424614636e-52
CAGL0L08404g3.498ON4103584362e-48
NCAS0F035803.498ON4133644362e-48
ZYRO0D09768g3.498ON4602293472e-35
Ecym_12313.498ON3291563122e-31
AFR317C3.498ON3282232869e-28
NDAI0B059003.498ON5221762734e-25
KLLA0E03939g3.498ON4351702671e-24
TBLA0D029303.498ON2761701823e-14
TBLA0C009302.649ON658861242e-06
NCAS0C051102.649ON604821027e-04
CAGL0L05368g2.649ON59080980.002
Kpol_1073.42.649ON53080950.004
KNAG0M024702.649ON60628940.007
NDAI0G046002.649ON64796930.008
KAFR0A002302.649ON55628910.013
ZYRO0E00682g2.649ON57097910.017
TDEL0B074402.649ON57030900.019
KLLA0E18239g2.649ON57195900.020
Smik_11.2432.649ON57976900.020
YKL012W (PRP40)2.649ON58376880.033
ADR159C2.649ON56931820.20
Skud_11.2172.649ON58376820.21
Ecym_33972.649ON57550810.22
Kwal_14.9392.649ON56244780.51
TPHA0L020202.649ON58340780.52
Suva_11.2162.649ON58526780.53
TDEL0F009908.134ON78974741.9
CAGL0L06974g2.379ON27382722.2
KLLA0E13575g8.134ON81974732.3
ACL120W5.135ON16372702.3
KLTH0E06908g8.134ON79199732.4
Kwal_47.173028.134ON78799722.7
ADL055C8.134ON81774722.7
Ecym_83948.134ON84173713.7
CAGL0K02255g8.134ON82274713.8
SAKL0H24552g8.134ON790100713.9
KAFR0B021008.134ON800100714.0
YGL112C (TAF6)6.141ON516100714.0
Kpol_1031.398.134ON815100714.4
Suva_5.2468.134ON80974714.5
KNAG0D021808.134ON81174714.5
YER125W (RSP5)8.134ON80974714.6
ZYRO0G18920g8.134ON81974714.6
Smik_5.2718.134ON80874704.6
Skud_5.2538.134ON80974704.6
NCAS0B045408.134ON83574704.7
TBLA0G027908.134ON84474705.3
NDAI0B024608.134ON83674705.6
AGL226C6.356ON135875706.0
Ecym_25156.356ON136146706.2
Ecym_73775.135ON16364676.5
SAKL0G19360g2.649ON56897696.9
TPHA0D010308.134ON822100697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR152C
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   825   0.0  
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   614   0.0  
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   583   0.0  
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   498   e-174
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   219   4e-66
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   209   9e-62
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   206   2e-61
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   205   3e-60
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   202   2e-59
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   196   1e-56
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   187   3e-53
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   182   6e-52
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   172   2e-48
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   172   2e-48
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   138   2e-35
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   124   2e-31
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   114   9e-28
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   109   4e-25
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   107   1e-24
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    75   3e-14
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    52   2e-06
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    44   7e-04
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    42   0.002
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    41   0.004
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    41   0.007
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    40   0.008
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    40   0.013
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    40   0.017
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    39   0.019
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    39   0.020
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    39   0.020
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    39   0.033
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    36   0.20 
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    36   0.21 
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    36   0.22 
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    35   0.51 
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    35   0.52 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    35   0.53 
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    33   1.9  
CAGL0L06974g Chr12 complement(784296..785117) [822 bp, 273 aa] {...    32   2.2  
KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} high...    33   2.3  
ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic hom...    32   2.3  
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    33   2.4  
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    32   2.7  
ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON} S...    32   2.7  
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    32   3.7  
CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa] ...    32   3.8  
SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} high...    32   3.9  
KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.1...    32   4.0  
YGL112C Chr7 complement(298178..299728) [1551 bp, 516 aa] {ON}  ...    32   4.0  
Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON} (93761....    32   4.4  
Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W ...    32   4.5  
KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {O...    32   4.5  
YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3 ubi...    32   4.6  
ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} high...    32   4.6  
Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W ...    32   4.6  
Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON...    32   4.6  
NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134     32   4.7  
TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.1...    32   5.3  
NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134     32   5.6  
AGL226C Chr7 complement(271523..275599) [4077 bp, 1358 aa] {ON} ...    32   6.0  
Ecym_2515 Chr2 (1003069..1007154) [4086 bp, 1361 aa] {ON} simila...    32   6.2  
Ecym_7377 Chr7 complement(784580..785071) [492 bp, 163 aa] {ON} ...    30   6.5  
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    31   6.9  
TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.1...    31   7.4  

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/465 (87%), Positives = 408/465 (87%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG
Sbjct: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE
Sbjct: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120

Query: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXX 180
           DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSG    
Sbjct: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDE 180

Query: 181 XXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKK 240
                       QIVNQDIS              ERNIFFELFDRYKLDKFSTWSLQSKK
Sbjct: 181 EEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFSTWSLQSKK 240

Query: 241 IENDPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYLAQI 300
           IENDPDFYKIRDDTVRESLFEEWCGERSGNATA              VLEPTKYHYLAQI
Sbjct: 241 IENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLAQI 300

Query: 301 VANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKE 360
           VANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKE
Sbjct: 301 VANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKE 360

Query: 361 IFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRCCVSPIV 420
           IFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPA             HRCCVSPIV
Sbjct: 361 IFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVSPIV 420

Query: 421 VTEPRYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINPE 465
           VTEPRYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINPE
Sbjct: 421 VTEPRYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINPE 465

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/467 (66%), Positives = 348/467 (74%), Gaps = 11/467 (2%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           M G WQEFKTP G+KYYYNK TKQS+WEKPNLKK S+LE +AK SQ ER PTF+LEL++G
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           WHLII NDGTKLYFN DSK FK+DI QE   +C +LIESLDK+KLVLLIG+ARGY+++EE
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXX 180
           DIDKI ES NEEI LFK+NQD  ER+ E  EEAG VKS L ESHTGL+SGYGSSS     
Sbjct: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEE 180

Query: 181 XXXXXXXXXXXXQIVNQDISXXXXXXXXXXX---XXXERNIFFELFDRYKLDKFSTWSLQ 237
                       Q VNQ++S                 ER++FF+L DRYKLDKFSTWSLQ
Sbjct: 181 EEEEEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQ 240

Query: 238 SKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYL 297
           SKKIENDP+FYKIRDDTVRE LFEEWC + S   +               VLEPTKYHYL
Sbjct: 241 SKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKES--------DSEDESNVLEPTKYHYL 292

Query: 298 AQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQ 357
           AQIVA AG IAPD IPQDIRK+QKALYKAY+IKEY+P KR+QD+FVSQLLFYYKTF+LEQ
Sbjct: 293 AQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQ 352

Query: 358 RKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRCCVS 417
           RK IF DCL DHERDF GA+ SLRQD +LI RWQ LL+ P              +RCCVS
Sbjct: 353 RKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVS 412

Query: 418 PIVVTEPRYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINP 464
            IVV +PRYYVVGILEKTVVWVRWLAAE  P SRFTP GAGN PINP
Sbjct: 413 AIVVADPRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINP 459

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/461 (62%), Positives = 338/461 (73%), Gaps = 6/461 (1%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
           WQEFKTPAG +YYYNK TKQS+WE P+ K  S+ E+  K  + ERKPTFSLEL++ WHL+
Sbjct: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61

Query: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124
           I NDGTK Y+N DSK FKN+ISQE DS+C +L+ESLDKEKLVLLIGVARGY MR+ED+DK
Sbjct: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVDK 121

Query: 125 ILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXXXXXX 184
           I ES NEEI+LFK+NQ+E  R DE +EE GDV  PL+E HTGL+SGYGSSS         
Sbjct: 122 IFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSS-EEEEEEEE 180

Query: 185 XXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKKIEND 244
                   Q +N+D +              ER +FF LFDRY+LDKFSTWSLQSKKIEND
Sbjct: 181 EEEEDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIEND 240

Query: 245 PDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYLAQIVANA 304
           PDFY I DD VRE  FEEWCG    ++ A              VLEPTKYHYLAQI+A A
Sbjct: 241 PDFYTIGDDAVREGFFEEWCGHEHSDSAA---AEASGSEDVGDVLEPTKYHYLAQILAKA 297

Query: 305 GTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCD 364
           GTI PD +PQDIRKQQK LYKAY+IKEY+PSKR+QDKFVSQLLFYYKTF LEQRKEIF D
Sbjct: 298 GTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQD 357

Query: 365 CLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRCCVSPIVVTEP 424
           CLRDHERDF GAV+S+R++  LI +WQ +L+APA             +RC +  +V  +P
Sbjct: 358 CLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNI--VVAADP 415

Query: 425 RYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINPE 465
           RYYVVGIL+KT+VWVRWLAAE  PS RFTP GAG+ PI+PE
Sbjct: 416 RYYVVGILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISPE 456

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  498 bits (1281), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/450 (58%), Positives = 314/450 (69%), Gaps = 19/450 (4%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
           WQEFKTPAGK+Y+YNKNTK+SRW+KP+ KK S  +  AK +Q ERKP F+LEL++ WHLI
Sbjct: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66

Query: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124
           I NDGTK Y+N +S   K +I +E   +C +L+ SLDKEKL+LLIGVARGY +REED++K
Sbjct: 67  ICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVEK 126

Query: 125 ILESCNEEIHLFKRNQDEV--ERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXXXX 182
           I ES NEEI LFK+NQ  V  E+ DE +EEAGD ++P Q +  GLVSGYGSSS       
Sbjct: 127 IFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSS------- 179

Query: 183 XXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKKIE 242
                     +  N D                ER +FF+L DRY+LDKFSTWSLQ KKIE
Sbjct: 180 ---EEEEEEEEPENDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIE 236

Query: 243 NDPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYLAQIVA 302
           NDPDFYK+ D  VRESLFEEWC   S +A+               +LEPTK+HYLAQIVA
Sbjct: 237 NDPDFYKVGDAAVRESLFEEWCASASASASG----NESEDEDDADLLEPTKFHYLAQIVA 292

Query: 303 NAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIF 362
            A  IAPD IPQDIRKQQKAL+KAY+IKEY+PSKRDQD+FVSQLLFYYKTF LEQRKEIF
Sbjct: 293 KA-EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351

Query: 363 CDCLRDHERDFTGAVESLRQDKELIDRWQTLLK-APAXXXXXXXXXXXXXHRCCVSPIVV 421
            +CLRDHERDF  AV+SLRQD  LI RWQ +L+   A             HRC V  I +
Sbjct: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411

Query: 422 TEPRYYVVGILEKTVVWVRWLAAE-VGPSS 450
            +PRYYV+GIL+KT  WVRWLAAE V P++
Sbjct: 412 ADPRYYVLGILDKTAGWVRWLAAEGVDPAA 441

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  219 bits (558), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 228/446 (51%), Gaps = 50/446 (11%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           M   W+E++ P GKKYYYN  TK++ WEKP   K   +E           P F + L+N 
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEAAKREEIE-----------PVFVIRLMND 49

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           W L+I N+G K Y  D+  E   ++S E+  R   LIE  DKEKLV LIG+ARGY +  E
Sbjct: 50  WKLVICNNGMKYYL-DNENEPTKELSDEESLR---LIELFDKEKLVCLIGIARGYAI--E 103

Query: 121 DIDKILESCNEEIHLFK---RNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGX 177
           +++KI  +  EE+   K   +N+ E  +K+  SE    V    ++    LV G    S  
Sbjct: 104 NVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEG--YDSSE 161

Query: 178 XXXXXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQ 237
                           + ++ +S              ++  F ELFDRY LDKFS WS++
Sbjct: 162 SEEEEEEEDDYEFLNNVADEGLSG-------------DKAKFMELFDRYGLDKFSEWSME 208

Query: 238 SKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATA--XXXXXXXXXXXXXXVLEPTKYH 295
             K+  DPDFY + DD  RE LFE WC  +  ++T+                 LEPTK+H
Sbjct: 209 MNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLEPTKFH 268

Query: 296 YLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTF-D 354
           YL+QIV+ +  I   TI QDI++Q K L+K YKIK++I S ++Q+KFVS+LLFYYKTF  
Sbjct: 269 YLSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQ 327

Query: 355 LEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRC 414
           +E R + F D LR+   ++T ++  +    E I R  T                     C
Sbjct: 328 VEDRTKQFNDFLREKNANYT-SMSDMNTLSEHIKRNDTYAIETTLLQI----------EC 376

Query: 415 CVSPIVVTEPRYYVVGILEKTVVWVR 440
                V+++ RYY++ + +KT+  V+
Sbjct: 377 NFPQDVLSDVRYYILDLKQKTIELVK 402

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  209 bits (533), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 228/475 (48%), Gaps = 59/475 (12%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNA-KESQTERKPTFSLELVNGWHL 63
           W+EF  P G+KYYYN  TK++ W++P     S  E NA  + Q +  P F+  L N W+L
Sbjct: 6   WKEFIAPNGQKYYYNLKTKKTTWDEPE----SLFEGNAVSQGQKDESPVFAFPLFNDWYL 61

Query: 64  IIYNDGTKLYFNDDSKEFKN-DISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMRE--- 119
           +I + G K YFN      +N  + +  D     L++S+DK+KL+LL+GVARG+   E   
Sbjct: 62  VISSLGKKFYFN----AVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQ 117

Query: 120 --EDIDKILESCNEEI-HLFKRNQDEVERKDEISEEAGDVKSP--LQESHTGLVSGYGSS 174
             E+I + L+    EI + +K  Q  V ++   SEE+ D + P  L  +  G+V+ Y SS
Sbjct: 118 VYEEIMENLDFVKNEISNEYKELQVNVAQE---SEESADKQDPGDLIATDNGIVNDYYSS 174

Query: 175 SGXXXXXXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNI--------------FF 220
           S                 +   Q                 E N+              +F
Sbjct: 175 SDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYF 234

Query: 221 ELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXX 280
           +LF++Y+L+ FSTWS QSK + +DPDFY I D+++RE +FEEWC  +  +  +       
Sbjct: 235 QLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKD 294

Query: 281 XXXXXXXV---------------------LEPTKYHYLAQIVANAGTIAPDTIPQDIRKQ 319
                                        LEPTKYHYL+ I++ A  I+PDTI QDI+K 
Sbjct: 295 DQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN-ISPDTIFQDIKKD 353

Query: 320 QKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVES 379
            K L+K +KI ++I SKRD + F S+L+FYYK FD  QR++IF   L  ++      V  
Sbjct: 354 NKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV-- 411

Query: 380 LRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRCCVSPIVVTEPRYYVVGILEK 434
           +    ++++   T +                         +  +P+YY++GI +K
Sbjct: 412 VEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK 466

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  206 bits (524), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/386 (35%), Positives = 198/386 (51%), Gaps = 58/386 (15%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           M+  W+E++ P GKKYY+N  T ++ W+ P  +K         + +   KP + + L+N 
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRK--------PQRELSIKPQYVIPLLNA 52

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           W+L+I N+G K Y N D     + +   DD+    L+  +D+EKL+LLIGVARGY     
Sbjct: 53  WNLVICNNGAKFYLNPDG----DPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSG 108

Query: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXX 180
           D  K+  S  EEI   K   D    K  ++EE    + PL+   T + S    S+     
Sbjct: 109 D--KVYNSVLEEISFLK--DDLANDKAPLAEERELQEEPLE---TNVQSEPVPSALVSGY 161

Query: 181 XXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKK 240
                          + D +               R  +F LF  Y LDK+S WS++S K
Sbjct: 162 GSSSDGSDDEEEVPPDTDAN---------------RISYFNLFSEYGLDKYSVWSIESLK 206

Query: 241 IENDPDFYKIRDDTVRESLFEEWC-------GERSGNATAXXXXXXXXXXXXXXVLEPTK 293
           I NDP F+ I DD  RE +FEEWC        E  G ++                L PTK
Sbjct: 207 ISNDPRFHIISDDRQREEIFEEWCCSGVVDDSEDEGYSSGDDD------------LSPTK 254

Query: 294 YHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTF 353
           YHYL+QIVA + T+ P TI QDI++++ +L+K Y IK+++ SKR+Q++FVSQLLFYYK F
Sbjct: 255 YHYLSQIVAKS-TVTPTTIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKF 312

Query: 354 DLEQRKEIFCDCLRDHERDFTGAVES 379
            LE+R ++F   + +     TG V S
Sbjct: 313 TLEERVQLFTKFIAESR---TGTVPS 335

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  205 bits (522), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 144/476 (30%), Positives = 236/476 (49%), Gaps = 52/476 (10%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
           W+EF  P G+KYYYN  +K+S W KP+     + E     S     P F   L+NGWHLI
Sbjct: 6   WKEFNAPDGRKYYYNIKSKESTWTKPD--SLYDTEKGKVGSDRAGAPLFVFPLLNGWHLI 63

Query: 65  IYNDGTKLYFNDDSKEFKNDISQE--DDSRCRSLIESLDKEKLVLLIGVARGYTMREEDI 122
           I   G K Y+N   K   + IS+E  DDS  + L+ ++DK+KL+LLI VARGY     D 
Sbjct: 64  ICVGGEKYYYN---KVLNDTISKELSDDSSLQ-LLNAVDKDKLILLIAVARGYNW--PDY 117

Query: 123 DKILESCNEEIHLFKRNQDEVERKDEIS----------EEAGDVKSPLQESHTGLVSGY- 171
           +K+ +   +E  L   +  + ++ +  S           + G+V +    S+TGL+ GY 
Sbjct: 118 EKLYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAV---SNTGLIGGYL 174

Query: 172 ----------GSSSGXXXXXXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERN--IF 219
                                            V+++++              E++  +F
Sbjct: 175 SSDDEESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSKSLF 234

Query: 220 FELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWC-----GERSGNATAX 274
             LF+ ++LD +S+W LQ KKI+N PD+++I D++ RE LFE WC     G +S      
Sbjct: 235 TRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFE 294

Query: 275 XXXXXXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIP 334
                          EPTK+HYLA I++ A  IA DTI  DI++  K+L+K +KIK++I 
Sbjct: 295 GEDEETLTSDEEDDFEPTKFHYLAHIISKAD-IAADTIFLDIKENNKSLFKEFKIKDFIK 353

Query: 335 SKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLL 394
           SK+DQ+ F S+LLF+YK F L +RK +F   L+++E      + ++  + E++   + ++
Sbjct: 354 SKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENE---NLIIPNINSNIEIV---RHII 407

Query: 395 KAPAXXXXXXXXXXXXXHRCC-VSPIVV---TEPRYYVVGILEKTVVWVRWLAAEV 446
           K                 +   +  ++V    +P+YY++GI +K ++   +L  ++
Sbjct: 408 KNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYLKDKI 463

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  202 bits (515), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 192/375 (51%), Gaps = 28/375 (7%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           M  +W+E+KTP G KYYYN NTK+S +E P+     +  S  K  + + KP F+L L N 
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFND 59

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           W LII N G + ++N +S   + D+   DD     L+  LD+EKLVLL+GVA+G+   + 
Sbjct: 60  WALIICNTGLRFFYNSESHTSRWDL---DDEASLELLAKLDREKLVLLVGVAKGFDPGDR 116

Query: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXX 180
           ++    +  ++ I   K + +  + + E +EE+     P Q     LVSGYGSS      
Sbjct: 117 NV---YQELSDSISELKEDSNNRDFRKETAEESIPTAVPGQ----SLVSGYGSSDESDKD 169

Query: 181 XXXXX--------XXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFS 232
                                + + D+                   F  LF +Y +D +S
Sbjct: 170 EDEEEEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAE--FISLFSKYAVDPYS 227

Query: 233 TWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGN-----ATAXXXXXXXXXXXXXX 287
           TW++QS+KI +DP FYKI +D  R+ LFE WC     N     A                
Sbjct: 228 TWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAID 287

Query: 288 VLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLL 347
            LEP++YHYLA IV+ +  I   T+P+DIR  QK L+K ++IK+ + SKR+QD F+S+LL
Sbjct: 288 SLEPSRYHYLAHIVSKSK-ITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLL 345

Query: 348 FYYKTFDLEQRKEIF 362
           FYYK    EQR  IF
Sbjct: 346 FYYKRMTPEQRIAIF 360

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/461 (30%), Positives = 224/461 (48%), Gaps = 27/461 (5%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPN-LKKGSNLESNAKESQTERKPTFSLELVNGWHL 63
           W+E+KTP G KYYYN NTK+S  +KP+  ++  +  S ++  + +   TF + L N W L
Sbjct: 10  WREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSR--RVDPGVTFVVPLSNDWVL 67

Query: 64  IIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDI- 122
            +  +G + ++   ++E + DI  E+  R  SL+   DK KLVLL+  ARG+ + E D+ 
Sbjct: 68  SVCENGQRFFYKSSTEESRWDIEDEESLRILSLV---DKNKLVLLLATARGFDIGERDVY 124

Query: 123 DKILESCN--EEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTG---LVSGYGSSSGX 177
            ++LE  N  ++        + +E  +E S  AG+  +  +E       L+S Y SS   
Sbjct: 125 QELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYESSDED 184

Query: 178 XXXXXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQ 237
                               +                 + +F  LFD Y LD +STW++Q
Sbjct: 185 GDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYSTWNMQ 244

Query: 238 SKKIENDPDFYKIRDDTVRESLFEEWCG---------ERSGNATAXXXXXXXXXXXXXXV 288
           SKKI ++P FY++  D  R  LFE+WC          E   +                  
Sbjct: 245 SKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDDTSTDE 304

Query: 289 LEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLF 348
           LEPT+YHYLA IV+ A  +AP T+P+D+R +QK L+K +KIKE +  K+ QD+F+S+LLF
Sbjct: 305 LEPTRYHYLAHIVSKA-EVAPSTLPRDLRSEQKQLFKQFKIKESL-GKKQQDEFLSKLLF 362

Query: 349 YYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXX 408
           YYK    EQR E+    L+   +       ++ Q + ++ + Q L  +            
Sbjct: 363 YYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQ-QDLPTSGFAIESQLLRLE 421

Query: 409 XXXHRCCVSPIVVTEPRYYVVGILEKTVV---WVRWLAAEV 446
                  VS  +  E +YYV+GI +KT     +++ L +EV
Sbjct: 422 DCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLKQLNSEV 462

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  187 bits (475), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 157/503 (31%), Positives = 225/503 (44%), Gaps = 90/503 (17%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
           M   W EF TP+G KYYYN  TKQS  EKP    G + + + K  + + KP + + L  G
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKP---AGFDDQKSRKRQKLQHKPKYLVPLDKG 57

Query: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           W L++ N GTK Y N  + E    +   DD     L++ LDKEKLVLLIG++RGY     
Sbjct: 58  WSLVLCNTGTKFYHNKITNESHWTL---DDPCSIELLQQLDKEKLVLLIGISRGYYCPRR 114

Query: 121 DI------------DKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLV 168
           ++            DK LE    E  + + ++++VE   +  EE G           GLV
Sbjct: 115 NVYDEIINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQ-GEEQG----------LGLV 163

Query: 169 SGYGSSSGX--------------XXXXXXXXXXXXXXXQIVNQ-DISXXXXXXXXXXXXX 213
           +GYGSS                                + V+Q DI              
Sbjct: 164 TGYGSSDDSEDENIEEEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDA 223

Query: 214 XERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATA 273
             +N F  LFD+Y LD +S W  QS+KI  DPDFY + + + R+ LFE+WC E   N+  
Sbjct: 224 --KNRFTILFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKD 281

Query: 274 XXXXXXXXXXXXXXV---------------------------LEPTKYHYLAQIVANAGT 306
                                                     LEPT++HYL+ I++ + +
Sbjct: 282 AISDANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKS-S 340

Query: 307 IAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIF---- 362
           I   TI  DI+K+ KAL+K ++IK  +  K+DQ+ F S+LLFYYK  DLEQRK IF    
Sbjct: 341 IEQTTIFLDIKKENKALFKTFRIKSSL-KKKDQEDFASKLLFYYKRMDLEQRKLIFQKLL 399

Query: 363 ---CDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXXXHRCCVSPI 419
               D +R + R+    VE LR   ++     T   + A                 +S  
Sbjct: 400 LSKLDIIRSNLRN----VEKLR---DIATEQSTPADSYAIETQLLMMEDCMDIHGKLS-F 451

Query: 420 VVTEPRYYVVGILEKTVVWVRWL 442
           +  E  YY++GI +KT+   ++L
Sbjct: 452 LQGEVHYYILGIKDKTIQLKQFL 474

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  182 bits (463), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 223/461 (48%), Gaps = 42/461 (9%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPN--LKKGSNLESNAKESQTERKPTFSLELVNGWH 62
           W  F  P+G+KYYYN  TK+S W++P    + G N          E +P +++ LVN W 
Sbjct: 5   WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR---EPEPFYAIPLVNDWF 61

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDI 122
           L+I + G K YF+  ++E    +   +D     L+ ++DK K+  ++ VA          
Sbjct: 62  LVIDDIGGKYYFDSSTEEASWTL---EDPESAELLSTIDKNKI--ILLVAIARGYNTNVG 116

Query: 123 DKILESCNEEIHLFKRNQ----DEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXX 178
           D++ +   +++   ++      +  +  ++ SE         ++  +GL++GY SS    
Sbjct: 117 DRVYQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSE--- 173

Query: 179 XXXXXXXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQS 238
                          + + D+                RN FF+L  R++ D +STWS+Q+
Sbjct: 174 EEENEIDSDVEKLNNLGDDDLPKENHEDESQI-----RNDFFQLLQRHQCDPYSTWSIQA 228

Query: 239 KKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAX--------XXXXXXXXXXXXXVLE 290
           +KI+ DP FY+I DD++RES+FEEWC E++ N T                        LE
Sbjct: 229 RKIQEDPLFYRITDDSIRESMFEEWC-EKAINRTTNPQDLVDEDNLDDDSREEEEEDELE 287

Query: 291 PTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYY 350
           P  +HYLA IV+ A  I P TI QDI+ Q KA +K YKIK+++ SK  Q+ FVS+LLFYY
Sbjct: 288 PLPFHYLAHIVSKAN-ITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYY 346

Query: 351 KTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPAXXXXXXXXXXXX 410
           K F L++RKEIF D L  H R      ++L Q+ E +    TL +               
Sbjct: 347 KKFTLDERKEIFHDLLESHSRSIK---KNLEQESESMR--STLSEEAGSNDAYAIETKLL 401

Query: 411 XHRCCVSPI-----VVTEPRYYVVGILEKTVVWVRWLAAEV 446
                +        +  +P+YYV+GI +K +  + +L + +
Sbjct: 402 KMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTSYI 442

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  172 bits (436), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 196/358 (54%), Gaps = 24/358 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
           W+E+  P G KYYYN  T+++ W KP+ ++    +    + + E KP  + EL+ GW LI
Sbjct: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQ----KDETADKEIEIKPLVAFELLAGWALI 64

Query: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124
           I++DG+K Y+N +  ++   IS  +   C  LI+ L+K++L+LLIG+ RGY  R    D 
Sbjct: 65  IFSDGSKKYYNCNESQWSRKISHPE---CLKLIDLLNKDRLLLLIGIIRGYRCRTNAKD- 120

Query: 125 ILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXXXXXX 184
           ++    E+I   + + +  +  +++  ++G   + L+ +   L+  Y S           
Sbjct: 121 LVNEIREDIDFIREDMNAAKTSEDM--KSGSTVNNLENTKNALLGYYSSDDEEEPAKRDE 178

Query: 185 XXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKKIEND 244
                   +    ++                ++ +F LF +++L+K+STW ++S+K+  D
Sbjct: 179 QAVVEEPDETNTLEVPDITQELGQDI-----KDSYFALFAKHELNKYSTWRIESEKVSQD 233

Query: 245 PDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYLAQIVANA 304
           P+FYKI DD VRE++FEEWC   S  +                  EPTKYHYL+Q+VAN 
Sbjct: 234 PEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQ------FEPTKYHYLSQLVANY 287

Query: 305 GTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIF 362
             + PDTIP+DI K +K + K Y+IK+Y  +K +Q +F+S++L +YK   LE RK++F
Sbjct: 288 D-LKPDTIPEDIIKDKKLI-KKYRIKDYT-TKSEQRQFLSKMLAWYKHMSLEDRKQMF 342

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  172 bits (436), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 177/364 (48%), Gaps = 40/364 (10%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
           W+E+K P G+KYYYN  TK++ W KP       +E    E    ++  F+ EL +GW+L+
Sbjct: 7   WREYKAPNGRKYYYNVKTKETTWTKP-------VEEEKPEPGDNKEVKFAFELFDGWYLL 59

Query: 65  IYNDGTKLYFND-DSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDID 123
           I  DG KL+++  + K +    +++       +IE +DKEK++LLIG+ RG+      I 
Sbjct: 60  IRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIK 119

Query: 124 KILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGXXXXXXX 183
            + +   ++I+  K+         EI  +A +++    E+         +          
Sbjct: 120 GVYDDIAQDINFLKQ---------EILNDAMELERLNAEAEEEESEKEEALPQEEQDDHT 170

Query: 184 XXXXXXXXXQIVNQDISXXXXXXXXXXXXXXERNIFFELFDRYKLDKFSTWSLQSKKIEN 243
                    +   QD+                ++  F LF+ + LD +STWSLQS+KI N
Sbjct: 171 VELLNNLEEEEEEQDV----------------KDRLFHLFESFNLDVYSTWSLQSRKISN 214

Query: 244 DPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXXXXXXXXXXXVLEPTKYHYLAQIVAN 303
             D++ + DDT RE +FE+WC      A                  EPTKYHYL++I+  
Sbjct: 215 QADYFLVHDDTQREEMFEDWC------AMKVAQLPEDESEAEDDDYEPTKYHYLSEIMYQ 268

Query: 304 A-GTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIF 362
               I  DT+  DI +  + L+K Y IK++IP +R+    VS+LLFYYK F   +R+ +F
Sbjct: 269 LRDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVF 328

Query: 363 CDCL 366
            D +
Sbjct: 329 HDYV 332

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 122/229 (53%), Gaps = 14/229 (6%)

Query: 215 ERNIFFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGER-SGNATA 273
           ++   ++LF RY L+ +S W  + KKI +DPDF ++ DD+VRE +FEEWC    SG+   
Sbjct: 229 DKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVE 288

Query: 274 XXXXXXXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYI 333
                          LEPTKYHYLA IV+ +  I P TI  DI+   K+ +K Y IK+++
Sbjct: 289 PVDEIKSEDFDEEEDLEPTKYHYLAHIVSKS-NITPTTIFMDIKNDNKSSFKKYNIKDFL 347

Query: 334 PSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTL 393
            SK+DQ+ FVS+LLFYYK   LE+RKE+F   L+ + +      E+L  D   +D+ +  
Sbjct: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSND---MDKVRHC 401

Query: 394 LKA------PAXXXXXXXXXXXXXHRCCVSPIVVTEPRYYVVGILEKTV 436
           L        P                      +V EP+YY++GI +K +
Sbjct: 402 LAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKP-NLKKGSNLESNAKESQTERKPTFSLELVNGWHL 63
           W+E+  P G+KYYYN  TKQS W KP +L +        +  + E KP  +LEL +GWHL
Sbjct: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64

Query: 64  IIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYT 116
           +I + G K Y+N ++ E   ++    D   R+LI++LDK KLV LIG+ARGY+
Sbjct: 65  VICDTGKKFYYNVETNESAWNLP---DEGSRNLIDALDKNKLVALIGLARGYS 114

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  124 bits (312), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 94/156 (60%), Gaps = 10/156 (6%)

Query: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWC--------GERSGN 270
           F  LFDRY+L+ +S+WSLQS+K+++DP+FY + DD  R  LFE+WC        G+ S +
Sbjct: 90  FIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSSAS 149

Query: 271 ATAXXXXXXXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIK 330
            T                LEP K+HYL+ IV+ + TI P T+  D++ + K L+K + I 
Sbjct: 150 LTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTENKLLFKNFNID 208

Query: 331 EYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCL 366
           E  P K++Q +FVS LLFYYK    ++R EIF + L
Sbjct: 209 ETHP-KQEQRQFVSSLLFYYKKKSSKERVEIFKNLL 243

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  114 bits (286), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 114/223 (51%), Gaps = 13/223 (5%)

Query: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGER---SGNATAXX 275
            + LF+R +LD +S W  +S KI  D  FY + DD  R+ LFE+WC  +    GNA    
Sbjct: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAV--- 156

Query: 276 XXXXXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPS 335
                        L PT++HYLA IV+ + T+ PDT+  D+R++ K L+   ++   I  
Sbjct: 157 --LEDGEEAEEVELVPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILD 211

Query: 336 KRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGA-VESLRQDKELIDRWQTLL 394
           K++Q +FV+ LLFYYK  D   R E+F   L  H    T A +E+  Q +EL++  +   
Sbjct: 212 KKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELPQ 271

Query: 395 KAPAXXXXXXXXXXXXXHRCCVSPIVVTEPRYYVVGILEKTVV 437
            + +                 +S +  +E +YYV+G+ +K VV
Sbjct: 272 DSYSIETDLFIVEKCIGLHGALSKL-QSEIKYYVLGVKDKLVV 313

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKE 44
          W+  K+  GK YYYN  T ++ W+KP+  + S+ E    E
Sbjct: 3  WKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDE 42

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  109 bits (273), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 96/176 (54%), Gaps = 22/176 (12%)

Query: 216 RNIFFELFDRYKLDKFSTWSLQSKKIENDPD-FYKIRDDTVRESLFEEWCGERSGNATAX 274
           +  FFEL D+ KLD +STWS+QS++I   P  FY I +D+ RE +FE+WC  R  +    
Sbjct: 256 KQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLY 315

Query: 275 XXXXXXXXXXXXXV--------------------LEPTKYHYLAQIVANA-GTIAPDTIP 313
                        V                    LEPTKYHYL++++     +I   +I 
Sbjct: 316 SSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIF 375

Query: 314 QDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDH 369
           QDI++Q K+L+K Y+IK++IP K++ +K VS LLFYYK    ++R + F + +  H
Sbjct: 376 QDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKH 431

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 80/141 (56%), Gaps = 6/141 (4%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKP-NLKKGSNLESNAK---ESQTERKPTFSLELVNG 60
           W+E+KTP GKKYYYN  TKQS WEKP +  K +   SN K   ++  E +  F+ +L+N 
Sbjct: 12  WKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLLNE 71

Query: 61  WHLIIYNDGTKLYFNDDSKE--FKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMR 118
           W+LI+ +DG+K Y+N  S     K    +ED+     L++ LDK  L+ LIG+ RGY   
Sbjct: 72  WYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYNDP 131

Query: 119 EEDIDKILESCNEEIHLFKRN 139
             DI  + E     I   K++
Sbjct: 132 SIDIKGLYEEIVANIGFLKQD 152

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  107 bits (267), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 97/170 (57%), Gaps = 9/170 (5%)

Query: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGER------SGNAT 272
           F +L +  +LD +STWS+Q+K+I +DP +Y I  +  R+ LF+ WC ++           
Sbjct: 206 FIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDNENN 265

Query: 273 AXXXXXXXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEY 332
           A               LEPTKYHYLA I++ A  I P+T+  +I+K+ K+L+K  +I + 
Sbjct: 266 AQDSAENSDEEDSDVTLEPTKYHYLAHIISKAN-ITPETLFSNIKKENKSLFKELEINKT 324

Query: 333 IPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQ 382
           + +K++Q++F S+++ YYK  D  QR E+F   +++  R F    E L Q
Sbjct: 325 L-TKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNKLR-FPPISEKLSQ 372

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 70/120 (58%), Gaps = 12/120 (10%)

Query: 3   GEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWH 62
            EW+ FK P+G  YY+N  +K S  EKP  K+  + ++  KE    R P F L L N W+
Sbjct: 2   SEWKRFKDPSGNFYYFNTRSKVSTKEKP--KEFGSQQAGMKEL---RVPVFCLPLRNYWN 56

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQ--EDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120
           L+I  DG+K + ND+S     ++SQ    D   ++L++ +D   L LLIGVARG+ +R +
Sbjct: 57  LVICKDGSKFFHNDES-----NVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRND 111

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 81/170 (47%), Gaps = 12/170 (7%)

Query: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAXXXXX 278
           FFEL DR  +D +S W L++KKI +DP FY I  D  RE LFE+WC              
Sbjct: 75  FFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWC--------YGKLHS 126

Query: 279 XXXXXXXXXVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRD 338
                    +     YH LA+++     I  +TI +DIRK  K + +  +I E I SK +
Sbjct: 127 REEETTQPQLALALPYHDLAEMIC-CFDIQSNTIYKDIRKANKKMVR--QIDEKI-SKNE 182

Query: 339 QDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELID 388
           Q+KF ++LL   K  D    + +F   L ++  D      S     +L+D
Sbjct: 183 QEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVD 232

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 1  MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSN----LESNAKESQTERKPTFSLE 56
          M  +W++ K P G+ YYYN  TK+SRW+ P    G+N     E      + E K    LE
Sbjct: 1  MENDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLE 60

Query: 57 L--VNGWHLIIYNDGTKLYFNDDSKE 80
             ++GW      +G   Y+N D+KE
Sbjct: 61 FLKLHGWRTAQTKEGRIYYYNVDTKE 86

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 27/36 (75%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLES 40
           W+  +T  G+ YYYN +TK+SRW+ PNL K ++L++
Sbjct: 67  WRTAQTKEGRIYYYNVDTKESRWDPPNLPKNTSLKN 102

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+  K   G+ YYYN NTK+SRW++P   +GS        +  +      LE + GW   
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGS--------TNNDDSDKMLLEQI-GWKSN 61

Query: 65 IYNDGTKLYFNDDSKEFKNDIS 86
          + N+G   Y+N  + E + D++
Sbjct: 62 VTNEGKVYYYNLKTGESRWDVN 83

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 15/80 (18%)

Query: 1  MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
          M G+W++     GK YYYN  TK+SRW+KP ++  ++L+   +++              G
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKP-VEDTTDLKQKLRDA--------------G 45

Query: 61 WHLIIYNDGTKLYFNDDSKE 80
          W++    +G   Y+N  +KE
Sbjct: 46 WNVAKTKEGKVYYYNVKTKE 65

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGS 36
          W   KT  GK YYYN  TK+SRW+ P  +K +
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNPLAEKAT 77

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 15/80 (18%)

Query: 1  MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60
          M   W+E K   G+ YYYN  T +SRWEKP       +E+ +K+ Q  +K        NG
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKP-------VEAPSKQEQLLKK--------NG 45

Query: 61 WHLIIYNDGTKLYFNDDSKE 80
          W +     G   Y+N  + E
Sbjct: 46 WSIGKSKAGKIYYYNTKTGE 65

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 23/28 (82%)

Query: 3  GEWQEFKTPAGKKYYYNKNTKQSRWEKP 30
          G+W++ + P G+ YY+N+ T++S+WEKP
Sbjct: 2  GKWEQARDPQGRVYYFNRETRKSQWEKP 29

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLE 56
           ++G W+  KT  GK Y+YN  T +S W  P    G  LE   KE+ T   P  ++E
Sbjct: 62  VKGTWKSAKTKDGKVYFYNSATGKSSWTLP---AGVQLEVAPKETATTESPRGAVE 114

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 12/96 (12%)

Query: 3   GEWQEFKTPAGKKYYYNKNTKQSRWEKP------------NLKKGSNLESNAKESQTERK 50
            +W+  K   G+ YYYN  TK+S+WEKP             ++  +   +NAK +    K
Sbjct: 12  NQWRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIEK 71

Query: 51  PTFSLELVNGWHLIIYNDGTKLYFNDDSKEFKNDIS 86
              S+    GW   +  DG   Y+N  + E + DIS
Sbjct: 72  DDASIMENIGWKSNVTADGKTYYYNLKTGESRWDIS 107

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 3  GEWQEFKTPAGKKYYYNKNTKQSRWEKP 30
          G+W+  K P G+ YYYN  TK+S WEKP
Sbjct: 2  GDWKAAKDPKGRIYYYNTVTKKSTWEKP 29

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 25/97 (25%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+E K  +G+ YYYN  T +S+WEKP            +E  +E++   +    +GW   
Sbjct: 7  WKEAKDTSGRIYYYNAKTGESKWEKP------------RELLSEQELILA---KHGWKSS 51

Query: 65 IYNDGTKLYFNDDSK----------EFKNDISQEDDS 91
            +DG   Y+N  +K          EFK ++ +ED +
Sbjct: 52 KTSDGKLYYYNAQTKTSRWELPDLPEFKKEVKKEDTT 88

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 1  MRGEWQEFKTPAGKKYYYNKNTKQSRWEKP 30
          ++  W+  +T  GK YYYN  TK+SRWEKP
Sbjct: 44 LKHGWKSSRTAEGKIYYYNSITKESRWEKP 73

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 15/78 (19%)

Query: 3  GEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWH 62
           EW+E     G+ YYYN    +SRWEKP            +E  TE +      L +GW 
Sbjct: 5  SEWKEALDDKGRTYYYNAKNGESRWEKP------------QELFTEEELVL---LKHGWK 49

Query: 63 LIIYNDGTKLYFNDDSKE 80
               +G   Y+N  +KE
Sbjct: 50 SSRTAEGKIYYYNSITKE 67

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 25/95 (26%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVN-GWHL 63
          WQE K P G+ YYYN +T Q+ WEKP            +E  TE    F  +L+  GW  
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKP------------EELFTE----FERKLLKYGWKT 45

Query: 64 IIYNDGTKLYFNDDSKE-------FKNDISQEDDS 91
           +  DG   Y+  D+ E       F+ND ++++ S
Sbjct: 46 ALAEDGRVYYYKSDTGETTWNVPVFENDDNRDERS 80

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+E K   G+ YYYN  TK+S WEKP        E  ++E Q  R+        NGW   
Sbjct: 4  WKEAKDANGRVYYYNSLTKKSTWEKPK-------ELVSEEEQLLRE--------NGWRAA 48

Query: 65 IYNDGTKLYFNDDSKE 80
             +G   Y+N  ++E
Sbjct: 49 KTKEGKVYYYNPATRE 64

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKK 34
          W+  KT  GK YYYN  T+++ W  P  +K
Sbjct: 45 WRAAKTKEGKVYYYNPATRETSWTIPVFEK 74

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+E K  +G+ YYYN  TK+S WEKP        E  ++E    R+        NGW   
Sbjct: 4  WKEAKDASGRIYYYNTLTKKSTWEKPK-------ELISQEELLLRE--------NGWKAA 48

Query: 65 IYNDGTKLYFNDDSKE 80
             DG   Y+N  ++E
Sbjct: 49 KTADGKVYYYNPTTRE 64

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKK 34
          W+  KT  GK YYYN  T+++ W  P  +K
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIPAFEK 74

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKG 35
          W+   T  G  YYYN+ T +SRWEKP L+  
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPELEPA 74

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 16/78 (20%)

Query: 3  GEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWH 62
           +W+E +   G+ YYYN   + S W KPN      LE   +E               GW 
Sbjct: 2  SDWKEAQDSTGRVYYYNSKGETS-WNKPN-DTPVELEPRLEEC--------------GWK 45

Query: 63 LIIYNDGTKLYFNDDSKE 80
          +    DG   Y+N ++ E
Sbjct: 46 VATTEDGNVYYYNRETGE 63

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+E K   G+ YYYN  TK+S WEKP     + L S  ++   E          NGW   
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKP-----TQLVSKQEQLLQE----------NGWRAA 48

Query: 65 IYNDGTKLYFNDDSKE 80
             +G   Y+N  +++
Sbjct: 49 KTAEGKVYYYNTTTRK 64

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 1  MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERK 50
          ++  W+   T  GK YYYNKNT +S WE P +++    E   K  + + K
Sbjct: 40 LKQGWKVASTEDGKVYYYNKNTNESTWELPVVREEKKDEGGEKNEEGKEK 89

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTE 48
          W+  +T  GK YYYN+++ +SRWE P        ES+ KE   E
Sbjct: 45 WKTGETEGGKLYYYNESSGESRWEVP------TFESDEKEEAVE 82

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 3  GEWQEFKTPAGKKYYYNKNTKQSRWEKP 30
          G W E   P G+ YYYN  + ++ W+KP
Sbjct: 2  GNWNEAHDPEGRVYYYNSESGETTWDKP 29

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKE 44
          W   +T  GK YYYN +T +SRWE P  +  +   S  K+
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAPKFEDATTEVSRGKK 85

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 17/76 (22%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+  K   GK YYYN  T  S+WEKP +   +++E+  +               +GW + 
Sbjct: 7  WRTAKDSNGKVYYYNTKTGVSQWEKPGV--SADIETLKQ---------------HGWGVA 49

Query: 65 IYNDGTKLYFNDDSKE 80
             DG   Y+N  + E
Sbjct: 50 RTKDGKLYYYNSSTGE 65

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKP 30
          W+E K   G+ YYYN  TK+S WEKP
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKP 29

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGS 36
          W+  KT  GK YYYN +T+Q+ W  P   K +
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAFDKKT 76

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    S T +++P   L  L +GW 
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPASTTIQQQPVSQLGPLPSGWE 374

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 375 MRLTNTA-RVYFVD 387

>CAGL0L06974g Chr12 complement(784296..785117) [822 bp, 273 aa] {ON}
           highly similar to uniprot|Q07505 Saccharomyces
           cerevisiae YDL086w
          Length = 273

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 35/82 (42%), Gaps = 12/82 (14%)

Query: 288 VLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLL 347
           V+ P  YH           I P+ +P D++     L   YKIK+ IPS  + +K    LL
Sbjct: 65  VVAPAIYHNF---------IGPEPLPYDVKGTD--LGNEYKIKKPIPSYDEDNKLCCDLL 113

Query: 348 FYYKTFDLEQRKEIFCDCLRDH 369
           +    FD  +R      CL  H
Sbjct: 114 YSLPQFD-GKRIGATGMCLGGH 134

>KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPSTNTIQQQPVSQLGPLPSGWE 404

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 405 MRLTNTA-RVYFVD 417

>ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJR017C (ESS1)
          Length = 163

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 10/72 (13%)

Query: 1  MRGEWQ-EFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVN 59
          + G W  +F     ++YYYN  TK+S+WE P       L  +  E   +         V 
Sbjct: 7  LPGPWAVKFSKSRKREYYYNPETKESQWEVPADTDSEQLARHLAEHPVQ---------VR 57

Query: 60 GWHLIIYNDGTK 71
            HL+I + G++
Sbjct: 58 CLHLLIKHAGSR 69

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSL-ELVNGWHL 63
           W++  TP G+ Y+ + NT+ + W  P  ++       A  +  +++P   L  L +GW +
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN-TTIQQQPVSQLGPLPSGWEM 377

Query: 64  IIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
            + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 378 RLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 408

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSL-ELVNGWHL 63
           W++  TP G+ Y+ + NT+ + W  P  ++       A  +  +++P   L  L +GW +
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN-TTIQQQPVSQLGPLPSGWEM 373

Query: 64  IIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
            + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 374 RLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 404

>ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER125W
           (RSP5)
          Length = 817

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 345 WEQRYTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPSNNTIQQQPVSQLGPLPSGWE 402

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 403 MRLTNT-ARVYFVD 415

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSL-ELVNGWHL 63
           W++  TP G+ Y+ + NT+ + W  P  ++       A  +  +++P   L  L +GW +
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANNT-IQQQPVSQLGPLPSGWEM 427

Query: 64  IIYNDGTKLYFND 76
            + N   ++YF D
Sbjct: 428 RLTNTA-RVYFVD 439

>CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa]
           {ON} highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125w Ubiquitin--protein ligase
          Length = 822

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 407

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 408 MRLTNTA-RVYFVD 420

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNL-----KKGSNLESNAK-ESQTERKPTFSLELV 58
           W+      G+ YY + NT+ + W++P L     ++GS L +N + E +  R  T    + 
Sbjct: 250 WERRTDNFGRTYYVDHNTRTTTWKRPTLEQSEQERGSQLTANTELERRQHRGRTLPGNVT 309

Query: 59  NG 60
           +G
Sbjct: 310 DG 311

>SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 790

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 318 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 375

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
           + + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 376 MRLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 407

>KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.134
           YER125W
          Length = 800

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 328 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 385

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
           + + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 386 MRLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 417

>YGL112C Chr7 complement(298178..299728) [1551 bp, 516 aa] {ON}
           TAF6Subunit (60 kDa) of TFIID and SAGA complexes,
           involved in transcription initiation of RNA polymerase
           II and in chromatin modification, similar to histone H4
          Length = 516

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 16/100 (16%)

Query: 53  FSLELVNGWHLIIYN------DGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLV 106
           F L  +N W  +++N      D  + + NDDS   +   ++E+    + L++++    LV
Sbjct: 407 FFLGNLNNWARLVFNESGITLDNIEEHLNDDSNPTRTKFTKEE---TQILVDTVISALLV 463

Query: 107 LLIGV-----ARGYTMREEDIDKILESCNEEI--HLFKRN 139
           L   +      +G  + +ED +K+LE C   I  H+ KR+
Sbjct: 464 LKKDLPDLYEGKGEKVTDEDKEKLLERCGVTIGFHILKRD 503

>Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON}
           (93761..96208) [2448 nt, 816 aa]
          Length = 815

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 343 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 400

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
           + + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 401 MRLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 432

>Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W
           (REAL)
          Length = 809

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 394

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 395 MRLTNTA-RVYFVD 407

>KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {ON}
           Anc_8.134 YER125W
          Length = 811

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 339 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 396

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 397 MRLTNTA-RVYFVD 409

>YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3
           ubiquitin ligase of the NEDD4 family; involved in
           regulating many cellular processes including MVB
           sorting, heat shock response, transcription,
           endocytosis, and ribosome stability; human homolog is
           involved in Liddle syndrome; mutant tolerates
           aneuploidy; ubiquitylates Sec23p
          Length = 809

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 394

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 395 MRLTNTA-RVYFVD 407

>ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 404

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 405 MRLTNTA-RVYFVD 417

>Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W
           (REAL)
          Length = 808

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 336 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 393

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 394 MRLTNTA-RVYFVD 406

>Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON}
           YER125W (REAL)
          Length = 809

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 394

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 395 MRLTNTA-RVYFVD 407

>NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134
          Length = 835

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 363 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 420

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 421 MRLTNTA-RVYFVD 433

>TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.134
           YER125W
          Length = 844

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 372 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 429

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 430 MRLTNTA-RVYFVD 442

>NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134
          Length = 836

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 364 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 421

Query: 63  LIIYNDGTKLYFND 76
           + + N   ++YF D
Sbjct: 422 MRLTNTA-RVYFVD 434

>AGL226C Chr7 complement(271523..275599) [4077 bp, 1358 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR081W
            (SRB8)
          Length = 1358

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 316  IRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDL-EQRKEIFCDCLRDHERDFT 374
            I+K  K +   Y+      S  D+  F+  L+FY     L EQ   I C+CLR+   D++
Sbjct: 945  IKKNFKIVLSMYRNS---TSLDDRKLFLDLLVFYGPNSRLQEQVTTIICNCLRESNEDYS 1001

Query: 375  GAVESLRQDKELIDR 389
              +  LR   + ID+
Sbjct: 1002 LILSLLRYGTKNIDQ 1016

>Ecym_2515 Chr2 (1003069..1007154) [4086 bp, 1361 aa] {ON} similar to
            Ashbya gossypii AGL226C
          Length = 1361

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 338  DQDKFVSQLLFYYKTFD--LEQRKEIFCDCLRDHERDFTGAVESLR 381
            ++ KF   LL  Y T+    EQ   I C+ L++H RD++  VE L+
Sbjct: 966  EEHKFFIDLLVEYGTYSKLQEQVTNIICNYLKEHRRDYSLIVELLK 1011

>Ecym_7377 Chr7 complement(784580..785071) [492 bp, 163 aa] {ON}
          similar to Ashbya gossypii ACL120W
          Length = 163

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 8  FKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLIIYN 67
          F     ++Y++N  T QS+WE P     + LE    E+  +         V   HL+I +
Sbjct: 15 FSKSRKREYFFNPETMQSQWELPEGTDSAKLEQYLVENPLK---------VRCLHLLIKH 65

Query: 68 DGTK 71
          DG++
Sbjct: 66 DGSR 69

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 19/97 (19%)

Query: 5  WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64
          W+E K   G+ YYYN  T ++ W KP              S+ ER+      L +GW + 
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKP----------QELYSELERRL-----LAHGWKVG 50

Query: 65 IYNDGTKLYFNDDSKEFKNDI----SQEDDSRCRSLI 97
                  Y+N+ S E + ++     QE D + ++ I
Sbjct: 51 STAGKQTYYYNEASGESRWELPVLPDQEQDVQAKAEI 87

>TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.134
           YER125W
          Length = 822

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQT-ERKPTFSL-ELVNGWH 62
           W++  TP G+ Y+ + NT+ + W  P  ++   + +    + T +++P   L  L +GW 
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDP--RRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWE 407

Query: 63  LIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDK 102
           + + N   ++YF D + +     +  DD R  S   SLD+
Sbjct: 408 MRLTNTA-RVYFVDHNTK----TTTWDDPRLPS---SLDQ 439

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,745,286
Number of extensions: 2104577
Number of successful extensions: 8439
Number of sequences better than 10.0: 120
Number of HSP's gapped: 8643
Number of HSP's successfully gapped: 163
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)