Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR149W (NCE102)3.493ON1731738231e-113
Smik_16.4023.493ON1731738121e-112
Skud_16.4443.493ON1731737691e-105
Suva_16.4783.493ON1661736675e-90
CAGL0I10494g3.493ON1721745982e-79
CAGL0L08448g3.493ON1731735878e-78
KAFR0C019703.493ON1791795523e-72
NDAI0G009303.493ON1761765305e-69
NDAI0B058803.493ON1821825272e-68
NCAS0E008003.493ON1741745097e-66
YGR131W (FHN1)3.493ON1741745044e-65
KNAG0B008003.493ON1821824969e-64
TDEL0D056103.493ON1751754932e-63
KNAG0A079503.493ON1821824932e-63
Suva_7.4193.493ON1741744914e-63
KLLA0D16280g3.493ON1691734593e-58
Smik_6.2273.493ON1741744569e-58
TPHA0D032803.493ON1841844517e-57
Kpol_1017.63.493ON1871874501e-56
KAFR0G037003.493ON1861774447e-56
SAKL0F02750g3.493ON1701734392e-55
NCAS0F035603.493ON1831834403e-55
ZYRO0D09966g3.493ON1781784385e-55
Skud_7.4423.493ON1741744245e-53
TBLA0D029603.493ON1891734231e-52
KLTH0F14850g3.493ON1711744194e-52
TBLA0C044903.493ON1861684031e-49
Kwal_55.212383.493ON1701733968e-49
Ecym_12363.493ON1691733324e-39
AFR312W3.493ON1681732716e-30
KNAG0B038505.502ON55657638.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR149W
         (173 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   321   e-113
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   317   e-112
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   300   e-105
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   261   5e-90
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   234   2e-79
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   230   8e-78
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   217   3e-72
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   208   5e-69
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   207   2e-68
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   200   7e-66
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   198   4e-65
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   195   9e-64
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   194   2e-63
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   194   2e-63
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   193   4e-63
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   181   3e-58
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   180   9e-58
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   178   7e-57
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   177   1e-56
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   175   7e-56
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   173   2e-55
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   174   3e-55
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   173   5e-55
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   167   5e-53
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   167   1e-52
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   166   4e-52
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   159   1e-49
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   157   8e-49
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   132   4e-39
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   108   6e-30
KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {O...    29   8.2  

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  321 bits (823), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 159/173 (91%), Positives = 159/173 (91%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLALADNILRIINF              NTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  317 bits (812), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 158/173 (91%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLALADNILRIINF              NTQ +HSSRVNYCMFACAYGIFTDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMS+FNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  300 bits (769), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 153/173 (88%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLA ADNILRIINF              NTQ R+SSRVN+CMFA AYGIFTDSLYGVFAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNN SYVDSN ITQGSGTRCRQA
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  261 bits (667), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 139/173 (80%), Gaps = 7/173 (4%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLA  DNILRIINF              NTQ  +SSR+NYCMFA AY I TDSLYGVFAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F EPLAWPL+LF+LDFLNFVFTFTA       IRAHSC N +Y+ SN ITQGSG RCR+A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  234 bits (598), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 116/174 (66%), Positives = 136/174 (78%), Gaps = 3/174 (1%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ADN+LRI+N               NT+ RHSSRVN+C+FA AYGI TDSLYG+FAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVD-SNKITQGSGTRCRQ 119
           F EPLAWPLVLF LDFLNFVFTFTAGTVLAVGIRAHSCNN  Y++   KI QGSGTRCRQ
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           AQA VAF YFS AIFLAK +MS+ +++SNGAFG+    +R+   +VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAK--LRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  230 bits (587), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 131/173 (75%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLA+ DN+LRI+NF               T+ RHSSRVNYCMFA AYGI TDSLYGVFAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F E LAWPL+LFTLDFLNF F  TAG VLAVGIRAHSCNN+ Y ++NKI QGS  RCR++
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAF +FS AIFLAK +MS+ N+ SNGAFG+    +RR   +VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  217 bits (552), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 131/179 (73%), Gaps = 6/179 (3%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQH-RHSSRVNYCMFACAYGIFTDSLYGVFA 59
           ML +ADNILR+IN               NTQ+  H+SRVNYCMFACA+G+F DS+YG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
           NF + LAWPL+LFTLDFLNF FTF+A T LAVGIRAHSC N SY+DSNKI +GSG RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS--FSKRRR---TGQVGVPTISQV 173
           AQA VAFLYFS AIF+AK +MS  N+  NGAF SGS  F  RR+   T   GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  208 bits (530), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 103/176 (58%), Positives = 125/176 (71%), Gaps = 3/176 (1%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ADN+LR++N               NTQ  H+SR+NYCMF C Y + TDS +G+ AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F E L++P +LFTLDFLNF FTF AGTVLA GIR+HSCNN SY+D NKITQGSG RCR++
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---TGQVGVPTISQV 173
           QA VAF YFS  IFL K  MS  +MI NGAF +   S+RRR     +VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  207 bits (527), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 111/182 (60%), Positives = 129/182 (70%), Gaps = 9/182 (4%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+  DNILR+IN               NTQ  +SSR+N+CMFA A+G+ TDS +GV  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
             + LA WP++LF  DFLNFVFTFTAGTVLAV IRAHSC N  YV+SN ITQGS  RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----SKRR--RTG--QVGVPTIS 171
           +QAAVAF YFSC IFLAK +MS  NM SNG FGSG++    SKRR  R+G  +VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 172 QV 173
           QV
Sbjct: 181 QV 182

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  200 bits (509), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 122/174 (70%), Gaps = 1/174 (0%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML +ADN+LRI+N               NT+  ++SR+NYCMF CAY + TDS+YG+FAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F + LA P + F LDFLNF FTF AGTVLA GIRAHSC +  YV+SNKITQG   RCR++
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  198 bits (504), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 97/174 (55%), Positives = 119/174 (68%), Gaps = 1/174 (0%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+ ADN++RIIN                TQ +HSSRVN+CMFA  YG+ TDSLYG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F   L +P +L  LDFLNF+FTF A T LAVGIR HSC N +Y++ NKI QGS +RC Q+
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 173
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  195 bits (496), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 103/182 (56%), Positives = 117/182 (64%), Gaps = 9/182 (4%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML +ADN+LR++NF              NTQ  H SRVNYCMFA AYGI TD LYG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F EPLAWPL+LFTLDFLNF FT TAG VLAVGIRAHSC N  Y + N I QGS  RCR +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 171
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 172 QV 173
           QV
Sbjct: 181 QV 182

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  194 bits (493), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 124/175 (70%), Gaps = 2/175 (1%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLA+ DN LR++NF              +++  HSSRVN+CMFA A+GI TDS YG+ AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
             E  AWP++LF LDFLNF FTF+A T LAVGIR HSC N  Y+DSN ITQGS  RCR A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS--FSKRRRTGQVGVPTISQV 173
           QA+VAF YFS  IFLAK +MS+  +I+NG F S +   S+RR++ QVGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  194 bits (493), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/182 (62%), Positives = 127/182 (69%), Gaps = 9/182 (4%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           MLALAD  LR++NF              NTQH HSSR+NYCMF  AYGI TDS YGV AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F EPL+WPL+L  LDFLNFVFT TAG VLAVGIRAHSC N +Y + NKI QGS  RCRQA
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 171
           QAAVAF +FS AIFLAK +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 172 QV 173
            V
Sbjct: 181 TV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  193 bits (491), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 126/174 (72%), Gaps = 1/174 (0%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ADNI+RIIN               ++Q +HSSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
               L +P+++F LDFLNF+FTF AGT LAVGIR HSC+N +Y+D+NKITQGSG+RC QA
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173
           +AAV F YFSC +FL K ++S+  M+ NG FG G+   RRR   Q+G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  181 bits (459), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 93/173 (53%), Positives = 115/173 (66%), Gaps = 4/173 (2%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ DN LR +NF               TQ   SSRVN+ +FA  +GI  DSLY + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FI  LAWP++L +LDFLN+VFTF+A T LAVGIR  SC N S+   NKI +GS  RCR+A
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QA+  FLYFS AIFL K ++S+ N I++GAFG+ S     R  QVGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRKTQVGVPTISQV 169

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  180 bits (456), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 115/174 (66%), Gaps = 1/174 (0%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+ ADN++RIIN               +TQ +HSSRVN+CMF  AYG+ TDSLYG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F   L +P +L  LD LNF+FTF A T LAVGIR HSC N +Y++ NKITQ S +RC Q+
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173
           QAAVAF YFSC +FL K  ++    I NG FG  S   RRR   Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  178 bits (451), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 119/184 (64%), Gaps = 11/184 (5%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML LADNILR +NF               TQ++HSSRVNYC+F   + + TD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
            +  PLAWP++LF  DFLNF FTFTAGTVLAVG R HSC N SY+DSN ITQGS  RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----------SKRRRTGQVGVPT 169
           AQAA AF YFS  IFLAK +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 170 ISQV 173
           ISQV
Sbjct: 181 ISQV 184

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  177 bits (450), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 121/187 (64%), Gaps = 14/187 (7%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+LADNI+R INF               T+  HSSRVNYCMF   + + TDS YG+ AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
            +  P AWP++LF  DFLNF FTFTAGTVL+VGIR HSC N +Y+D+NKI QGS  RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG--SGSFSKRRR-----------TGQVG 166
           AQA++AF YFS  IF  K +MS  N++SNGA G  + S  +RR            + QVG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 167 VPTISQV 173
           VP ISQV
Sbjct: 181 VPNISQV 187

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  175 bits (444), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 126/177 (71%), Gaps = 6/177 (3%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRH-SSRVNYCMFACAYGIFTDSLYGVFA 59
           MLA+ADN LR++NF              NT+  H S+RVNYCMFA A+GI TDS+YG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
           NF E LAWP++LF  DFLNFVF FTAGTVLAVGIRAH+CNN +Y +SNKI +GS TRCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFS-----KRRRTGQVGVPTIS 171
           AQAAVAF YFS AIFL K + S+   IS G FGSGS       ++RR+   GVPT S
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTS 177

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  173 bits (439), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 117/173 (67%), Gaps = 3/173 (1%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ DN LR++NF               TQ  HS RVN+ +F  A+ + TDS Y VFAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
                AWP++L T DFLNFVFTF+A T LAVGIR HSC N SY+ SN ITQGS  RCR+A
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QA VAFLYFS  IFL K ++SV N+ S+GAFGSGS S+R     VGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRR---ANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  174 bits (440), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 125/183 (68%), Gaps = 10/183 (5%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+  DN LR  N               +TQ+  SSRVNYCMFA A+G+ TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FIEPLA-WPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
            I+ L+ WP++LF  DFLNFVFTFTAGTVLAVGIR HSCNN  Y++SNKI QGSG RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRR---------TGQVGVPTI 170
           +QAAVAF YF+  +FLAK +MS  +M SNGAFGSGSF  RR+         T   GVPTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 171 SQV 173
           S+V
Sbjct: 181 SEV 183

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  173 bits (438), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 101/178 (56%), Positives = 121/178 (67%), Gaps = 5/178 (2%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQ-HRHSSRVNYCMFACAYGIFTDSLYGVFA 59
           MLAL DNILR +NF               ++ H H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
           N   P A+P++LF LDFLNFVFTFTA T LAVGIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGA----FGSGSFSKRRRTGQVGVPTISQV 173
           AQA VAF YF+  IFL K +MS  +++SNGA     G  S  +R +   VGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  167 bits (424), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 116/174 (66%), Gaps = 1/174 (0%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML+ ADN++RI++                TQ   SSRVN+CMFA AYG+ TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           F   L +P +L  LDFLNF+FTF A T LAVGIR HSC N +Y++ N ITQGS +RC Q+
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFG-SGSFSKRRRTGQVGVPTISQV 173
           QAAVAF YFSC +FL K  +SV  M+ NG FG +  + +RR   Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  167 bits (423), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 105/173 (60%), Gaps = 11/173 (6%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQH-RHSSRVNYCMFACAYGIFTDSLYGVFA 59
           ML L DN+ RI NF              NT+H  HSSRVNYCMF  A+G+ +DS YG+ A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFI-EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118
           N + EP A+P +LF  DFLNFVFTFTAGTVLAVGIR HSC N  Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSG---------SFSKRRRT 162
           +AQA +AF YFS  +FL K L+++    + G  G           SF +R RT
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRT 173

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  166 bits (419), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 118/174 (67%), Gaps = 4/174 (2%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSS-RVNYCMFACAYGIFTDSLYGVFA 59
           ML++ DN LR +NF               T   H++ +VN+ +F  A+G+  DSLY + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119
           NF+  LAWPL++   DFLNFVFTF A T LAV IR HSC N  Y+DSN +TQGS  RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           AQA+VAFLYFS  IFLAK  +S+ N+IS GAFG+GS    RRTG VGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS---SRRTGNVGVPTISQV 171

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  159 bits (403), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 104/168 (61%), Gaps = 7/168 (4%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHR-HSSRVNYCMFACAYGIFTDSLYGVFA 59
           ML+   N+LRIINF               ++ R HS RVNYCMFA  + + TDS Y + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFIE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118
           NF   P AWP++L++ DFLNF FTFTAGTVL+VGIR HSC N  Y+ SNKITQGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF-----GSGSFSKRRR 161
            AQA++AF YFS  I+L + + S   M  NG F     G  SF   RR
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  157 bits (396), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 115/173 (66%), Gaps = 3/173 (1%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ DN LR  NF               T+  ++ +VN+ +FA A+G+  D+LY + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FI  LAWPL++   DFLNFVFTF A T LAV IR HSC NS YVD+NK+TQGS  RCR+A
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QA+VAFLYF+  +FL K  +S+ N+ S GAF +   S  R++  VGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFST---SSGRKSANVGVPTISQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  132 bits (332), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 106/173 (61%), Gaps = 4/173 (2%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ DN LR  NF              N Q+R  SRVN+ +F   + +  DSLY V AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FI  LAWP++L T D LN +FTF A T L   I  HSC+NS ++  N I++G   RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QA+  FL+FS  IFLAK ++S  N++S GAF SGS    R+TG  GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGS---GRKTGG-GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  108 bits (271), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 97/173 (56%), Gaps = 5/173 (2%)

Query: 1   MLALADNILRIINFXXXXXXXXXXXXXXNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60
           ML++ DN LR +NF              + Q    SRVN+ +F   + + TDS Y + AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120
           FI   AWP++   LD LN +FTF A T L   I AHSC+N  ++D N I++ S  RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QA+  FL+FS  IFLAK + S  N+ S     SG+FS        GVPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFS-----SGAFSSGGSKRGGGVPTISQV 168

>KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {ON}
           Anc_5.502 YOR161C
          Length = 556

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 113 SGTRCRQAQ-AAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVP 168
           SG  C  A+   +  L F C  ++++ + +V +M  +G FGS  +  +   G    P
Sbjct: 285 SGGNCSHAKLIGILVLVFFCGYYISEVIRNVIHMTVSGVFGSWYYMFKSDQGMPKWP 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,556,828
Number of extensions: 507974
Number of successful extensions: 1460
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1434
Number of HSP's successfully gapped: 42
Length of query: 173
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 71
Effective length of database: 41,785,467
Effective search space: 2966768157
Effective search space used: 2966768157
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)