Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR147C3.488ON30430416420.0
Smik_16.4003.488ON30430414620.0
Skud_16.4423.488ON30430414550.0
Suva_16.4763.488ON30430413860.0
TBLA0C044503.488ON3093107671e-101
TDEL0D055603.488ON3113107671e-101
NCAS0F035303.488ON3133167261e-94
Kpol_480.173.488ON3133127164e-93
CAGL0L08514g3.488ON3123127103e-92
KLTH0F14740g3.488ON3022937093e-92
TPHA0D042203.488ON3163186991e-90
Kwal_55.212193.488ON3022946832e-88
ZYRO0D10076g3.488ON3053086321e-80
NDAI0B058303.488ON3293336314e-80
SAKL0F02860g3.488ON3053066086e-77
Ecym_12413.488ON3053115224e-64
AFR306C3.488ON3192825071e-61
CAGL0L04686g3.454ON451133780.28
Kwal_27.123173.454ON435142740.76
CAGL0M11462g8.284ON38666721.4
KAFR0E03110singletonON356107721.4
TPHA0L016008.524ON372108721.5
TDEL0C011808.89ON23460711.6
NCAS0D03520na 1ON314112711.6
YGR110W (CLD1)3.454ON445131721.7
Skud_4.3868.284ON44681712.2
YLR099C (ICT1)8.284ON39438702.7
Kpol_YGOB_Anc_6.2986.298ON52022702.7
SAKL0G12078g5.231ON316100692.8
SAKL0H10450g8.524ON39246693.7
Suva_10.1838.284ON39436684.1
YFL048C (EMP47)8.2ON44564684.3
Smik_12.1588.284ON39438684.3
KLTH0F09438g2.329ON67597684.8
Smik_11.7na 1ON314107666.6
TDEL0F041008.284ON43469676.9
Kwal_27.119758.524ON33689668.1
ZYRO0F04356g8.89ON23646658.9
TPHA0A016908.284ON40561669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR147C
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   637   0.0  
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   567   0.0  
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   565   0.0  
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   538   0.0  
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   300   e-101
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   300   e-101
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   284   1e-94
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   280   4e-93
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   278   3e-92
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   277   3e-92
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   273   1e-90
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   267   2e-88
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   248   1e-80
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   247   4e-80
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   238   6e-77
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   205   4e-64
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   199   1e-61
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...    35   0.28 
Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]...    33   0.76 
CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa...    32   1.4  
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               32   1.4  
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    32   1.5  
TDEL0C01180 Chr3 complement(202833..203537) [705 bp, 234 aa] {ON...    32   1.6  
NCAS0D03520 Chr4 (656259..657203) [945 bp, 314 aa] {ON}                32   1.6  
YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}  CLD1Mitoch...    32   1.7  
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    32   2.2  
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    32   2.7  
Kpol_YGOB_Anc_6.298 s1060 complement(42505..44067) [1563 bp, 520...    32   2.7  
SAKL0G12078g Chr7 complement(1027844..1028794) [951 bp, 316 aa] ...    31   2.8  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    31   3.7  
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    31   4.1  
YFL048C Chr6 complement(38843..40180) [1338 bp, 445 aa] {ON}  EM...    31   4.3  
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    31   4.3  
KLTH0F09438g Chr6 (818524..820551) [2028 bp, 675 aa] {ON} simila...    31   4.8  
Smik_11.7 Chr11 (9360..10304) [945 bp, 314 aa] {ON} YKL216W (REAL)     30   6.6  
TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {O...    30   6.9  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    30   8.1  
ZYRO0F04356g Chr6 complement(370432..371142) [711 bp, 236 aa] {O...    30   8.9  
TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.2...    30   9.0  

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180
           SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF
Sbjct: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240
           SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC
Sbjct: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240

Query: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300
           EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI
Sbjct: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300

Query: 301 NAFF 304
           NAFF
Sbjct: 301 NAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/304 (87%), Positives = 286/304 (94%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M ++EYTKSK PCSILNIKPT+T+S EDA LLVWIPGNPGLLYYYQEML +LH KHPDWE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGMTLNAHSNTP++SLQDQVDHQVEVINNFS +NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180
           S+ LVG+VQKVGLVTPTVMDIHTSEMG+K+T AL YIPPLAHVVSLFSYIFFYWILSEGF
Sbjct: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240
           SRFIIDKFMGCGST  QAVLSTRIFLTH+QFVRQSLGLA+QEMEEITTNWEFQD+FINYC
Sbjct: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240

Query: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300
           E+NG  IWFLFSSNDHWVSGKTRSHLS YYKDKV Q RL+IDVTDKIPHSFVVKHA+YAI
Sbjct: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300

Query: 301 NAFF 304
           N FF
Sbjct: 301 NTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/304 (86%), Positives = 283/304 (93%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M V+EYTKS LPCSILNIKP+V    EDAPLLVWIPGNPGLLYYYQEML HLH KHPDWE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120
           ILG+SHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFS +NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180
           S+KLVGSV+K+GL+TPTVMDIHTSEMG+KMTA L YIPPLAHVVSL SY+FFYWILSEG 
Sbjct: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180

Query: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240
           SRF+IDKFMGCGSTGYQAVLSTRI LTH+QFVRQSLGLA+QEM+EITTNWEFQD FINYC
Sbjct: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240

Query: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300
           +EN I IWFLFS+ DHWV+ KTR+HLS YYKDK+KQERLKIDVTDKIPHSFVVKHAEYA+
Sbjct: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300

Query: 301 NAFF 304
           N FF
Sbjct: 301 NTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/304 (81%), Positives = 276/304 (90%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M+++EYTKSKLPCSILNIKPTVT   EDAPLLVWIPGNPGLL+YYQEM+HHLHLKHPDWE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120
           ILGISHAGM+ NA SNTPIFSLQDQVDHQV+VINNFS  NRKIIIMGHSVGAYIVQKVCL
Sbjct: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180
           SN+LVGSV KVGL+TPTVMDIH SEMG+KMT A  Y+P LAHV+S  SY+FFYW+LSEG 
Sbjct: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180

Query: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240
           S+ IIDKFMGCG+ G +AVLSTR+FLTHRQFVRQSLGLA+QE++EITTNWEFQD+FIN+C
Sbjct: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240

Query: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300
           EE GI  WFLFS+ DHWV+ +TR HLS YY DKVKQE L+IDVTDK+PHSFVVKHAEYAI
Sbjct: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300

Query: 301 NAFF 304
           NAFF
Sbjct: 301 NAFF 304

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  300 bits (767), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 205/310 (66%), Gaps = 7/310 (2%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVT-KSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDW 59
           MT++ Y  S+ P SI++  P    K  ED PL +WIPGNPGLL YY +ML  LH K+P W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGISHAGMTLNAHS-----NTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYI 114
           EILG+SHAGM+ N +      +T +++L +QV H+VEVINNFS   R IIIMGHSVGAY+
Sbjct: 61  EILGVSHAGMS-NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYM 119

Query: 115 VQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYW 174
            Q+V + + L+G+V K+GLVTPTV+DIH S  GIKMT A      L   + L S + F  
Sbjct: 120 AQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSK 179

Query: 175 ILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQD 234
           +    F+R+++   MGC +    A  ++ +FLT+  FV+Q LGLA+ EM+ I  +W FQ 
Sbjct: 180 LFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQK 239

Query: 235 RFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVK 294
           R I+YC +  +S WFLFSS DHWVS  TR+ L ++Y+   K + L + V++ IPHSFV+ 
Sbjct: 240 RLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVIN 299

Query: 295 HAEYAINAFF 304
            +++ +N++F
Sbjct: 300 FSDFTVNSYF 309

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  300 bits (767), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 206/310 (66%), Gaps = 8/310 (2%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M  +EY K   P SI++ K    +   + PL VWIPGNPGL+ YY+E L  +H +HP+WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGISHAGMTLNAHSNTP------IFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYI 114
           +LGISHAGM+  + S +       ++SL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 115 VQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYW 174
           VQ + LS+KLVG V K+GL+TPT++DIHTS+ G+ +T  L ++  L  +   FS + F +
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 175 ILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQD 234
            L     R ++  FMGC       VL+T + L + +FV+Q+LGL+  EMEEI ++W FQ 
Sbjct: 181 FLPSFILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239

Query: 235 RFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVK 294
           R I +C E GIS W LFS +DHWV+  TR  L  +Y+D  + +++KI  T KIPHSFV+ 
Sbjct: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298

Query: 295 HAEYAINAFF 304
           H++Y I+ +F
Sbjct: 299 HSKYLISEYF 308

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  284 bits (726), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 202/316 (63%), Gaps = 15/316 (4%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M+V+ Y   + P  +++I P   K+ E  P+ VWIPGNPG+L YYQEML +LH KHP WE
Sbjct: 1   MSVEAYDDDEFPTCVVHILPI--KTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  ILGISHAGMTLNAHS--------NTPIFSLQDQVDHQVEVINNF-SCKNRKIIIMGHSVG 111
           IL ISH GM     S        N+ +F+L++Q+ H++++INNF    N  I I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 112 AYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRY-IPPLAHVVSLFSYI 170
           AY+VQK+  S++L+G V K+GL+TPT++DIH SE G  MT   R+    L H++S   YI
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 171 FFYWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNW 230
            F W++      +II   MGC     QA +ST +FLT   FVRQSLGLA +EM+ I  +W
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 231 EFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQER--LKIDVTDKIP 288
           +FQ   I YC +N I I FLFS+ DHWV   TR  +  +Y+++ K  +  LKIDV+D+ P
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 289 HSFVVKHAEYAINAFF 304
           HSFVV+ ++Y +  +F
Sbjct: 298 HSFVVRRSKYVVEHYF 313

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  280 bits (716), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 198/312 (63%), Gaps = 12/312 (3%)

Query: 3   VKEYTKSKLPCSILNIKP-TVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEI 61
           VK +  S  P SI+++ P T   S ED+PL VWIPGNPGLL YY + L  +H K+P WE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 62  LGISHAGMTLNAHSNTP---------IFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGA 112
           LGISHAGM+ + +             +F L++QV H+V++IN FS KNR +IIMGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 113 YIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFF 172
           Y+ Q+V ++NKL G + KVG +TPTV+DIH S+ GIKMT    +   L H V   S   F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 173 YWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEF 232
           + +L   F +F I K + C S    AVL++   L +   + Q+LGLA  EME I  +W F
Sbjct: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242

Query: 233 QDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFV 292
             + I+YC E G+  WFLF+ +DHWV+  TR  + D+Y+   K E ++ID+ D IPH+FV
Sbjct: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301

Query: 293 VKHAEYAINAFF 304
           +K ++Y ++ +F
Sbjct: 302 IKKSKYIVDQYF 313

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  278 bits (710), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 191/312 (61%), Gaps = 8/312 (2%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M+V+ Y  S LP  I++IKPTVT + E +PL VWIPGNPGLL YYQE L  +H K+P WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAGMTLNA-------HSNTPIFSLQDQVDHQVEVINNFSCK-NRKIIIMGHSVGA 112
           ILGISHAG  + +        +  PI+ L+ Q  H++++IN  +   NR+++IMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 113 YIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFF 172
           YI Q V  S  LVG V K+GL+TPT+ DIH S  G+  T    YI  +   +S  S   F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 173 YWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEF 232
             ++   +++ +I   MGC    Y  +L T + LT R+ +RQ LGLAA EM EI  +W F
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 233 QDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFV 292
           Q+  +  C++NG  +W LFS NDHWVS  T++ L  + KD+  +  L++DV   I HSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 293 VKHAEYAINAFF 304
           VK  +     +F
Sbjct: 301 VKDVDLVTRRYF 312

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  277 bits (709), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 137/293 (46%), Positives = 192/293 (65%), Gaps = 2/293 (0%)

Query: 12  PCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTL 71
           P SIL++K  V+  G DA L V+IPGNPGL+ YY   L  +H K+PDWEILGISHAGM  
Sbjct: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71

Query: 72  NAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKV 131
                 P+++LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V +V
Sbjct: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131

Query: 132 GLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGC 191
           GL+TPTV+DIH SE G+K+TA     P    +VS   +I F  +  +  + +II  F   
Sbjct: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191

Query: 192 GSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLF 251
             T   A  +TR+ LT+ +FV+Q+LGLA +EM+ I ++WE+Q  F++YCE  G  IW+LF
Sbjct: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249

Query: 252 SSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAINAFF 304
           S NDHWVS +TR  L  +Y+     E + IDV+  I H+FV +HA+  +  +F
Sbjct: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  273 bits (699), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 203/318 (63%), Gaps = 16/318 (5%)

Query: 1   MTVKEYTKSKLPCSILNIKPT---------VTKSGEDAPLLVWIPGNPGLLYYYQEMLHH 51
           MT+  +  SK P SIL+IK T         +TK+ + +PL VWIPGNPGLL YY+E L  
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  LHLKHPDWEILGISHAGMTLNAHSN-----TPIFSLQDQVDHQVEVINNFSCKNRKIIIM 106
           LH+K+P+W+ILGISHAGM+ + +SN       +++L +Q+ H++E+IN F+   R++I+M
Sbjct: 61  LHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119

Query: 107 GHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSL 166
           GHSVGA++ QKV +SNKL G V+K+GL+ PTV+DIH SE G +++  L +IP L  +   
Sbjct: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179

Query: 167 FSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEI 226
            S   F   L     +FII  FM   +   +A  +T  FL    FV QSLGLA  EM+ I
Sbjct: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238

Query: 227 TTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDK 286
             +WEFQ   +  C  N I +W LF+ +DHWVS +TRS L + Y++ V  +     +TD+
Sbjct: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298

Query: 287 IPHSFVVKHAEYAINAFF 304
           +PH+FV+K++ + ++ +F
Sbjct: 299 VPHAFVIKNSCHVVDNYF 316

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  267 bits (683), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 126/294 (42%), Positives = 191/294 (64%), Gaps = 2/294 (0%)

Query: 11  LPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMT 70
           LPCS+ +    +  SG +APL V+IPGNPGL+ +Y+  L  +H K+P WEILGISHAGM 
Sbjct: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70

Query: 71  LNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQK 130
             +   +P++SL+ Q+DH++E+IN +    + IIIMGHSVGA++VQK+  S +L   V +
Sbjct: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130

Query: 131 VGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMG 190
           VGL+TPTV+DIH SE G+K+T+  R+ P   +VVS  ++  F  +L    ++ II   + 
Sbjct: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190

Query: 191 CGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL 250
              +   A  +T + +T+ +FV+Q+LGLAA+E+  I ++W +Q  F+  C+EN   IW+L
Sbjct: 191 DPQSCLGA--TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248

Query: 251 FSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAINAFF 304
           FS  DHWVS  TR+ + D+Y+        +IDV+  I H+FV +HA+  I  +F
Sbjct: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  248 bits (632), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 194/308 (62%), Gaps = 7/308 (2%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M+++    ++LP S+L+IKP        +PL VWIPGNPG++ YY+E L+ LH K+  +E
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPS--SPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  ILGISHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQ 116
           IL ISHAGM             I++L DQ+ H+VE+IN FS K+R +I+MGHSVGAY+ Q
Sbjct: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118

Query: 117 KVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWIL 176
            V L+ KL+G V K+GL+TPTV+DIH S+ G ++T A  ++  L  + +  S + F  + 
Sbjct: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178

Query: 177 SEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRF 236
           S  F+  +I  FMG        V +++  + + + +RQ+LGLAA EM++I   W FQ + 
Sbjct: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237

Query: 237 INYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHA 296
           I++C  N I   F+FS+ND WVS  TR  L  +Y++  +   L+I V+  + HSF+VKH+
Sbjct: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297

Query: 297 EYAINAFF 304
           +Y ++ +F
Sbjct: 298 KYIVDEYF 305

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  247 bits (631), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 133/333 (39%), Positives = 197/333 (59%), Gaps = 33/333 (9%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDA--PLLVWIPGNPGLLYYYQEMLHHLHLKHPD 58
           M VK Y++SK P SI++I+       + +  PL +WIPGNPG+L YYQ+ L  LH KHP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGISHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSCK---------NRKIII 105
           WEIL I HAGM  +     H N  I+ L +Q++H++EVI  F  K          R ++I
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 106 MGHSVGAYIVQKVCLSNKLVGSV-------QKVGLVTPTVMDIHTSEMGIKMTAALR--- 155
           MGHSVG Y++Q++ L+ +   ++       +K+G +TPT++DI+ S  GI ++  L+   
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 156 -YIPPLAHVVSLFSYIFFYWILS--EGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFV 212
            Y+P   +++S  SY  F  IL   +   R +I   MGC  T + A+  T I LT+   V
Sbjct: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236

Query: 213 RQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKD 272
           +QSLGLA+ EM+EI  NW+ Q +F+  C  N I +W LF   DHWV+  TR+ L  +Y+ 
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 273 KVKQ-ERLKIDVTDKIPHSFVVKHAEYAINAFF 304
             K   RL+I+V+ + PHSFVV H+++ +  FF
Sbjct: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  238 bits (608), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 118/306 (38%), Positives = 189/306 (61%), Gaps = 5/306 (1%)

Query: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60
           M ++ Y+K+    S+ ++KP   +     PL V+IPGNPGL+ +Y+  L  +  KH +WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGMTLNAHS---NTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQK 117
           ILGISHAGM          T ++SL+DQV H++ VIN+F   NR +II GHS+GAYIVQK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 118 VCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILS 177
           + L   L+G+V+K+ L+TPTV+DIH SE G K+     + P     V+  S++ F  +L 
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 EGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFI 237
           +  +  I+  F+G   T  +   + ++ +T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238

Query: 238 NYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAE 297
            +C+   + + FLF+  DHWV+ +TR  L+++Y     ++ L ID  +KI HSFV+   +
Sbjct: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298

Query: 298 YAINAF 303
             ++ +
Sbjct: 299 SVVDRY 304

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  205 bits (522), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 183/311 (58%), Gaps = 15/311 (4%)

Query: 3   VKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEIL 62
           ++ Y +  +   IL+I    T  G   PLL++IPGNPGL+ +Y+E L  +H ++P WE++
Sbjct: 1   METYLREDIFADILHIYSQSTPPG---PLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57

Query: 63  GISHAGMTLNAHSNT---PIFSLQDQVDHQVEVINNF--SCKNRKIIIMGHSVGAYIVQK 117
           GI H GM+    +N+    + +L +Q++ +V+VIN F  +  +R I ++GHS+GAY+VQK
Sbjct: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117

Query: 118 VCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILS 177
           + L   L G +  V L+TPT++DIH S  G+++T    + P       +   + F WIL 
Sbjct: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177

Query: 178 EGFSRFIIDKFMGCGSTGYQAVL-STRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRF 236
             +  +I  K +G GS   + VL S +  ++  +FV+Q+LGLA  EM ++   W+FQD F
Sbjct: 178 TSWIEWIARKLIG-GSD--ECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEF 234

Query: 237 INYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKV---KQERLKIDVTDKIPHSFVV 293
           I++C+ N I + FLFS +DHWV   T   + + Y+ K    +++ L I +   I HSFVV
Sbjct: 235 ISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVV 294

Query: 294 KHAEYAINAFF 304
           K     +N +F
Sbjct: 295 KDTTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  199 bits (507), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 168/282 (59%), Gaps = 11/282 (3%)

Query: 31  LLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSN--TPIFSLQDQVDH 88
           +L+++PGNPGL+ +Y+E L  +H K+P WEI+GISH GM+          +++L +QV+H
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100

Query: 89  QVEVINNF--SCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEM 146
           +V+ IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V+ VGL+TPT++DIH S  
Sbjct: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160

Query: 147 GIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVL-STRIF 205
           G+++T    + P     VS+   +   W+L   +  ++  K +G GS   + VL S    
Sbjct: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSD--ECVLQSAEKL 217

Query: 206 LTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSH 265
           + +  +VRQ+LG+A  EM ++   W+FQ+ FI  C+E   S+W LFS +DHWV   T   
Sbjct: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277

Query: 266 LSDYYKDKV---KQERLKIDVTDKIPHSFVVKHAEYAINAFF 304
           + ++Y+ K        L+I + + I HSFVVK     +N +F
Sbjct: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 16/133 (12%)

Query: 16  LNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHS 75
           L I+P      +    L+++ G    L +Y +   HL L    W I  I   G   ++  
Sbjct: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178

Query: 76  NTPIFSLQDQVDHQVEVINNFSCKNRKI-----------IIMGHSVGAYIVQKVCLSNKL 124
           + P    Q   D    V + F  + R +           I+M HS+GAY++      NK 
Sbjct: 179 DFP---FQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKY 233

Query: 125 VGSVQKVGLVTPT 137
             SV+K+ + +P 
Sbjct: 234 PDSVKKMVMCSPA 246

>Kwal_27.12317 s27 complement(1173365..1174672) [1308 bp, 435 aa]
           {ON} YGR110W - Hypothetical ORF [contig 20] FULL
          Length = 435

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 16  LNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHS 75
            NI+PT   + +    L+ + G    L ++ +   +L+L + +W I  I   G   ++  
Sbjct: 128 FNIRPTAVDTSKTMKHLILVHGYGAGLGFFLKTFENLNLINENWMIHAIDLPGYGFSSRP 187

Query: 76  NTPIFSLQDQVDHQVEVI--NNFS--CKNRKII-------IMGHSVGAYIVQKVCLSNKL 124
             P F + D    QVE    + F    + R ++       ++ HS+GAY+      +NK 
Sbjct: 188 PFP-FKVGDSTPAQVEQWFHSRFHRWMERRGLLETPENNMVVAHSMGAYLT--ALYANKH 244

Query: 125 VGSVQKVGLVTPTVMDIHTSEM 146
            G  +K+ + +P  +     EM
Sbjct: 245 PGHFKKLVMCSPAGVCHSAPEM 266

>CAGL0M11462g Chr13 complement(1129244..1130404) [1161 bp, 386 aa]
           {ON} similar to uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 386

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 82  LQDQVDHQVEVINNFSCKNR--KIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVM 139
           LQ   D+ VE I  +  +N   K  ++GHS G Y+  K  L  K   SV K+ L++P  M
Sbjct: 142 LQQYEDYYVESIEQWRKENNLDKFNLVGHSFGGYLSYKYAL--KYPESVNKLCLLSPLGM 199

Query: 140 D--IHT 143
           +  IH+
Sbjct: 200 ERNIHS 205

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 55/107 (51%), Gaps = 3/107 (2%)

Query: 31  LLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSNTPIFSLQDQVDHQV 90
           L + IPG  G L  ++ ++  +   + ++  + +   G + + +SN  +  +   +D  +
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSED-YSNYSMTHIATLIDQML 140

Query: 91  EVINNFSCKNRKIIIMGHSVGAYIVQKVC-LSNKLVGSVQKVGLVTP 136
           E +   +  N KI +MGHS+G ++      L NK   +V+K+ LV+P
Sbjct: 141 ETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKY-TVEKLILVSP 186

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 13/108 (12%)

Query: 91  EVINNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKM 150
           +V + +   N KII+ GHS+G Y+        K    +QK+ L+ P   + H + +  K 
Sbjct: 153 QVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAPP--NPHETRLD-KS 209

Query: 151 TAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTGYQA 198
             + R+I     + ++FS+    WI    F R   D+  G  S+G ++
Sbjct: 210 NYSTRFI-----IRTMFSW---SWIFD--FYRKRFDQSKGLQSSGIKS 247

>TDEL0C01180 Chr3 complement(202833..203537) [705 bp, 234 aa] {ON}
           Anc_8.89 YPL002C
          Length = 234

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 211 FVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYY 270
           F  + L  A +   EI  N EF+ +F+  C   GI    LF  N+H        +L+D+Y
Sbjct: 40  FQERLLQFAKKHNSEIKANPEFRSKFMRMCTSIGIDPLSLFDKNEHLF------NLNDFY 93

>NCAS0D03520 Chr4 (656259..657203) [945 bp, 314 aa] {ON} 
          Length = 314

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 15/112 (13%)

Query: 1   MTVKEYTK---SKLPCSILNIKPTVTKSGEDAPLLVWIP---------GNPGLLYYYQEM 48
           MT KE  +   S+    I     T+ ++G   P  V +P          N G+ YY + +
Sbjct: 27  MTTKELDELAASRAGAFITKSSTTLERAGNPEPRYVSVPLGSINSMGLPNQGIDYYLEYV 86

Query: 49  LHHLHLKHPDWEILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKN 100
           L      HP+   +  S AGM+++ + N  +  +QD   H +  + N SC N
Sbjct: 87  LER-QRTHPNEPAIFFSVAGMSIDENINM-LRKIQDSEFHGITEL-NLSCPN 135

>YGR110W Chr7 (713709..715046) [1338 bp, 445 aa] {ON}
           CLD1Mitochondrial cardiolipin-specific phospholipase;
           functions upstream of Taz1p to generate
           monolyso-cardiolipin; transcription increases upon
           genotoxic stress; involved in restricting Ty1
           transposition; has homology to mammalian CGI-58
          Length = 445

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 11/131 (8%)

Query: 18  IKPTVTKSGE-DAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSN 76
           I+P  T   E D   LV+I G    L ++ +    + L   +W I  I   G   ++   
Sbjct: 128 IRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPK 187

Query: 77  TP-------IFSLQDQVDHQVEV---INNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVG 126
            P       I S+QD    ++       N   +  K I+M HS+G+Y++       K   
Sbjct: 188 FPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESP 247

Query: 127 SVQKVGLVTPT 137
           S +K+ L +P 
Sbjct: 248 SFKKLILCSPA 258

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 58  DWEILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNR--KIIIMGHSVGAYIV 115
           D + +G +   +    ++N   F +Q   D  ++ I  +   N+  K+ I+GHS GAY+ 
Sbjct: 176 DIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMNIVGHSFGAYLS 235

Query: 116 QKVCLSNKLVGSVQKVGLVTP 136
            K  +  K   SV+K+ LV+P
Sbjct: 236 FKYAV--KYPNSVEKLCLVSP 254

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query: 99  KNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTP 136
           K RKI ++GHS G YI  K  L  K   S++K+ L++P
Sbjct: 173 KLRKINVVGHSFGGYISFKYAL--KYPDSIEKLCLISP 208

>Kpol_YGOB_Anc_6.298 s1060 complement(42505..44067) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 18/22 (81%)

Query: 94  NNFSCKNRKIIIMGHSVGAYIV 115
           NN++  NRK +++GHS+GA IV
Sbjct: 160 NNYALTNRKSVLIGHSMGAQIV 181

>SAKL0G12078g Chr7 complement(1027844..1028794) [951 bp, 316 aa]
           {ON} similar to uniprot|Q07913 Saccharomyces cerevisiae
           YLR007W NSE1 Essential nuclear protein required for DNA
           repair forms a complex with Smc5p and Rhc18p
          Length = 316

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 44/100 (44%), Gaps = 5/100 (5%)

Query: 35  IPGNPGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNA-HSNTPIFSLQDQV-DHQVEV 92
           IP +    Y  Q +L    + H +  ILG+ H  M     HS+      + ++ DH  ++
Sbjct: 9   IPDSDKRRYLLQYILQSRGVCHENSLILGLMHLEMDSGTYHSDWAASDWEKRLGDHIADI 68

Query: 93  INNFSCKNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVG 132
               S  N K++  GH +G  +V K    NK   +V + G
Sbjct: 69  NVKLSGLNYKVVRCGHGIGRSVVMK---KNKQYFNVNRTG 105

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 27/46 (58%)

Query: 100 NRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSE 145
           +R ++++GHS+G Y+    C + +   S Q++ L+ P  +D+   E
Sbjct: 195 SRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDLPQVE 240

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 101 RKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTP 136
           RKI ++GHS G YI  K  L  K   S+ K+ L++P
Sbjct: 175 RKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISP 208

>YFL048C Chr6 complement(38843..40180) [1338 bp, 445 aa] {ON}
           EMP47Integral membrane component of endoplasmic
           reticulum-derived COPII-coated vesicles, which function
           in ER to Golgi transport
          Length = 445

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 194 TGYQAVLST-RIFLTHRQFVRQSLGLAA--QEMEEITTNWEFQDRFINYCEENGISIWFL 250
           TG QA L   RI LT +Q  + SL L       +  T  W F+    +   + GIS WF+
Sbjct: 61  TGEQASLEEGRIVLTSKQNSKGSLWLKQGFDLKDSFTMEWTFRSVGYSGQTDGGISFWFV 120

Query: 251 FSSN 254
             SN
Sbjct: 121 QDSN 124

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 99  KNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTP 136
           K RKI ++GHS G YI  K  L  K   S+ K+ L++P
Sbjct: 173 KLRKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISP 208

>KLTH0F09438g Chr6 (818524..820551) [2028 bp, 675 aa] {ON} similar
           to uniprot|P33891 Saccharomyces cerevisiae YGL145W TIP20
           transport protein that interacts with Sec20p required
           for protein transport from the endoplasmic reticulum to
           the golgi apparatus
          Length = 675

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 71  LNAHSNTPIFSLQDQVDHQVEVINNFSCKN-------RKIIIMGHSVGAYIVQKVCLSNK 123
           L+++ +T + +++D V H+++ + N S +N         +    H   A ++  + LSN+
Sbjct: 486 LDSYEDT-VIAVKDSVIHRIKKMLNMSLRNYFKLNEWALVTSEPHQCSAELIAPLSLSNR 544

Query: 124 LVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPL 160
           L+G++    L   T + +    + I +   L Y+  L
Sbjct: 545 LIGTMDSFDLKPHTTLSVKNEVLNIIIHYMLDYVVNL 581

>Smik_11.7 Chr11 (9360..10304) [945 bp, 314 aa] {ON} YKL216W (REAL)
          Length = 314

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 12/107 (11%)

Query: 3   VKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIP---------GNPGLLYYYQEMLHHLH 53
           + E   SK    I     T+ + G   P  + +P          N G+ YY   +L+   
Sbjct: 32  LDELADSKAGAFITKSATTLEREGNPKPRYISVPLGSINSMGLPNEGIDYYLSYVLNR-Q 90

Query: 54  LKHPDWEILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKN 100
            K+PD   +  S AGM+++ + N  +  +QD   + +  + N SC N
Sbjct: 91  KKYPDAPAIFFSVAGMSIDENLNL-LKKIQDSEFNGITEL-NLSCPN 135

>TDEL0F04100 Chr6 complement(756762..758066) [1305 bp, 434 aa] {ON}
           Anc_8.284 YDR125C
          Length = 434

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 99  KNRKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIP 158
           K  KI ++GHS G Y+  K  L  K   S++K+ LV+P  ++     +  K+    +Y  
Sbjct: 212 KLEKINLVGHSFGGYLSFKYAL--KYPNSIEKLCLVSPLGVETSIYSVNNKLEKNTKYAL 269

Query: 159 PLAHVVSLF 167
            L    S F
Sbjct: 270 DLEDPTSNF 278

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 48/89 (53%), Gaps = 11/89 (12%)

Query: 29  APLLVWIPGNPGLLYYYQEMLHHLHLKHPDW---EILGISHAGMTLNAHSNTPIFSLQDQ 85
            P+ V+I G  G L  ++ +L  L + +  +   ++ G  H+   L+++S   I  +  +
Sbjct: 78  GPVYVFIHGLGGTLTQFEPLLRVLDVLNEGFLTIDLPGFGHSD-ELDSYSMLDIAKIIRE 136

Query: 86  VDHQVEVINNFSCKNRKIIIMGHSVGAYI 114
           V   VE     + KN+K+I++GHS+G +I
Sbjct: 137 V--LVE-----TTKNKKVIVVGHSMGCHI 158

>ZYRO0F04356g Chr6 complement(370432..371142) [711 bp, 236 aa] {ON}
           highly similar to uniprot|Q12483 Saccharomyces
           cerevisiae YPL002C SNF8 Component of the ESCRT-II
           complex which is involved in ubiquitin-dependent sorting
           of proteins into the endosome appears to be functionally
           related to SNF7 involved in glucose derepression
          Length = 236

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 211 FVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFLFSSNDH 256
           F  + +G A +   EI  N EF+ +F+  C   GI    LF  + H
Sbjct: 40  FQERLVGFAKKHNSEIQANPEFRSKFVRMCLSIGIDPLSLFDKDKH 85

>TPHA0A01690 Chr1 (344521..345738) [1218 bp, 405 aa] {ON} Anc_8.284
           YDR125C
          Length = 405

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 82  LQDQVDHQVEVINNFSCKNR--KIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVM 139
           L+   ++ ++ I  +  +N+  KI ++GHS G Y+  K     K   S++K+ LV+P  M
Sbjct: 157 LEINENYYIDRIEKWRIENKLDKINLVGHSFGGYLSYKYA--TKYPDSIEKLCLVSPLGM 214

Query: 140 D 140
           +
Sbjct: 215 E 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,211,237
Number of extensions: 1435347
Number of successful extensions: 3577
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3640
Number of HSP's successfully gapped: 49
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)