Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR151C (SUE1)3.496ON20620610951e-154
Smik_16.4033.496ON2032049391e-130
Suva_16.4793.496ON2122118951e-123
Skud_16.4453.496ON2152048591e-118
TPHA0D033003.496ON1961384505e-56
Kpol_1017.43.496ON1841434322e-53
SAKL0F02618g3.496ON2531374312e-52
KNAG0A079603.496ON1771464085e-50
NDAI0B058903.496ON2781403732e-43
ZYRO0D09812g3.496ON1851443652e-43
KLTH0F14938g3.496ON2291563614e-42
Kwal_55.212483.496ON2221483604e-42
KLLA0E03983g3.496ON1911523514e-41
TDEL0D056403.496ON1241512369e-25
CAGL0L08426g3.496ON1401362333e-24
NCAS0F035703.496ON2301492301e-22
TBLA0D029403.496ON71461665e-15
Ecym_12333.496ON87441632e-14
NCAS0C013108.682ON2571481714e-14
KAFR0G037103.496ON79391441e-11
TPHA0D012908.682ON2181581493e-11
YPL159C (PET20)8.682ON2531641494e-11
Suva_16.1518.682ON2531681487e-11
Skud_16.1238.682ON2551641479e-11
ZYRO0F07480g8.682ON2361521433e-10
TDEL0A062708.682ON2421581416e-10
Smik_6.3568.682ON2531361408e-10
AFR315C3.496ON77721301e-09
SAKL0H06380g8.682ON2191511371e-09
KNAG0J017608.682ON2581371354e-09
Kpol_1013.98.682ON2611361311e-08
NDAI0K013208.682ON2581551283e-08
KLLA0D06061g8.682ON2491561222e-07
CAGL0M02101g8.682ON2671731213e-07
KLTH0D11396g8.682ON2251361151e-06
TPHA0G015708.682ON2551381151e-06
Kwal_26.88288.682ON2231721133e-06
Kpol_1072.128.682ON2221571123e-06
TBLA0B038008.682ON3241471134e-06
TDEL0E007103.62ON4761521101e-05
ZYRO0C02244g3.62ON4601541073e-05
Kpol_1066.443.62ON479141975e-04
CAGL0M03685g3.62ON493137910.003
KLLA0A07447g3.62ON486144860.012
KAFR0H023808.682ON22039840.018
KAFR0A083403.62ON487141850.018
Skud_14.423.62ON524197850.019
NCAS0A099403.62ON494163830.036
TPHA0P012603.62ON494135810.061
Smik_14.363.62ON524161810.065
TBLA0B085103.62ON501156800.071
Ecym_23908.682ON22731780.100
SAKL0C12342g3.62ON552151780.15
NDAI0A061103.62ON490150760.27
Suva_14.443.62ON525141730.54
KLTH0A01364g3.62ON476147710.97
TBLA0B027208.798ON50233701.6
KNAG0C043807.427ON25484655.4
AGL234W6.363ON62964656.1
NDAI0E021108.676ON90399647.4
Kpol_529.138.425ON141063648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR151C
         (206 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   426   e-154
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   366   e-130
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   349   e-123
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   335   e-118
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   177   5e-56
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   171   2e-53
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   170   2e-52
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   161   5e-50
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   148   2e-43
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   145   2e-43
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   143   4e-42
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   143   4e-42
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   139   4e-41
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    96   9e-25
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    94   3e-24
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    93   1e-22
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   5e-15
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    67   2e-14
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    70   4e-14
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    60   1e-11
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    62   3e-11
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    62   4e-11
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    62   7e-11
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    61   9e-11
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    60   3e-10
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    59   6e-10
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    59   8e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    55   1e-09
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    57   1e-09
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    57   4e-09
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    55   1e-08
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    54   3e-08
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    52   2e-07
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    51   3e-07
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    49   1e-06
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    49   1e-06
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    48   3e-06
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    48   3e-06
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    48   4e-06
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    47   1e-05
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    46   3e-05
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    42   5e-04
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    40   0.003
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    38   0.012
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    37   0.018
KAFR0A08340 Chr1 complement(1670622..1672085) [1464 bp, 487 aa] ...    37   0.018
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    37   0.019
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    37   0.036
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    36   0.061
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    36   0.065
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    35   0.071
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    35   0.100
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    35   0.15 
NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa] ...    34   0.27 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    33   0.54 
KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly...    32   0.97 
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    32   1.6  
KNAG0C04380 Chr3 (862078..862842) [765 bp, 254 aa] {ON} Anc_7.42...    30   5.4  
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    30   6.1  
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    29   7.4  
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    29   8.6  

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  426 bits (1095), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%)

Query: 1   MILLKRTKIRGVSVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPK 60
           MILLKRTKIRGVSVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPK
Sbjct: 1   MILLKRTKIRGVSVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPK 60

Query: 61  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTID 120
           VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTID
Sbjct: 61  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTID 120

Query: 121 EKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPP 180
           EKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPP
Sbjct: 121 EKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPP 180

Query: 181 YMMRKLKPFDKALQMRLTHKSKKKMK 206
           YMMRKLKPFDKALQMRLTHKSKKKMK
Sbjct: 181 YMMRKLKPFDKALQMRLTHKSKKKMK 206

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  366 bits (939), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 186/204 (91%), Gaps = 2/204 (0%)

Query: 1   MILLKRTKIRGVSVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPK 60
           MILL RTKI+GVS  F S+QRRTHSRLVNPIRQQHQQITKQRSSKI KN HFYDFRSLPK
Sbjct: 1   MILLTRTKIKGVS--FASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPK 58

Query: 61  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTID 120
           VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+KSLQ LLT +E    EAKT +
Sbjct: 59  VPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPITEAKTTE 118

Query: 121 EKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPP 180
           + KHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEW+N+P 
Sbjct: 119 KSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWRNIPS 178

Query: 181 YMMRKLKPFDKALQMRLTHKSKKK 204
           YM RKLKPFDK LQ++L HKSKKK
Sbjct: 179 YMTRKLKPFDKPLQIQLKHKSKKK 202

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  349 bits (895), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 185/211 (87%), Gaps = 7/211 (3%)

Query: 1   MILLKRTKIRGVSVS-------FVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFY 53
           MILL++T+IRG+S +       F S+QRRT +RLVNP+RQQHQQI+KQR+SK+ KNAHF+
Sbjct: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+KSLQ LL  +EK  
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
            EAK  ++ +HKN+ FGERGTGGIMSGGVNGTWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 174 EWKNVPPYMMRKLKPFDKALQMRLTHKSKKK 204
           EWKNVP YMMRKLKPFD+ALQ++  H S KK
Sbjct: 181 EWKNVPSYMMRKLKPFDRALQLQAKHSSNKK 211

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 177/204 (86%), Gaps = 7/204 (3%)

Query: 1   MILLKRTKIRGV-------SVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFY 53
           MILL++TKIRG+       SV+   +QRRTH+RLVNPIRQQHQQITKQRSSKI KN HFY
Sbjct: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKR SLQ LL  +E   
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPA 120

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
           AEAK  ++  HKN+LFGERGTGGI SGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP
Sbjct: 121 AEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 174 EWKNVPPYMMRKLKPFDKALQMRL 197
           EWKNVP YMMRKLKPFDK+LQ  L
Sbjct: 181 EWKNVPSYMMRKLKPFDKSLQQPL 204

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  177 bits (450), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 3/138 (2%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  + +    L+  E    
Sbjct: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYN-NDFLSTQETQEK 109

Query: 115 EAKTIDEKKHK--NILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 172
               + +K H+  ++L GE+GTGGIMSGGVNGTWKYNPTVP  LLP+NWWSTS MGMEY+
Sbjct: 110 NNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYY 169

Query: 173 PEWKNVPPYMMRKLKPFD 190
           PEW NVP   ++ LKPF+
Sbjct: 170 PEWNNVPRRFLKTLKPFE 187

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  171 bits (432), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/143 (55%), Positives = 109/143 (76%), Gaps = 8/143 (5%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKR-KSLQTLLTMNEKTN 113
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+    K++     +N ++N
Sbjct: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95

Query: 114 AEAKTIDEKKHKNI-------LFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSS 166
           +   ++ ++  KNI       L G+RGTGGI SGGVNGTW++NP VP++LLP++WWSTS 
Sbjct: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155

Query: 167 MGMEYFPEWKNVPPYMMRKLKPF 189
           MGMEY+PEWKN+P  +++ LKP+
Sbjct: 156 MGMEYYPEWKNIPRKVVKDLKPY 178

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  170 bits (431), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (75%), Gaps = 1/137 (0%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKRKSLQTLLTMNEKTN 113
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    +RK L    +  ++  
Sbjct: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKKEYK 82

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
            EA+  +EK+  N++ G RGTGGI+SGGVNGTW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 83  NEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142

Query: 174 EWKNVPPYMMRKLKPFD 190
           EW NVP  +  KLKPFD
Sbjct: 143 EWLNVPKTIANKLKPFD 159

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  161 bits (408), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 1/146 (0%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+   K +      ++    
Sbjct: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSN-KLMAISHPEHDTEGT 90

Query: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174
           E    D +     LFG    GGI + G NGTWKY P +P ++LPFNWWS SS+ ME +PE
Sbjct: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPE 150

Query: 175 WKNVPPYMMRKLKPFDKALQMRLTHK 200
           W +VP ++++ LKPFD  L ++ T K
Sbjct: 151 WSSVPKHVVKGLKPFDLLLGVKATQK 176

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  148 bits (373), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/140 (53%), Positives = 100/140 (71%), Gaps = 4/140 (2%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD--KKRKSLQTLLTMNEKT 112
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   KK  S     +    +
Sbjct: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSSS 188

Query: 113 NAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 172
           ++E K   +++ K     E   GGIM+GG+NGTW+Y+P +PN LLP   WS S MGMEY+
Sbjct: 189 SSEKKKPQQEQMKKHYDDE--YGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246

Query: 173 PEWKNVPPYMMRKLKPFDKA 192
           PEWK VP  +++ LKPFDK+
Sbjct: 247 PEWKGVPFNIVKNLKPFDKS 266

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  145 bits (365), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 108/144 (75%), Gaps = 6/144 (4%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQT--LLTMNEKT 112
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ R    T  L + +   
Sbjct: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84

Query: 113 NAEAKT----IDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 168
             + +T     +  +  +++ G RG GGI SGG +GTW+    +P++LLP++WWST+SMG
Sbjct: 85  LRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMG 144

Query: 169 MEYFPEWKNVPPYMMRKLKPFDKA 192
           ME+FPEW+ VP +++RKLKPFD+ 
Sbjct: 145 MEFFPEWEGVPRHVVRKLKPFDRG 168

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  143 bits (361), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 108/156 (69%), Gaps = 3/156 (1%)

Query: 35  HQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 94
           H++     +SK+LK      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62

Query: 95  RDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPN 154
           ++      +T     E+   ++ T+ +    N + G  GTGGI SGGVNGTW+YNP +P+
Sbjct: 63  KEA---GWKTQRLRGERGARKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPS 119

Query: 155 ELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPFD 190
           +LLP+N WS +SM MEY PEW  VP  ++ KL+PF+
Sbjct: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  143 bits (360), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (71%), Gaps = 3/148 (2%)

Query: 43  SSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSL 102
           +SK+LK      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF   K    
Sbjct: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF---KETGW 67

Query: 103 QTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWW 162
           +T     E  +  A T  ++  KN + G +GTGGI SGGVNGTW+YNP +P++LLPF+ W
Sbjct: 68  KTQRLREEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLW 127

Query: 163 STSSMGMEYFPEWKNVPPYMMRKLKPFD 190
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  139 bits (351), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (65%), Gaps = 8/152 (5%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDK-KRKSLQTLLTMNEKTN 113
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+ K K   ++       K  
Sbjct: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
           ++A    E +H   + G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 72  SKAAFASEPEHP-FMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130

Query: 174 EWKNVPPYMMRKLKPFDKALQMRLTHKSKKKM 205
           EW +VP  +   LKP+      +L     KKM
Sbjct: 131 EWNDVPNKVSASLKPY------QLDQPQDKKM 156

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 95.5 bits (236), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 79/151 (52%), Gaps = 48/151 (31%)

Query: 43  SSKILKNAHFYD--FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRK 100
           SS++ +     D  FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF      
Sbjct: 17  SSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------ 70

Query: 101 SLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFN 160
                     KT A A                                  ++ + L  ++
Sbjct: 71  ------GRGTKTEAPA----------------------------------SLESNLPRYD 90

Query: 161 WWSTSSMGMEYFPEWKNVPPYMMRKLKPFDK 191
            WST++MG+E FPEW NVP  ++RKL+PFD+
Sbjct: 91  LWSTTTMGLERFPEWSNVPREVVRKLRPFDR 121

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 94.4 bits (233), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 83/136 (61%), Gaps = 11/136 (8%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL       +++      E +N 
Sbjct: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL---CHSNVRETHYYGESSN- 63

Query: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174
           E +  DE+    +L+G  G GGI + GV      +P+     L     S S MGMEY+PE
Sbjct: 64  ELQKKDEEPVNELLYGPEGRGGISTMGVRRMA--DPSKVKLGL-----SYSIMGMEYYPE 116

Query: 175 WKNVPPYMMRKLKPFD 190
           W+ VP  +++++KP++
Sbjct: 117 WEKVPRDVVKRIKPYE 132

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 93.2 bits (230), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 77/149 (51%), Gaps = 36/149 (24%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+ K ++        NEK   
Sbjct: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENGNEK--- 174

Query: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174
                            R  G  +S    G                 WSTS +G++ +PE
Sbjct: 175 -----------------RALGSSVSHKYKGI----------------WSTSILGLQDYPE 201

Query: 175 WKNVPPYMMRKLKPFDKALQMRLTHKSKK 203
           W NVP   ++ LKPFD+ L      K+KK
Sbjct: 202 WNNVPWNNIKNLKPFDEELASITIKKNKK 230

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
           YPR151C
          Length = 71

 Score = 68.6 bits (166), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRK 100
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 67.4 bits (163), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 55 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 98
           R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 10 LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 70.5 bits (171), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 64/148 (43%), Gaps = 29/148 (19%)

Query: 53  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKT 112
           +D+ +LPKV     L   E++ DILYSGYRP+    K+     +  RK+        E  
Sbjct: 85  FDYSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD---LENSSRKA--------EFG 133

Query: 113 NAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 172
           N+   T+ E   K          G  S                     W STS+ GME F
Sbjct: 134 NSNNSTLYEIAMKLDDLSPEAISGSTSSNF------------------WHSTSATGMEVF 175

Query: 173 PEWKNVPPYMMRKLKPFDKALQMRLTHK 200
            EW NVP  +++ LKPF   ++  LTHK
Sbjct: 176 DEWDNVPNSILKNLKPFQAPVKKNLTHK 203

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 60.1 bits (144), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 56 RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 94
          ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 9  KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 69/158 (43%), Gaps = 38/158 (24%)

Query: 37  QITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD 96
           Q++   S K L +    D+  LPKVP T  +  RE+T + LYSGYR         PLF D
Sbjct: 74  QMSGGLSGKSLADKKVLDYSWLPKVPQTSSITHREITTNSLYSGYR---------PLFID 124

Query: 97  KKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNEL 156
            K+ +L  L  +N        +I E   K                            NEL
Sbjct: 125 NKKGTL--LGDVNSTAQDANSSIYEFAMK---------------------------LNEL 155

Query: 157 LPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPFDKALQ 194
              + W  S+ G+E + EW  VP  +++KLKP+D +++
Sbjct: 156 SEPSPWMMSATGLESYSEWDYVPSKVIKKLKPYDLSIK 193

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 49/164 (29%)

Query: 30  PIRQQHQQITKQRSSKILKNAHF----YDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 85
           P+ +Q++ ITK+  S + + +H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQNKTITKKEHSDV-RGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLF 130

Query: 86  YPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGT 145
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 146 WKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
           +++   + +   P + W +S+ G+E+F EW+N+P  +++ LKPF
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 61.6 bits (148), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 75/168 (44%), Gaps = 49/168 (29%)

Query: 26  RLVNPIRQQHQQITKQRSSKILKNAHFY----DFRSLPKVPTTQYLEARELTRDILYSGY 81
               P+ +Q + I K  S+ I + +H      DF  LP+VP+T +L+  ++T ++LYSGY
Sbjct: 68  ECTTPLIEQSEAIAKTDSTNI-RASHSRKKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGY 126

Query: 82  RPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGG 141
           RP+      NP   D K K                                 TG  +   
Sbjct: 127 RPIFI----NP--NDPKLK-------------------------------EDTGSTL--- 146

Query: 142 VNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
               +++   + +   P + W +S+ G+E+F EW+N+P  +++ LKPF
Sbjct: 147 ----YEFAMKLDDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 49/164 (29%)

Query: 30  PIRQQHQQITKQRSSKILKNAH----FYDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 85
           P+ +Q +QI K  S+ I + +H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQSEQIAKNDSTSI-RASHPRKKRRDFSWLPRVPSTSHLKHTDMTTNVLYSGYRPLF 130

Query: 86  YPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGT 145
                NP   D K K                                 TG  +       
Sbjct: 131 I----NP--NDPKLK-------------------------------EDTGSTL------- 146

Query: 146 WKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
           +++   + +   P + W +S+ G+E+F EW+N+P  +++ LKPF
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 65/152 (42%), Gaps = 42/152 (27%)

Query: 53  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKT 112
           YD+  LP+VP+T YL  R+++  ILYSGYRP+      NP            L T  +  
Sbjct: 83  YDYSWLPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP----------DELKTSQDGG 128

Query: 113 NAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVP-NELLPFNWWSTSSMGMEY 171
           NA                            NG   Y   +   EL   + W++S+ G E 
Sbjct: 129 NAN---------------------------NGARLYEFAMKLEELGEQSLWTSSATGQEI 161

Query: 172 FPEWKNVPPYMMRKLKPFDKALQMRLTHKSKK 203
           +PEW  VP  + RKLKPF+      +  +++K
Sbjct: 162 YPEWDYVPMEVQRKLKPFNAPAPFNVDKEAEK 193

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 43/158 (27%)

Query: 32  RQQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKEN 91
           R Q +++T + S +  K    +D+  LP+VP+T  L+ R+++  +LYSGYRP+      N
Sbjct: 71  RSQQKKMTVEISGRGRKQQR-HDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPLFI----N 125

Query: 92  PLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPT 151
           P                      E KT  E           GTGG +       +++   
Sbjct: 126 P---------------------DEIKTSSEGS---------GTGGTL-------YEFAMK 148

Query: 152 VPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
           +  EL   + W TS+ G+EY+ EW ++P  + +KLKPF
Sbjct: 149 L-EELGDQSPWVTSATGLEYYREWDSIPGELQKKLKPF 185

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 61/136 (44%), Gaps = 44/136 (32%)

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           DF  LPKVP+T +L+  ++T ++LYSGYRP+      NP   D K K             
Sbjct: 99  DFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NP--NDPKLK------------- 139

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
                               TG  +       +++   + +   P + W +S+ G+E+F 
Sbjct: 140 ------------------EDTGSTL-------YEFAMKLEDLNEPLSPWISSATGLEFFS 174

Query: 174 EWKNVPPYMMRKLKPF 189
           EW N+P  ++R LKPF
Sbjct: 175 EWDNIPSELLRNLKPF 190

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR151C
           (SUE1)
          Length = 77

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R  +R +L + L       A
Sbjct: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR--RRPALLSFLA----DPA 60

Query: 115 EAKTIDEKKHKN 126
           E+   D+    N
Sbjct: 61  ESTKRDDGSRGN 72

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 57.4 bits (137), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 63/151 (41%), Gaps = 48/151 (31%)

Query: 39  TKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 98
           +K+R+   L     +D+  LPK P+T++L+ RE++ D+ YSGYRP+      NP      
Sbjct: 64  SKKRTQVELSGKKRHDYSWLPKAPSTEHLKLREISTDVFYSGYRPIFL----NPA---SP 116

Query: 99  RKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLP 158
           ++S  TL     K  A    I                                       
Sbjct: 117 KESESTLYEFAMKLEALGDPIP-------------------------------------- 138

Query: 159 FNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
              W +S+ G E++ EW NVP  +++KLKPF
Sbjct: 139 ---WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 33/137 (24%)

Query: 53  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKT 112
           Y +  LP VP+TQ++EA ++  ++LYSGYR         PLF D       T L      
Sbjct: 91  YRYHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLD------STAL------ 129

Query: 113 NAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 172
                       + +L  +       S    G+  Y   +  E  P   W+ S+ G+E +
Sbjct: 130 -----------ERGLLAAKEQASFTQSASPTGSTFYEIAMKLE-DPACIWANSATGLEKY 177

Query: 173 PEWKNVPPYMMRKLKPF 189
            EW N+P  +   LKPF
Sbjct: 178 TEWDNIPYSVANSLKPF 194

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 59/136 (43%), Gaps = 41/136 (30%)

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           D+  LPKVP+T+ L  RE+    LYSGYRP+                       +N K +
Sbjct: 108 DYSWLPKVPSTENLNHREIRTSALYSGYRPIY----------------------INSKGS 145

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
                           G+    G M  GVN T+     +  +L   + W +S+ GME + 
Sbjct: 146 ----------------GKNKLSGTMKNGVNSTFY---EIAMKLENPSPWMSSATGMELYS 186

Query: 174 EWKNVPPYMMRKLKPF 189
           EW +VP  +++ LKPF
Sbjct: 187 EWDHVPLDVLKDLKPF 202

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 65/155 (41%), Gaps = 44/155 (28%)

Query: 39  TKQRSSKI-LKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDK 97
           T  +SS + L+     +F  LPK+     L  ++++  +LYSGYRP+  P   N  F+  
Sbjct: 74  TNNKSSLVNLQRKKVLNFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQG 130

Query: 98  KRKSLQTLLTMNEKTNAEAKTIDE-KKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNEL 156
           ++ +  TL          A  +DE KK KN                              
Sbjct: 131 QKNNGSTLYEF-------AMKLDEFKKDKNSTI--------------------------- 156

Query: 157 LPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPFDK 191
                W TS+ G+E F EW NVP  ++R LKPF K
Sbjct: 157 -----WDTSATGVETFTEWDNVPESVIRNLKPFQK 186

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 64/156 (41%), Gaps = 53/156 (33%)

Query: 37  QITKQRSSKILKNAH---FYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPL 93
           ++ K    KI+K A      D+  LP+VPTT+++   E   D+LYSGYRP++   K    
Sbjct: 88  ELGKDSEEKIIKMATKKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDK---- 143

Query: 94  FRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVP 153
              K+ K +Q  + +                                      K +  VP
Sbjct: 144 -NAKENKLMQFAMKLE-------------------------------------KLSEPVP 165

Query: 154 NELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
                  W S S+ G E+F EW NVP  +++ LKPF
Sbjct: 166 -------WVS-SATGQEFFSEWDNVPSEIIKDLKPF 193

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 70/173 (40%), Gaps = 46/173 (26%)

Query: 17  VSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDI 76
           +S +++ +S + +  ++    +   +S K       YD+ +LP+V      + + ++ ++
Sbjct: 75  ISDKKQYNSGVTSAAQEAGGAVRDLKSEKAQTKKKVYDYSTLPRVEQISDTKLKNMSTEV 134

Query: 77  LYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGG 136
           LYSGYRP+ + V+                     K + E KT+ E   K   F E     
Sbjct: 135 LYSGYRPLFFDVE--------------------PKNSQEGKTLYEFAMKLEEFQE----- 169

Query: 137 IMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
                                  + W +S+ G E + EW NVP  +++ LKPF
Sbjct: 170 ---------------------AMSPWVSSATGSEMYAEWDNVPGDVIKDLKPF 201

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 48/136 (35%)

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           DF  LPK P+T +L+ R+++  +LYSGYRP +       L   +++++  TL     K  
Sbjct: 81  DFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFV-------LNSSEQKQTDSTLYEFAMKLE 133

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
           A               G+                          P  W S S+ G E++ 
Sbjct: 134 A--------------LGD--------------------------PLPWIS-SATGTEFYG 152

Query: 174 EWKNVPPYMMRKLKPF 189
           EW N+P  +++KL+PF
Sbjct: 153 EWDNIPADVIKKLRPF 168

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 52/138 (37%), Gaps = 43/138 (31%)

Query: 53  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMN-EK 111
           +D+ SLPK PTT +L + E   D+ YSGYRP+   V +    ++      +  L+M+  K
Sbjct: 101 FDYSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENPCTCYEISLSMDIVK 160

Query: 112 TNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEY 171
            N +  T                                           W  S+ G E 
Sbjct: 161 KNLKVSTP------------------------------------------WLFSATGSEL 178

Query: 172 FPEWKNVPPYMMRKLKPF 189
           + EW N+P  ++  LK F
Sbjct: 179 YKEWDNIPKSVLDNLKCF 196

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 51/172 (29%)

Query: 20  QRRTHSRLVNPIRQQHQQITKQRSSKILKNAHF-YDFRSLPKVPTTQYLEARELTRDILY 78
           +R++   +        +Q +K+R +  LK      DF  LPK P+T +L+ R+++  +LY
Sbjct: 46  KRKSRKNVGQSAEPASEQSSKKRVAVELKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLY 105

Query: 79  SGYRP-VMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGI 137
           SGYRP V+ P                                D+K+  + L+        
Sbjct: 106 SGYRPFVLAPA-------------------------------DQKQTDSTLY-------- 126

Query: 138 MSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
                    ++   + +   P  W S S+ G E++ EW  VP  ++++L+PF
Sbjct: 127 ---------EFAMKLESLGDPLPWIS-SATGTEFYGEWDGVPADVIKQLRPF 168

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 64/157 (40%), Gaps = 41/157 (26%)

Query: 33  QQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENP 92
            Q  Q+ K  ++  L N    D+  LPKVP+ + L  +++T DI YSG+RP+      +P
Sbjct: 72  SQKLQLNKYNNNTQLNNDLVVDYSWLPKVPSNKRLTHQDITTDIFYSGFRPLSI----DP 127

Query: 93  LFRDKKRKSLQTLLTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTV 152
              + K +   T   +       + T+D                +   G N         
Sbjct: 128 TELENKDEDSSTWYEV-------SLTLD--------------SPVPPSGHNSI------- 159

Query: 153 PNELLPFNWWSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
                    W++S+ GME + EW +VP  ++  L PF
Sbjct: 160 ---------WTSSATGMERYREWHSVPEEVINSLTPF 187

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 67/147 (45%), Gaps = 40/147 (27%)

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           D+  LPKVPT + L+ R++  ++LYSGYRP+    K                  +N+ TN
Sbjct: 163 DYSWLPKVPTLKNLKQRDVMTNVLYSGYRPLSIDFK-----------------ALNDPTN 205

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVP--NELLPFNWWSTSSMGMEY 171
                         ++    +      G +  +++   +   +E+ P   W +S+ G+E 
Sbjct: 206 --------------IYDPYSSP----NGSSTLYEFAMQLQSLSEIFP---WMSSAAGLEV 244

Query: 172 FPEWKNVPPYMMRKLKPFDKALQMRLT 198
           + EW ++P  +++KLKP      ++L+
Sbjct: 245 YSEWDSIPIEVLKKLKPLQSPQMIKLS 271

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 74/152 (48%), Gaps = 14/152 (9%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLT--MNEKTNAE 115
           LP+VP+T Y+   E+  + L++GYRP+   +  + L  + +  +L    T   N K  +E
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF--LGNSSLRPETRTNALDNFFTSFANLKVTSE 132

Query: 116 AKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE- 174
           +K   E++ ++++   +     ++   +      P +P        W  S  GM Y    
Sbjct: 133 SKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNRKPIIP--------WDASISGMVYNDHS 184

Query: 175 WKNVPPYMMRKLKPFDKALQMRLTHKSKKKMK 206
           +K+VP  ++ KLKPF K +++    +SKK  K
Sbjct: 185 FKDVPKSVVSKLKPF-KMVKLERAGESKKNNK 215

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 74/154 (48%), Gaps = 20/154 (12%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLT--MNEKTNAE 115
           +P+VP T Y+ A E+  + L++GYRP+   +  +P+        L    T   N K   E
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLF--LGNSPINDKNGSTPLDNFFTSFANLKVVEE 115

Query: 116 AKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYN--PTVPNELLPFNWWSTSSMGMEYFP 173
           ++ + E   + ++  E    GI SG ++ +   N  P +P        W  S  GM Y  
Sbjct: 116 SEVVGEVNVQEVI--EDLRRGIPSGQMSNSKGKNRKPIIP--------WDASISGMVYND 165

Query: 174 E-WKNVPPYMMRKLKPFDKALQMRLTHKSKKKMK 206
           + +K+VP  ++ KLKPF     +RL  KS K +K
Sbjct: 166 DPFKHVPNNVVSKLKPFK---MVRLEKKSDKNVK 196

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 63/141 (44%), Gaps = 22/141 (15%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTM--------N 109
           LP+VP+T+ +   E+  D L++GYRP+   +   P+   +K   L   L          N
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF--LGNCPIDDAEKGSELDRFLASFSDLKLLNN 131

Query: 110 EKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGM 169
           E ++++   I E   ++I    R       G  + T K  P VP        W  S  G+
Sbjct: 132 EDSDSKEVKI-EDILEDIQNDIRNATNEDIGDNSRTRK--PVVP--------WDASISGL 180

Query: 170 EYFPE-WKNVPPYMMRKLKPF 189
            Y    +KN+P  ++ KLKPF
Sbjct: 181 IYNDRPFKNIPNEVVSKLKPF 201

>CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|P48564 Saccharomyces
           cerevisiae YNL295w
          Length = 493

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 61/137 (44%), Gaps = 23/137 (16%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPV----MYPVKENPLFRDKKRKSLQTLLTMNEKTN 113
           +P V +T +L  +E+  + L++G +P+    +  +K  P F D      +    +N   +
Sbjct: 94  VPSVSSTDHLTDQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNFRVINASDD 153

Query: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173
              K++DE                +    +  W  + +   +++P   W  S  G+EY  
Sbjct: 154 GGEKSLDE---------------FLESVKDNDWNIDNSEQKKVIP---WQASISGIEYED 195

Query: 174 E-WKNVPPYMMRKLKPF 189
           + + N+P +++ KL+P+
Sbjct: 196 KSFSNIPKHVLSKLRPY 212

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 33/144 (22%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTM-----NEKT 112
           +P+VP+T YL   +L  + L++GY+P+   +  +PL  +     L  L +      N + 
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVLLDGLFSSIRKLKNAQI 147

Query: 113 NAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYN------PTVPNELLPFNWWSTSS 166
           N+E  T+           E     ++        +Y       P +P        W  S 
Sbjct: 148 NSENNTV-----------EIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDASI 188

Query: 167 MGMEYFPE-WKNVPPYMMRKLKPF 189
            G+ Y  E +K VP  ++ KLKPF
Sbjct: 189 SGLVYNDEPFKGVPRSVVSKLKPF 212

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 53  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKEN 91
           Y + +LP+VP+T  ++ ++L  ++L+S YRP+   +K +
Sbjct: 86  YKYSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 175 WKNVPPYMMRKLKPFDKALQMRLTHKSKKKMK 206
           W+NVP + +RKLKPF    ++  T+ +   M+
Sbjct: 157 WRNVPSHTVRKLKPFVPPSEIDFTNNADDVME 188

>KAFR0A08340 Chr1 complement(1670622..1672085) [1464 bp, 487 aa]
           {ON} Anc_3.62 YNL295W
          Length = 487

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 62/141 (43%), Gaps = 22/141 (15%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-----DKKRKSLQTLLT---MN 109
           +PKV  T Y+   EL  + L+ GYRP+   +  +P  +     + +  SL TLL    + 
Sbjct: 78  VPKVQNTDYISREELELEELFCGYRPLF--LGNSPFIKPRYNPNNRSPSLPTLLVKLRLM 135

Query: 110 EKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGM 169
           +  N  + +  EK   N +F  +     MS   +     +P  P        W  S  G+
Sbjct: 136 DVLNMGSNSSSEKFDFNKIFQSQTEDDFMS---DADKDRSPIFP--------WEVSVSGL 184

Query: 170 EYFPE-WKNVPPYMMRKLKPF 189
            +  E +KN+PP ++  L PF
Sbjct: 185 NFQDEGFKNLPPKIVTSLNPF 205

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 79/197 (40%), Gaps = 40/197 (20%)

Query: 25  SRLVNPIRQQHQQITKQRSSK---ILKNAHFYDFRSLPKVPTTQYLEARELTRDILYSGY 81
           S  V+ ++Q +Q +    +S+      N H      +PKV +T+Y+  +E+  + L++GY
Sbjct: 79  SHTVSALQQMNQSVDNVGTSRPKMFGSNLHLL----VPKVASTEYIPIKEVHTEGLFAGY 134

Query: 82  RPVMYPVKENPLFRDKKRK------------SLQTLLTMNEKTNAEAKTIDEKKHKNILF 129
           RP+      N  F    RK            ++Q +    +    + + I E   K  L 
Sbjct: 135 RPLFLG---NSSFSSDMRKGKNFHALDDGLPNIQVIDASEKDGKLDVQEIIEDLQKTSLI 191

Query: 130 GERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEY--FPEWKNVPPYMMRKLK 187
                    S     + K  P +P        W  S  GM Y   P +K VP  ++ K+K
Sbjct: 192 ENVSDKEQFS----SSHKRKPVIP--------WDASISGMVYNDMP-FKYVPKNVISKMK 238

Query: 188 PFDKALQMRLTHKSKKK 204
           PF     MR+  KS  K
Sbjct: 239 PFK---LMRIERKSHAK 252

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
           {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 44/163 (26%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPV-----MYPVKE---------NPLFRDKKRKSL- 102
           +PKVPTT Y+ + E+  + L++GY+P+     + PVK+         N +     R +L 
Sbjct: 70  VPKVPTTDYIPSLEMQTEGLFAGYKPLFLGNHVLPVKKQLPEELKALNFIIPKISRINLF 129

Query: 103 --QTLLTMNEK-----TNAEAKTIDEKKHKNILFGERGTGGIM-SGGVNG-------TWK 147
               + T+N        N   KTID    KNIL  +R    +  S  ++        T  
Sbjct: 130 SSNAVETLNPDHVSPLDNDGVKTID---IKNIL--KRSDAEVHPSDNIDNTVAKKTETLT 184

Query: 148 YNPTVPNELLPFNWWSTSSMGMEYFPE-WKNVPPYMMRKLKPF 189
             P +P        W  S  G+ Y    +KNVP  ++ +LKPF
Sbjct: 185 RKPVIP--------WDASISGVIYNDHPFKNVPGRIISELKPF 219

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 35.8 bits (81), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 56/135 (41%), Gaps = 9/135 (6%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLT--MNEKTNAE 115
           +PKV +T  L + E+  + L++GYRP+   +  + L  + K   L    T   N K +A 
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLF--LGNSSLETNSKLDVLDNFFTSFANLKVSAP 146

Query: 116 AKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE- 174
               D      I    +     +  G+    + +        P   W  S  GM Y  + 
Sbjct: 147 ESETDSYNSGQI----KDVIDDLQNGLESEQEQSSLTRENRKPIIPWDASIGGMVYSDKA 202

Query: 175 WKNVPPYMMRKLKPF 189
           +K++P  ++ KL PF
Sbjct: 203 FKDLPKSVVSKLSPF 217

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 33/161 (20%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRK------------SLQTL 105
           +PKV +T +++ +E+  + L++GYRP+      N  F    RK            ++Q +
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPLFLG---NSSFPSDARKGKNFHELGDVLPNIQVI 167

Query: 106 LTMNEKTNAEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTS 165
               +      + I E  HK+ L   R +   M    + + K  P +P        W  S
Sbjct: 168 DASEKDGKLNMQEIIEDLHKSSL---RDSIHNMEQH-SSSHKRKPVIP--------WDAS 215

Query: 166 SMGMEY--FPEWKNVPPYMMRKLKPFDKALQMRLTHKSKKK 204
             GM Y   P +K+VP  ++ ++KPF     MR+  KS+ K
Sbjct: 216 ISGMVYNDMP-FKHVPKSVVLRMKPFK---LMRIERKSQMK 252

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 69/156 (44%), Gaps = 31/156 (19%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAK 117
           +P+V +T+ + + E+  D L++GYRP+   + E+ + R +K   L          + E  
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLF--LGESSIKRRRKASPLDKFFH-----SVETH 142

Query: 118 TIDEKKHKNILFGERGTGGIMSG--------------GVNGTWKYNPTVPNELLPFNWWS 163
           T + +  K+ L    G   I+                  +   K  P  P  ++P   W 
Sbjct: 143 TRNRESGKSTL----GIQDIIDNLRKDHEEENLEIEEHSDKNTKVEPRKP--VIP---WD 193

Query: 164 TSSMGMEYFPE-WKNVPPYMMRKLKPFDKALQMRLT 198
            S  G+ Y  + +KNVP ++M KLKP+   L ++ T
Sbjct: 194 ASVSGIFYKDQSFKNVPKHVMNKLKPYKVYLPVKKT 229

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 34.7 bits (78), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPV 84
           D+   P  P T++L+  ++  D+LYSGYRP+
Sbjct: 85  DYSWFPVAPKTEHLKEGDIAVDLLYSGYRPL 115

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 162 WSTSSMGMEYFPEWKNVPPYMMRKLKPF 189
           W  ++ G   + EW NVP  ++R L+P+
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 63/151 (41%), Gaps = 18/151 (11%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNAEAK 117
           +P VP T Y+   E+  + L++GY+P+      N    +K+   L  L T   K      
Sbjct: 161 VPHVPNTDYIPHSEIQTEGLFAGYKPLFL---GNSSLDEKRADVLDGLFTSLTKIKKGTS 217

Query: 118 TIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEY--FPEW 175
             + + +   +  +      M      + K  P +P        W  S  GM Y   P +
Sbjct: 218 APNGEINVQEILDDLQKDDTMETLKEKSHK-KPVIP--------WDASISGMVYNDLP-F 267

Query: 176 KNVPPYMMRKLKPFDKALQMRLTHKSKKKMK 206
           K+VP  ++ KLKPF     +R+  ++KK  K
Sbjct: 268 KDVPRNVVGKLKPFK---LLRIERRNKKDGK 295

>NDAI0A06110 Chr1 complement(1384706..1386178) [1473 bp, 490 aa]
           {ON} Anc_3.62 YNL295W
          Length = 490

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 26/150 (17%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMY---PVKENPLFRDKK-------RKSLQTLLT 107
           +P+V  T ++   E+  + L++GY+P+      +     F D +       + S   LL 
Sbjct: 67  VPRVGETDHIPVNEVQTEGLFAGYKPLFLGNSSISTQNRFYDNELHLKLLPQLSDLKLLG 126

Query: 108 MNE-----KTNAEAKTIDEKKHKNILFGERGTGGIMSGGVN--GTWKYNPTVPNELLPFN 160
            N      ++++   T+ +K +   +  E     I S  +N  G     PT+P       
Sbjct: 127 ANAENFITESSSLHDTLSQKNNIQDIIEELKNATIHSQDINSDGEGITKPTIP------- 179

Query: 161 WWSTSSMGMEYFPE-WKNVPPYMMRKLKPF 189
            W  S  GM Y    +K VP  ++ KLKPF
Sbjct: 180 -WDASISGMLYKDRPFKAVPNSVVTKLKPF 208

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 20/141 (14%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENP--LFRDKKRKSLQTLLTMNEKTNAE 115
           +PKV +T ++  +E+  + L++GYRP+       P  + + K    L  +L   +  +A 
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPNIQLVDAS 171

Query: 116 AKTIDEKKHKNILFGERGTGGIMSGGVN-----GTWKYNPTVPNELLPFNWWSTSSMGME 170
            K  D K +   +  +     +     N      + K  P +P        W  S  GM 
Sbjct: 172 EK--DGKLNVQEIIEDLQRTSLRESISNMEQSSSSHKRRPVIP--------WDASISGMV 221

Query: 171 Y--FPEWKNVPPYMMRKLKPF 189
           Y   P +K++P  ++ KLKPF
Sbjct: 222 YNDMP-FKHIPKNVVSKLKPF 241

>KLTH0A01364g Chr1 (126448..127878) [1431 bp, 476 aa] {ON} weakly
           similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 476

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 68/147 (46%), Gaps = 15/147 (10%)

Query: 58  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLL-TMNEKTNAEA 116
           +PKV +T +++  E+  + L++G +P+   + E  L   +   +L  +  T+ +   A  
Sbjct: 86  VPKVHSTDHIKQDEIHTEGLFAGNKPLF--LGELSLSFKRPSGALDGIFGTLTKIKRATD 143

Query: 117 KTIDEKKHKNILFGERGTGG-IMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE- 174
              D++     +  +  TG   +S G     K  P +P        W  S  GM Y  + 
Sbjct: 144 DGGDQEIDVQGIINDLQTGDKDISSGEKSAAK-RPVIP--------WDASISGMVYNDQP 194

Query: 175 WKNVPPYMMRKLKPFDKALQMRLTHKS 201
           +K VP  ++ KLKPF K L++   +KS
Sbjct: 195 FKQVPRGVVNKLKPF-KLLKIERKNKS 220

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 55  FRSLPKVPTTQYLEARELTRDILYSG--YRPVM 85
           +  LP +P T YL A+ L +DI+ SG  Y P+ 
Sbjct: 273 YNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>KNAG0C04380 Chr3 (862078..862842) [765 bp, 254 aa] {ON} Anc_7.427
           YBL095W
          Length = 254

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 15  SFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTR 74
           S +SL+  ++S  V+ +  + Q +  QRS  + K A    ++ L   P+ ++L   E   
Sbjct: 34  STISLKDPSNSPSVDKLLHRKQPLVLQRSDVLNKIAKSTLYQELISNPSVEHLAQSEK-- 91

Query: 75  DILYSGYRPVMYPVKENPLFRDKK 98
             + SG+RP  Y V + PLF   K
Sbjct: 92  --IPSGHRP--YHVGQGPLFGPSK 111

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 29.6 bits (65), Expect = 6.1,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 15 SFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARELTR 74
          S VS  +   + L+  IRQ+ Q ++++ +S  L+N   YDF+        Q L   +  R
Sbjct: 3  SSVSASQAKVNELLEAIRQEFQSVSQEATSYRLQNQKDYDFK------INQQLAEMQQIR 56

Query: 75 DILY 78
          + +Y
Sbjct: 57 NTVY 60

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 37/99 (37%), Gaps = 25/99 (25%)

Query: 63  TTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKT------NAEA 116
           + + ++   + R I  +G  P+          RD K KS+ T+LTM             A
Sbjct: 24  SQEQIDENIVCRIICTNGTIPI----------RDLKVKSIATILTMETPIKKIWTFGRNA 73

Query: 117 KTID---------EKKHKNILFGERGTGGIMSGGVNGTW 146
             +D           KH  IL GE G   I     NGTW
Sbjct: 74  NIVDYHLGDISRLSNKHFQILLGEDGNLLIKDTSTNGTW 112

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
            complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 7/63 (11%)

Query: 31   IRQQHQQITKQRSSKILKNAHFYDFRSLPKVPTTQYLEARE-LTRDILYSGYRPVMYPVK 89
            I QQ+  I   +  K+L N   Y F        T +L   E  T + L+S   P  YP  
Sbjct: 1253 INQQYATIDVDKLEKLLNNVLVYSFND------TSFLNMSEQSTNEFLFSSNYPTYYPFT 1306

Query: 90   ENP 92
             +P
Sbjct: 1307 SSP 1309

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,580,657
Number of extensions: 973391
Number of successful extensions: 3373
Number of sequences better than 10.0: 77
Number of HSP's gapped: 3413
Number of HSP's successfully gapped: 99
Length of query: 206
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 102
Effective length of database: 41,556,135
Effective search space: 4238725770
Effective search space used: 4238725770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)