Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR148C3.491ON43543516240.0
Smik_16.4013.491ON42743413310.0
Skud_16.4433.491ON42043413200.0
Suva_16.4773.491ON42343812431e-169
ZYRO0D10010g3.491ON3824378541e-111
SAKL0F02794g3.491ON3974388481e-110
Kwal_55.212273.491ON3764368271e-107
TDEL0D055903.491ON3442778141e-105
Kpol_1017.73.491ON3784357222e-91
KLTH0F14806g3.491ON3582797117e-90
NDAI0B058503.491ON4732966685e-82
NCAS0F035403.491ON4442736379e-78
KLLA0E04621g3.491ON3892836285e-77
Ecym_12383.491ON3932925999e-73
CAGL0L08492g3.491ON3854175972e-72
TBLA0D029803.491ON4432885769e-69
TPHA0D032703.491ON3882785171e-60
KAFR0G036803.491ON4152754851e-55
KNAG0A079303.491ON4522834774e-54
AFR309C3.491ON3641683651e-38
TDEL0H022407.221ON3382302002e-16
Kwal_47.181487.221ON3232331791e-13
KLTH0A03894g7.221ON3232341772e-13
Kpol_1070.197.221ON3112301727e-13
KLLA0E04511g7.221ON3021211593e-11
KNAG0D017607.221ON342621561e-10
KAFR0I019507.221ON330661532e-10
CAGL0L00891g7.221ON341661497e-10
NDAI0A026607.221ON364661498e-10
TPHA0C012307.221ON305721461e-09
Ecym_43777.221ON333611452e-09
SAKL0F08162g7.221ON330661452e-09
Kpol_478.227.221ON3502301435e-09
ADL115W7.221ON333621425e-09
NCAS0A133807.221ON329661416e-09
Smik_9.1507.221ON326661382e-08
Suva_9.1597.221ON325681372e-08
TBLA0D042007.221ON331621363e-08
YIL041W (GVP36)7.221ON326661354e-08
Skud_9.1287.221ON329661344e-08
TBLA0B015807.221ON386611274e-07
ZYRO0D16522g7.221ON358621266e-07
TPHA0B027507.221ON363631257e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR148C
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   630   0.0  
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   517   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   513   0.0  
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   483   e-169
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   333   e-111
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   331   e-110
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   323   e-107
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   318   e-105
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   282   2e-91
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   278   7e-90
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   261   5e-82
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   249   9e-78
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   246   5e-77
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   235   9e-73
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   234   2e-72
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   226   9e-69
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   203   1e-60
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   191   1e-55
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   188   4e-54
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   145   1e-38
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    82   2e-16
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    74   1e-13
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    73   2e-13
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    71   7e-13
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    66   3e-11
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    65   1e-10
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    64   2e-10
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    62   7e-10
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     62   8e-10
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    61   1e-09
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    60   2e-09
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    60   2e-09
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    60   5e-09
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    59   5e-09
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    59   6e-09
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    58   2e-08
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    57   2e-08
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    57   3e-08
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    57   4e-08
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    56   4e-08
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    54   4e-07
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    53   6e-07
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    53   7e-07

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/435 (74%), Positives = 322/435 (74%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFSGFSLNKITDSIATAAHKTQDT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXX 180
           GWFG             NHDDAFLPRSFAQAISKAAVDCECEFQNL              
Sbjct: 121 GWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKES 180

Query: 181 XXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240
             TAQTTEAQGADHN               LSNLIKVFDSWSTCYKNIDEGKAEMDSMMV
Sbjct: 181 IKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240

Query: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHSK 300
           KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY                    HSK
Sbjct: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAHSK 300

Query: 301 DVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSNKVN 360
           DVSAKDISANTTTSFDETPST                     TVDDVADRKEDLKSNKVN
Sbjct: 301 DVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSNKVN 360

Query: 361 DEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420
           DEPPI               FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV
Sbjct: 361 DEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420

Query: 421 QEVEANLKVLNGLEI 435
           QEVEANLKVLNGLEI
Sbjct: 421 QEVEANLKVLNGLEI 435

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/434 (63%), Positives = 286/434 (65%), Gaps = 8/434 (1%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS FSLNKITDSIATAAHKT DT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+SDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXX 180
           GWFG             NHDDAFLPRSFAQAISKAAVDCE EFQNL              
Sbjct: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180

Query: 181 XXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240
              AQTT   GA                  LSNLIKVFDSWSTCYKNIDEGK EMDSMMV
Sbjct: 181 TKNAQTT---GAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMV 237

Query: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHSK 300
           KEFNKKLE LINQDFK+VH+LRKKVE SRLKFDTMRY                    H+K
Sbjct: 238 KEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTK 297

Query: 301 DVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSNKVN 360
           DV     SANT TS +E PST                      V D A   ++   +   
Sbjct: 298 DV-----SANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKK 352

Query: 361 DEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420
           D+ P+               FVSNTTAAVETMEEI DSSEILGLIKLFQNFQLVYFRQCV
Sbjct: 353 DDTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCV 412

Query: 421 QEVEANLKVLNGLE 434
           QEVEANLKVLNGLE
Sbjct: 413 QEVEANLKVLNGLE 426

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/434 (62%), Positives = 290/434 (66%), Gaps = 15/434 (3%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFSGFSLNKITDSIATAAHKTQDT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 121 GWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXX 180
           GWFG             NHDDAFLPRSFAQAISKAAVDCECEFQ+L              
Sbjct: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLK----- 175

Query: 181 XXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240
               + +E+     +               LSNLIKVFDSWSTCYKNIDEGKAEMDS M+
Sbjct: 176 ----KKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMI 231

Query: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHSK 300
           KEFNKKLE LIN+DFKKVH+LRKKVE+SRLKFDTMRY                     SK
Sbjct: 232 KEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAET-----SK 286

Query: 301 DVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSNKVN 360
           +V  K +SAN   S DE P+T                       DD A  KED K+N+  
Sbjct: 287 EVDDKAVSANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQ-G 345

Query: 361 DEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420
           DEP I               FVSNTT AVE MEEITDSS+ILGL+KLFQNFQLVYFRQCV
Sbjct: 346 DEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCV 405

Query: 421 QEVEANLKVLNGLE 434
           QEVEANLKVLN LE
Sbjct: 406 QEVEANLKVLNSLE 419

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  483 bits (1243), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 265/438 (60%), Positives = 281/438 (64%), Gaps = 20/438 (4%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGY+     NKITDSIATAAHKTQDT             DPQTRLSIKSRTRFVQESLG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 121 GWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXX 180
           GWFG             NHDD FLPRSFAQAISKAAVDCE EF+NL              
Sbjct: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEA 175

Query: 181 XXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240
             T Q T  Q                    LSNLIKVFDSWSTCYKNIDEGKAEMDSMMV
Sbjct: 176 KKTTQETAEQEE-----EEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 230

Query: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHSK 300
           KEFNKKLE LIN+DFKKVH+LR+KVEESRLKFDTMRY                     SK
Sbjct: 231 KEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDET-----SK 285

Query: 301 DVSAKDISANTTTSFDETPSTXXXXXXXXXXX----XXXXXXXXXXTVDDVADRKEDLKS 356
           +    D SAN +TS +E  +                          T +D  D  E+ K 
Sbjct: 286 EADNNDNSAN-STSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQ 344

Query: 357 NKVNDEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYF 416
              N++PP+               FVSNTTAAVETMEEITDSSEIL L+KLFQNFQLVYF
Sbjct: 345 QPTNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYF 404

Query: 417 RQCVQEVEANLKVLNGLE 434
           RQC QEVEANLKVLNG+E
Sbjct: 405 RQCAQEVEANLKVLNGME 422

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  333 bits (854), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/437 (43%), Positives = 239/437 (54%), Gaps = 59/437 (13%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YFS FS   + DSIA AAH+TQD              DPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            V +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118

Query: 121 GWFGXXXX---XXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXX 177
           GWFG                +  D  +PRSFAQAI+KA+ +C   +QN            
Sbjct: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN------------ 166

Query: 178 XXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDS 237
                 +Q +E +  D +                 NL+++F++ S CY+NIDEGK EMD 
Sbjct: 167 ------SQKSEKKQIDEDEDDV-------------NLVEMFNTLSICYRNIDEGKDEMDK 207

Query: 238 MMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXX 297
            + +EFN KLE L+N+DFKK+H LR KVE SRLKFDTMRY                    
Sbjct: 208 SIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLK--------------- 252

Query: 298 HSKDVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSN 357
                  +      T + DE PS                      T  + A+ +   K+ 
Sbjct: 253 ----EKEEKEENENTANADEGPSN----KNQQEPTNEPAKEEEKPTPAEPAEAQHTTKTE 304

Query: 358 KVNDEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFR 417
             N EP +               FVSNT+ AVETM  I + SEIL L+KLFQN QLVY+R
Sbjct: 305 NSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 364

Query: 418 QCVQEVEANLKVLNGLE 434
           QCVQE+EA+LK LN LE
Sbjct: 365 QCVQEMEASLKGLNDLE 381

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  331 bits (848), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/438 (42%), Positives = 239/438 (54%), Gaps = 47/438 (10%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS FSL+K+T+SI++AAHKTQD              DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLD--DPQAKLSLKVRKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            + DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118

Query: 121 GWF----GXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXX 176
           G      G             + ++ FLPRSFAQA+SKAA D     + L          
Sbjct: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQD 178

Query: 177 XXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMD 236
                                             +++LI +F++WS C + ID+ KAEMD
Sbjct: 179 EDEDEDED--------------------------INSLITMFEAWSKCEQKIDQEKAEMD 212

Query: 237 SMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXX 296
           S+M KEFNKKL+ LIN+DFKKVH LRKKVEESRLKFDT+RY                   
Sbjct: 213 SLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEEN 272

Query: 297 XHSKDVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKS 356
                V          T   ET                        + D  +   E +++
Sbjct: 273 EKVDVVEQNAPEEKAKTEGQETSEG----------KEHDLKADEKLSEDTASKIPESVEN 322

Query: 357 NKVNDEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYF 416
            +V++E P                FVS+TT AVE M EITDSSEIL L+KLF  FQL+Y 
Sbjct: 323 EEVDNEDP-----EHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYH 377

Query: 417 RQCVQEVEANLKVLNGLE 434
           RQCVQE+EA+ K+L+GL+
Sbjct: 378 RQCVQELEASTKILDGLD 395

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  323 bits (827), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/436 (42%), Positives = 232/436 (53%), Gaps = 66/436 (15%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YF GFS NK+TD++  AAHKTQDT             DPQ  LS+K+R  ++QE+LG
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+ DISKLPPQYQ LEKK DSLEK C+R+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGXXXXXX--XXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXX 178
           G FG                   A +PRSFAQAI+KAA D                    
Sbjct: 119 GLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKD-------------------- 158

Query: 179 XXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSM 238
                  + +   A  +               ++ LIK+F +WS C   ID+GKAEMD++
Sbjct: 159 -------SGDVLAALKDQEQQASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDAL 211

Query: 239 MVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXH 298
           M KEFN+KL  LI + FK    LR+KVE+SRLKFDTMRY                     
Sbjct: 212 MAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFK 271

Query: 299 SKDVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSNK 358
             D+S+K+  A+   + +E   +                         V   KE+  +N 
Sbjct: 272 ESDLSSKEEGADANETSNEVGKS-------------------------VTKTKEEQATND 306

Query: 359 VNDEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQ 418
              E                  FVSNTT AVETM EITDS+E+L L+KLF NFQLVY RQ
Sbjct: 307 AAQE----------LLEKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQ 356

Query: 419 CVQEVEANLKVLNGLE 434
           CVQ++EA+L  LN LE
Sbjct: 357 CVQDLEASLSTLNELE 372

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  318 bits (814), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 164/277 (59%), Positives = 186/277 (67%), Gaps = 37/277 (13%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGY S FSLNKITD++A AAHKTQDT             DPQ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+ D SKLPPQYQ LEKKSD+LEK CKRILLV++TFEVEGYDYPPNLTESISDWWSLNKD
Sbjct: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116

Query: 121 GWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXX 180
           GWFG             +  DAFLPRSF+QAISKAA DC   F NL              
Sbjct: 117 GWFG-TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQ------------- 162

Query: 181 XXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240
                       +H                +SN+ K+FDSWS CYKNIDEGK EMDSM+ 
Sbjct: 163 ------------EHG-------DEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIR 203

Query: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           KEFN KLE +IN+DFKKVH  RKKVEESRLKFDT+RY
Sbjct: 204 KEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY 240

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (90%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVSNTTAAVE M E+T+S+EILGL KLFQNFQLVYFRQCVQEVEA+LK+L  LE
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  282 bits (722), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 228/435 (52%), Gaps = 64/435 (14%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXX----XDPQTRLSIKSRTRFVQESLG 60
           FSGFS++K+TDSI+  A KTQ+                  DP T+LSIKS+ RF+QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119
           T++D  SKLPP Y  LE K+D++EK  KR+L V+KT+E EGYDYPPNLTES+SDWW+ N 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT-ND 120

Query: 120 DGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXX 179
           D                   + +FLPRSFAQAIS A+ D      ++             
Sbjct: 121 DN-----VTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSV------------- 162

Query: 180 XXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMM 239
                  T     +H                 S+L K+F+S   CY+NID GK EMD ++
Sbjct: 163 -------TNTIKLNH----KDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLI 211

Query: 240 VKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHS 299
           V EFN KL+ LIN +FK VH LRK VE SRLKFDTMRY                      
Sbjct: 212 VNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKS-- 269

Query: 300 KDVSAKDISANTTTSFDETPSTXXXXXXXXXXXXXXXXXXXXXTVDDVADRKEDLKSNKV 359
            DVS K       TS  ETP                       T     ++KED     +
Sbjct: 270 -DVSKKG------TSKKETPK---------------KEASKKETPKKEINKKED-----I 302

Query: 360 NDEPPIXXXXXXXXXXXXXXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQC 419
            +E                  FVSNT  AVE MEE+TD+S+I+ L+KL+QNFQLVY++QC
Sbjct: 303 TNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQC 362

Query: 420 VQEVEANLKVLNGLE 434
           +QE+E+NLK+LNGLE
Sbjct: 363 IQEIESNLKILNGLE 377

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  278 bits (711), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 175/279 (62%), Gaps = 31/279 (11%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MS YF GFSLNK+T+SI   AHKTQDT             DPQ +LS+K+R  ++QE+LG
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
           T+ DISKLPPQYQFLEKK DSLEKVC+R+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGXXXXXXXXXXXXXNHD--DAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXX 178
           G FG               D  +A +PRSFAQAISKAA D                    
Sbjct: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDS------------------- 159

Query: 179 XXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSM 238
               TA  TE Q A                  +++LIK+F++WS C  N+D+ KAEMD++
Sbjct: 160 GEVMTALKTEEQKA--------SAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDAL 211

Query: 239 MVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           MVKEFN KL   + + FK    LRKKVE+SRLKFDTMRY
Sbjct: 212 MVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRY 250

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 45/54 (83%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVSNTT AVETM EITDS+EI+ L+KLF NFQL+Y++QCVQ +E ++  LN LE
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  261 bits (668), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 150/296 (50%), Positives = 176/296 (59%), Gaps = 37/296 (12%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD 64
           FS FSL+KIT+SI  AA K  +T             DPQT+LSIKS+TR  QE LGT+ D
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT----DPQTKLSIKSQTRLFQEQLGTIHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124
           ISKLP QY+ LE K+DSLEK  KRILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSH 117

Query: 125 XXXXXX----XXXXXXXNHDDA--------------FLPRSFAQAISKAAVDCECEFQNL 166
                            +HD+A              FLPRSFAQAISK+A+DC   +Q L
Sbjct: 118 RKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177

Query: 167 XXXXXXXXXXXXXXXXTAQTT-----EAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSW 221
                           T +TT     EAQ  D                 + NLIK F+SW
Sbjct: 178 ----------SIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESW 227

Query: 222 STCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           S CYKNID+GK+EMDSMM KEFN KLE LIN +FKKV+ LRKKV +SRLKFDT+R+
Sbjct: 228 SNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRH 283

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 41/54 (75%), Positives = 48/54 (88%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVS+T +AVE M EIT+SS I+GLIKLFQNFQLVY+RQCVQE+EANLK LN L+
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  249 bits (637), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 134/273 (49%), Positives = 168/273 (61%), Gaps = 31/273 (11%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD 64
           FS FSL+KIT+S+ATAA KT DT             DP T+LS++S+ R  QES+GTV D
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124
           IS LP QY  LE ++D+LEK  +RIL+VSKTFE+EGYDYPPNL+ES SDWWSL+      
Sbjct: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLS------ 111

Query: 125 XXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXXXXTA 184
                             FLPRSFAQAIS +A DC   +Q++                  
Sbjct: 112 ----SKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGD-------------- 153

Query: 185 QTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFN 244
              +    ++                + NLIK FDSW+ CYKNID+GKAEMDSMM+KEFN
Sbjct: 154 ---DEDKEENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFN 210

Query: 245 KKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
            KLE L+N++FKKVH LRK+V++SRLKFDT+RY
Sbjct: 211 AKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRY 243

 Score = 99.4 bits (246), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 51/55 (92%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEI 435
           FVS+T +AVE MEEITDSSEI+GL+KLFQNFQLVY+RQCVQE+EANLK LN LEI
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELEI 444

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  246 bits (628), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 135/283 (47%), Positives = 166/283 (58%), Gaps = 22/283 (7%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD 64
           FS  SLN ITDSI+ AA +TQ+              DP+TRLSI  R   +QE+LGTV D
Sbjct: 2   FSKLSLNNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD 59

Query: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124
           IS+LP QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F 
Sbjct: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119

Query: 125 -XXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXXXXT 183
                           ++  LPRSFAQA+SKAA D     + L                T
Sbjct: 120 FSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQL----------KAEETRT 169

Query: 184 AQTTEAQGADHNXXXXXXXX---------XXXXXXXLSNLIKVFDSWSTCYKNIDEGKAE 234
            Q    +GAD                          + NLIK F+SW+ C  +ID+ KAE
Sbjct: 170 NQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAE 229

Query: 235 MDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           MDS+MVKEFN KL  LI  DFKK H+LR KV+++RL FDT+R+
Sbjct: 230 MDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRH 272

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 44/54 (81%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVS T+  VE + E+TDSSEI+ L+KLF NFQL++++QCV+ +E +L+VLN L+
Sbjct: 332 FVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  235 bits (599), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 166/292 (56%), Gaps = 41/292 (14%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 55
           MS YFS FSL+KI  +I TAAHKTQ                    DPQT LS+++R   +
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 116 --SLNKDG--W-FGXXX-----XXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQN 165
             S  KDG  W FG                    ++ ++P SFAQAISKAA D     + 
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKE 180

Query: 166 LXXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCY 225
           L                      + GA+                 + +L+ + ++W+   
Sbjct: 181 LNEEQL--------------VNPSNGAE------------TEDEDVDSLMPILEAWAEAQ 214

Query: 226 KNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
            NIDE K +MD  M+ EFNKKL++L+N DF KV  LRKKVEESRLKFDT+RY
Sbjct: 215 SNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRY 266

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEI 435
           FVSNTT AV  M +ITDS  +  L+KLF NFQL+Y ++CVQE++A+L V+N L +
Sbjct: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTV 387

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  234 bits (597), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 202/417 (48%), Gaps = 81/417 (19%)

Query: 41  DPQTRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEG 100
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV KRIL+V+KT+E+EG
Sbjct: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85

Query: 101 YDYPPNLTESISDWWSLNKDGWFGXXXXXXXXXXXXXNHDDAFL---------------P 145
           YDYPPN++ES+S WW   +  WF              N + A                 P
Sbjct: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEGP 143

Query: 146 RSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXX 205
            SFA AI++A  D +  F+++                                       
Sbjct: 144 PSFASAIARAGKDSQLIFESIETKDEDEKEDI---------------------------- 175

Query: 206 XXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKV 265
                   L+K+F  WS C+  I + K EMD MM+KEFN KLE  + ++F+K+H LR KV
Sbjct: 176 ------DELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKV 229

Query: 266 EESRLKFDTMRYXXXXXXXXXXXXXXXXXXXXHSKDVSAKD------ISANTTTSFDETP 319
           EESRL FDTMRY                     SK++  +D      + AN T + ++  
Sbjct: 230 EESRLNFDTMRY-----------EVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEA 278

Query: 320 STXXXXXXXXXXXXXXXXXXXXXTVD--DVADRKEDLKSNKVNDEPPIXXXXXXXXXXXX 377
           +                      T D  D  D KED K++                    
Sbjct: 279 ANDKVETKEKTETNATIADETKETKDTKDSEDLKEDSKTS-----------TDGQLLEQL 327

Query: 378 XXXFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
              FVSNTT AVE M E++++SE+L LIKLFQ FQL Y + CV+ +E +LK LN ++
Sbjct: 328 EDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  226 bits (576), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 163/288 (56%), Gaps = 32/288 (11%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           MSGYFS FSL+K+ DS+ +AA KTQDT             DPQTRL++ S+  ++QES+G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120
            +++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW  +  
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 121 GWFGXXXXXXXXXXXXXNHDDA-----------FLPRSFAQAISKAAVDCECEFQNLXXX 169
            +               N  D            FLPRSF  AISKA+ D      NL   
Sbjct: 146 AFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNN 205

Query: 170 XXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 229
                          +  E                      +  LIKVFDSWS C KNID
Sbjct: 206 EKLEFAKTKTEDEEYEDDED---------------------IQLLIKVFDSWSLCNKNID 244

Query: 230 EGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           + K + D +++K+FNKKL +L++ +FK V  LR KV+++RLKFDTMRY
Sbjct: 245 KSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/53 (69%), Positives = 49/53 (92%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGL 433
           FVS+T+AAVETMEEIT+SS+IL LIKLFQNFQL++++QC++EVE N+K+L  L
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  203 bits (517), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 155/278 (55%), Gaps = 28/278 (10%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXX----XXXXXXXXXDPQTRLSIKSRTRFVQESLG 60
           FS FSL+K+TDSI+  A KTQ+                  DP T+LSI++R+R++QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119
           T+ D ISKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+ ++
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121

Query: 120 DGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXX 179
                               +  FLPRSFAQA++KA  D +     +             
Sbjct: 122 -----------------TTENKNFLPRSFAQALAKAYSDSKL----ITDKAERNIKLQTS 160

Query: 180 XXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMM 239
              T   T+ +  +                 L  L K F + S  + NID GK EMD+M+
Sbjct: 161 PKNTG--TKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMI 218

Query: 240 VKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           V EFNKKLE L+  +FK+V  LR+ VE SRLKFDTMRY
Sbjct: 219 VNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRY 256

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 40/55 (72%), Positives = 50/55 (90%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLEI 435
           FVSNT++AVE MEE+TDS++IL L+KLFQNFQLVY+RQCVQE+E NLK ++ LEI
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLEI 386

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  191 bits (485), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 115/275 (41%), Positives = 148/275 (53%), Gaps = 38/275 (13%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD 64
           FS F+ +KIT+SI+TAA   Q               D QT+L  K   RF QE +G + D
Sbjct: 2   FSNFNFDKITNSISTAAQSAQ-----QKINDTILTPDVQTKLHFKKTARFWQEKVGQIPD 56

Query: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122
             ISKLP  Y  LE K D+LEK+ KR+L+V+KT+E+EGYDYPPNL+ES++DWW      W
Sbjct: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------W 110

Query: 123 FGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXXXXXXX 182
                              +F+  SF  AISKAA D +    +L                
Sbjct: 111 ------SDLKKSKKHQEKSSFMNNSFPMAISKAAFDSKSILDDLKE-------------- 150

Query: 183 TAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKE 242
                + Q                      NL++VF+S S CYKNID+ KAEMD+M+VKE
Sbjct: 151 -----KQQDLPKEGEEPEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKE 205

Query: 243 FNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           FN KLE LIN DFKKV  LR KV++SRL+FDT+R+
Sbjct: 206 FNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRH 240

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 47/54 (87%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVSNT AAVE M E+T++SE++ L+KLFQNFQL++++QCVQE+E N+K L+ LE
Sbjct: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  188 bits (477), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 157/283 (55%), Gaps = 30/283 (10%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSIKSRTRFVQESLGTVSD 64
           FS FSL+K+T +I  AA   QDT             D QT+L     TR+ QE +GT+S+
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56

Query: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122
             I+KLP  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW+ +++  
Sbjct: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKK 116

Query: 123 -----FGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNLXXXXXXXXXXX 177
                FG               D + L RSFA AI KA +D +    +L           
Sbjct: 117 KKTQDFG---------------DSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEE 161

Query: 178 XXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXX---LSNLIKVFDSWSTCYKNIDEGKAE 234
                  +   A+  D                    ++N+I  F  WS CYKNID+ KAE
Sbjct: 162 KKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAE 221

Query: 235 MDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277
           MDSM+VKEFN+KL  ++  DFK VH L  +V++SRL+FDT+R+
Sbjct: 222 MDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVSN TAAVE M E+TDSSE++ L+KLFQN QLV++RQCVQE+EA++K L+ LE
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  145 bits (365), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 99/168 (58%), Gaps = 15/168 (8%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPQTRLSIKSRTRFV 55
           MS YF   SL+K+ +++  AA KTQ                    DP+T LS+K+R R +
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LG+  DIS+LPPQY FLE+K D++E+VCK+IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 116 SLN-------KDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAA 156
           + +       K G  G                D   P SFA A+ +AA
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD---PPSFAHALHRAA 165

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (74%)

Query: 211 LSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRL 270
           + +LIK+F +W+    N+D  K EMD  MVKEFN+KL+ L+  +FKK H LR+KVEESRL
Sbjct: 193 VESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRL 252

Query: 271 KFDTMRY 277
            FDT++Y
Sbjct: 253 TFDTLKY 259

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (75%)

Query: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434
           FVSNT  AVE M  I D+++++ L+KLFQNFQLVY R+CVQE+E +L  L  LE
Sbjct: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 99/230 (43%), Gaps = 42/230 (18%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ + +  L V+  +E E YDYP  +T
Sbjct: 38  QSTQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 109 ESISDWWSL--NKDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNL 166
           ES++D+  +  +K                      A  PR+   A+SK ++    E+ N 
Sbjct: 98  ESVNDFSKIVAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSL-ISSEYLN- 155

Query: 167 XXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 226
                                     DH+                + +  V   +S    
Sbjct: 156 -----------------------HIGDHDE---------------AQVASVLLKYSDLQA 177

Query: 227 NIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
            + + + + D+M+   FNK+L+  +  +FKK    RK VE  RL++D  R
Sbjct: 178 KVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 101/233 (43%), Gaps = 48/233 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R +QE LG V+DIS+LP  Y  LE K D ++ V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWS-----LNKDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEF 163
           +S++++ S     L++                   H D   P++   A+SK A+    E+
Sbjct: 117 DSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKD---PKTLNYALSKVAL-TSSEY 172

Query: 164 QNLXXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWST 223
            N                      ++ GA+ +                S+L+K    +S 
Sbjct: 173 LN----------------------KSPGAEDSEVS-------------SSLLK----YSD 193

Query: 224 CYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
               I + +   D+++  +FNKKL   +  D  +    RK VE  RL++D  R
Sbjct: 194 VQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIAR 246

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 101/234 (43%), Gaps = 50/234 (21%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWS-----LNKDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEF 163
           +S++++ S     L+                    H D   P++   A+SK A+    E+
Sbjct: 117 DSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKD---PKTLNYALSKVAL-TSSEY 172

Query: 164 QNLXXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSN-LIKVFDSWS 222
            N                      ++ G D +               +SN L+K    +S
Sbjct: 173 LN----------------------KSVGGDDS--------------EVSNALLK----YS 192

Query: 223 TCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
                + + + + D+++   FNKKL  ++  D  +    RK VE  RL++D  R
Sbjct: 193 DVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIAR 246

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 96/230 (41%), Gaps = 42/230 (18%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE++ D+++ V +  L ++  +E E YDYP  ++
Sbjct: 37  ESTQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVS 96

Query: 109 ESISDWWSL--NKDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNL 166
           +S++D+  +  NK                      A  PR+   A+SK A++        
Sbjct: 97  DSVNDFSKVFANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSESL--- 153

Query: 167 XXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 226
                                 AQ AD N                  L+K    +S    
Sbjct: 154 ----------------------AQLADPNEGPVADA-----------LLK----FSDVQA 176

Query: 227 NIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
            I + +   D+++  +FNK+L   +  D  K    RK V+  RL++D  R
Sbjct: 177 KIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVAR 226

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 66/121 (54%), Gaps = 13/121 (10%)

Query: 1   MSGYFSGFS--LNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPQTRLSI--KSRTRFVQ 56
           MS YF  FS  + +++ S++  A + Q               D +T L +   S  R +Q
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ---------LDQKFKDLKTNLPLLANSTQRMLQ 51

Query: 57  ESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWS 116
           E LG V+DIS+LP +Y  LE + ++++ + +  L V+K +E E YDYP N+ ES+ ++  
Sbjct: 52  EKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSK 111

Query: 117 L 117
           L
Sbjct: 112 L 112

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+M+  +FNK ++  + QD +     RK VE+ RL++D +R
Sbjct: 172 YSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 43/62 (69%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG V+DIS+LP +Y  LEK+ D+L+ V +  L V+  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 113 DW 114
           +W
Sbjct: 102 EW 103

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     + + + E D+ +  +FN+KL   ++ +  +    RK+V + RL++D  R
Sbjct: 175 FSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LEKK DS++ + +  L V+  +E E YDYP  + 
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 109 ESISDW 114
           +S++D+
Sbjct: 98  DSVNDF 103

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNK L   ++    K +  RK+V+  RL++D  R
Sbjct: 173 FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 45/66 (68%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ V +  L V+  +E E YDYP  ++
Sbjct: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 109 ESISDW 114
           ES++++
Sbjct: 98  ESVNEF 103

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ V    L V+ TFE + YDYP    
Sbjct: 41  QSTQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVAR 100

Query: 109 ESISDW 114
           ES+ ++
Sbjct: 101 ESVIEF 106

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D ++ ++FN  L   +N  F++   +RK V+  RL++D  R
Sbjct: 184 FSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 49/72 (68%), Gaps = 1/72 (1%)

Query: 47  SIKSRT-RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPP 105
           SI S T R VQE LG V+DIS+LP +Y  LEK+ D+++ V +  L ++  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 106 NLTESISDWWSL 117
            +++S++D+  L
Sbjct: 94  YVSDSVNDYSKL 105

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 43/61 (70%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG ++DIS++P +Y  +EK+ D +  + +  L V++ +E E YDYP +++ES++
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 113 D 113
           +
Sbjct: 121 E 121

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D ++   FNK+L+  +N +F      RK+V+  RL++D  R
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 44/66 (66%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE + D +  V +  L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 109 ESISDW 114
           +S++++
Sbjct: 117 DSVNEF 122

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNKKL   +  D  K    RK+VE  RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 90/230 (39%), Gaps = 50/230 (21%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R V+E LG V DIS LP +Y  LE K D+ + V +  L ++  +E E YDYP   +
Sbjct: 33  QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 109 ESISDWWSL--NKDGWFGXXXXXXXXXXXXXNHDDAFLPRSFAQAISKAAVDCECEFQNL 166
           ES++++     NK   F                     PR+   A+SK ++    +FQ L
Sbjct: 93  ESVNEFTDSIGNKMYEFSNGVSTEGSSGKT--------PRTLNYAVSKVSMGASEQFQKL 144

Query: 167 XXXXXXXXXXXXXXXXTAQTTEAQGADHNXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 226
                                      H+               ++NL+    +      
Sbjct: 145 ---------------------------HD----------TDDKRIANLL---TNVGNAEA 164

Query: 227 NIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +I E +   D  +  +FN +L   I Q  ++    RK+V   RLK+D  R
Sbjct: 165 SIAEARLLQDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIAR 214

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 43/62 (69%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG V+DIS++P +Y  LE++ D  + +    L VS+ +E E YDYP ++++S++
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 113 DW 114
           D+
Sbjct: 121 DF 122

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++   FN++L   +N  F +    RK+V++ RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K DS++++    L VS  +E + YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 109 ESISDW 114
           ES+ ++
Sbjct: 98  ESLIEF 103

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 43/66 (65%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDW 114
           ES++++
Sbjct: 93  ESVNEF 98

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNK L   ++ +  K    RK V   RL++D  R
Sbjct: 167 FSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWS 116
           ES++++ S
Sbjct: 93  ESVNEFSS 100

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNKKL   ++ +  K    RK+V   RL++D  R
Sbjct: 167 FSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R  QE LG ++DIS++P +Y  LE + D+L+   + +L V++ +E   YD+P +  ES+ 
Sbjct: 41  RLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQ 100

Query: 113 DW 114
           DW
Sbjct: 101 DW 102

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDW 114
           ES++++
Sbjct: 93  ESVNEF 98

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNK L   ++ +  K    RK V   RL++D  R
Sbjct: 167 FSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDW 114
           ES++++
Sbjct: 93  ESVNEF 98

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     I + + + D+++  +FNKKL   ++ +  K    RK V   RL++D  R
Sbjct: 167 FSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (65%)

Query: 55  VQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDW 114
           +QE  G V+DIS LP +Y  LE++ DS++ V    L ++  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 115 W 115
            
Sbjct: 61  Q 61

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R++QE LG  +DIS++P +Y  L  K D+++ +    L V++ ++ E YDYP  + ESI+
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 113 DW 114
           ++
Sbjct: 97  EF 98

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 221 WSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMR 276
           +S     + + +   DS++   FN KL   I+ + K+ H +R+ VE  RL +D  R
Sbjct: 167 YSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESIS 112
           R ++E LG   DIS LP +Y  LE K D+++++ +  L V+  +E E YDYP    ES  
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGES-- 94

Query: 113 DWW 115
            +W
Sbjct: 95  -FW 96

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%)

Query: 212 SNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLK 271
           ++L +   S S    +I E +   DS++    N +L+  ++Q+F++    RK V   R  
Sbjct: 148 NSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAKYRKAVHHKRFN 207

Query: 272 FDTMR 276
           +D  +
Sbjct: 208 YDVAK 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,116,013
Number of extensions: 1074271
Number of successful extensions: 2892
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2905
Number of HSP's successfully gapped: 87
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)