Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR145C-A3.484ON78783952e-51
Skud_16.4403.484ON76682745e-33
Smik_16.3973.484ON83792721e-32
Suva_16.4753.484ON77682399e-28
Smik_14.1082.17ON76162670.29
ZYRO0D08910g6.311ON234648650.55
Kwal_56.24155singletonOFF84235410.0
NOTE: 8 genes in the same pillar as YPR145C-A were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A KAFR0G03675 NCAS0F03520 KNAG0A07925 Agos_YGOB_YPR145C-A TPHA0D04205 NDAI0B05820 Cgla_YGOB_Anc_3.484

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR145C-A
         (78 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR145C-A Chr16 complement(824690..824926) [237 bp, 78 aa] {ON} ...   156   2e-51
Skud_16.440 Chr16 complement(778385..778615) [231 bp, 76 aa] {ON...   110   5e-33
Smik_16.397 Chr16 complement(696642..696893) [252 bp, 83 aa] {ON...   109   1e-32
Suva_16.475 Chr16 complement(821114..821347) [234 bp, 77 aa] {ON...    97   9e-28
Smik_14.108 Chr14 complement(204166..206451) [2286 bp, 761 aa] {...    30   0.29 
ZYRO0D08910g Chr4 (758822..765862) [7041 bp, 2346 aa] {ON} highl...    30   0.55 
Kwal_56.24155 s56 complement(876906..877160) [255 bp, 84 aa] {OF...    25   10.0 

>YPR145C-A Chr16 complement(824690..824926) [237 bp, 78 aa] {ON}
          Putative protein of unknown function
          Length = 78

 Score =  156 bits (395), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60
          MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR
Sbjct: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60

Query: 61 NLQSQGKRRSDSKESRKL 78
          NLQSQGKRRSDSKESRKL
Sbjct: 61 NLQSQGKRRSDSKESRKL 78

>Skud_16.440 Chr16 complement(778385..778615) [231 bp, 76 aa] {ON}
          YPR145C-A (REAL)
          Length = 76

 Score =  110 bits (274), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 53/68 (77%), Positives = 62/68 (91%)

Query: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60
          MS  FRKIKLIFK++DS+YPQ+YRAE+KS+NKNTVITRHDLLIAHE +QRASL+R +SI 
Sbjct: 1  MSITFRKIKLIFKRNDSEYPQSYRAEMKSKNKNTVITRHDLLIAHEREQRASLDRISSIS 60

Query: 61 NLQSQGKR 68
          NLQSQ KR
Sbjct: 61 NLQSQDKR 68

>Smik_16.397 Chr16 complement(696642..696893) [252 bp, 83 aa] {ON}
          YPR145C-A (REAL)
          Length = 83

 Score =  109 bits (272), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 59/79 (74%), Positives = 67/79 (84%), Gaps = 3/79 (3%)

Query: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60
          MS  FRKIKLIFKK+DS+YPQNYRAE+KS  KNTVITRHDLLIAHE +QRASL+R+NSI 
Sbjct: 1  MSITFRKIKLIFKKNDSRYPQNYRAEMKS--KNTVITRHDLLIAHEREQRASLDRTNSIS 58

Query: 61 NLQSQGKRRSD-SKESRKL 78
          NLQS  KRR + SK + KL
Sbjct: 59 NLQSHEKRREERSKRAYKL 77

>Suva_16.475 Chr16 complement(821114..821347) [234 bp, 77 aa] {ON}
          YPR145C-A (REAL)
          Length = 77

 Score = 96.7 bits (239), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%)

Query: 1  MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIR 60
          MS  F+KIKL+FK++D QY  NY  E+K +NKNTVITRHDLLIA+E +QRASL+RSNSIR
Sbjct: 1  MSATFKKIKLMFKRNDRQYSPNYGTEMKPKNKNTVITRHDLLIAYEKEQRASLDRSNSIR 60

Query: 61 NLQSQGKR 68
          NL  Q KR
Sbjct: 61 NLHLQDKR 68

>Smik_14.108 Chr14 complement(204166..206451) [2286 bp, 761 aa] {ON}
           YNL224C (REAL)
          Length = 761

 Score = 30.4 bits (67), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 3   TAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMKQRASLERSNSIRNL 62
            AFRK  + F K+   Y  ++    K R KN V++R ++L    ++   S E +N+I N+
Sbjct: 114 AAFRKRPMQFVKAKEVYDPSHDMIQKLREKNLVVSRENIL---GIEAEVSEEPTNAIHNV 170

Query: 63  QS 64
           Q+
Sbjct: 171 QN 172

>ZYRO0D08910g Chr4 (758822..765862) [7041 bp, 2346 aa] {ON} highly
            similar to uniprot|Q00955 Saccharomyces cerevisiae
            YNR016C ACC1 Acetyl-CoA carboxylase biotin containing
            enzyme that catalyzes the carboxylation of acetyl-CoA to
            form malonyl-CoA required for de novo biosynthesis of
            long-chain fatty acids or YMR207C uniprot|P32874
            Saccharomyces cerevisiae YMR207C HFA1 Mitochondrial
            acetyl-coenzyme A carboxylase, catalyzes the production
            of malonyl-CoA in mitochondrial fatty acid biosynthesis
          Length = 2346

 Score = 29.6 bits (65), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 1    MSTAFRKIKLIFKKSDSQYPQNYRAEIKSRNKNTVITRHDLLIAHEMK 48
            +S+A R+I  IF  SD  YP+ Y  +  +  ++  I   +  +A++++
Sbjct: 1367 ISSAIRRITFIFGYSDGSYPKYYTFKGPAYEEDKTIRHIEPALAYQLE 1414

>Kwal_56.24155 s56 complement(876906..877160) [255 bp, 84 aa]
          {OFF} [contig 165] FULL
          Length = 84

 Score = 25.4 bits (54), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 5  FRKIKLIFKKSDSQYPQNYRAEI 27
          +RKIK I+KK  SQ P++ + EI
Sbjct: 35 YRKIKEIYKKKQSQAPRDSQCEI 57

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.124    0.320 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,324,290
Number of extensions: 240106
Number of successful extensions: 970
Number of sequences better than 10.0: 23
Number of HSP's gapped: 969
Number of HSP's successfully gapped: 23
Length of query: 78
Length of database: 53,481,399
Length adjustment: 50
Effective length of query: 28
Effective length of database: 47,748,099
Effective search space: 1336946772
Effective search space used: 1336946772
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)