Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPR122W (AXL1)3.455ON1208120862350.0
Smik_16.3713.455ON1208120853460.0
Skud_16.4123.455ON1208120850450.0
Suva_16.4513.455ON1218121848000.0
NCAS0A116303.455ON1201119731280.0
NDAI0A046503.455ON1199120830470.0
KAFR0A053703.455ON1201121729340.0
Kpol_1050.883.455ON1213121628540.0
ZYRO0C06336g3.455ON1189121127250.0
TDEL0F034003.455ON1170120826550.0
SAKL0F06886g3.455ON1183121025910.0
KNAG0A077403.455ON1197118425480.0
TBLA0C054503.455ON1202121725380.0
Ecym_44043.455ON1196120425110.0
AGR251C3.455ON1193120323920.0
Kwal_55.204643.455ON1189120923710.0
KLTH0E05104g3.455ON1185120722840.0
TPHA0D040603.455ON1201115922800.0
KLLA0D15631g3.455ON1170116720360.0
CAGL0D04686g3.455ON1181118916010.0
KAFR0A059704.246ON10119844116e-40
TDEL0E012504.246ON9952344053e-39
NCAS0J014704.246ON9952484036e-39
TBLA0I029404.246ON9652383911e-37
NDAI0J022404.246ON9992263902e-37
KLTH0D14278g4.246ON10012383893e-37
Skud_12.4744.246ON10222253893e-37
KNAG0B060804.246ON9962263813e-36
SAKL0H03124g4.246ON10062403777e-36
YLR389C (STE23)4.246ON10272253761e-35
Kpol_1055.834.246ON10202293742e-35
AER053C4.246ON10132253742e-35
KLLA0E05105g4.246ON10042253732e-35
CAGL0H06457g4.246ON10082373732e-35
Kwal_23.42374.246ON10012443705e-35
TPHA0B022604.246ON10412263689e-35
ZYRO0B12320g4.246ON9942253671e-34
Smik_12.4764.246ON10252253634e-34
Suva_10.5064.246ON10232253617e-34
Ecym_32734.246ON10232283402e-31
TBLA0A080504.246ON9952323026e-27
AGL138C8.376ON4702261362e-07
Kwal_23.33458.376ON4582281335e-07
KLTH0F08954g8.376ON4582381318e-07
KLLA0D18095g8.376ON4692231318e-07
NDAI0G023208.376ON4632201254e-06
Smik_12.2258.376ON4622261254e-06
NCAS0C029708.376ON4612331245e-06
YLR163C (MAS1)8.376ON4622261211e-05
SAKL0H14168g8.376ON4612231202e-05
KAFR0H020308.376ON4622231202e-05
KNAG0A027608.376ON4672281173e-05
Suva_10.2608.376ON4622261165e-05
TPHA0C024508.376ON4692311148e-05
TDEL0F050008.376ON4562311131e-04
Ecym_41918.376ON4622571131e-04
Skud_12.2308.376ON4622261121e-04
ZYRO0C03806g8.376ON4652261102e-04
CAGL0H02739g8.376ON4652261094e-04
TBLA0H010108.376ON4992281076e-04
Kpol_1024.23singletonOFF4542271059e-04
Kpol_YGOB_1024.238.376ON4642271059e-04
TBLA0A069405.541ON9911551060.001
Kwal_56.226883.93ON1040971020.003
CAGL0I07535g3.93ON1021106990.006
SAKL0G05236g5.541ON986103940.025
KLTH0C09570g3.93ON104297920.039
AFR334W3.93ON1029169920.040
ZYRO0B06490g3.93ON1028158920.048
NCAS0F011405.541ON988117900.073
SAKL0C09504g3.93ON106997900.074
Ecym_35853.93ON1032138900.081
TPHA0P010403.93ON1038106870.17
Kpol_1004.325.541ON988108870.18
KAFR0E032505.541ON984100860.22
NCAS0C049503.93ON103297850.26
YOL098C3.93ON103797840.37
ZYRO0D12870g5.541ON98698840.43
Kwal_47.185775.541ON98788830.46
KLLA0F27071g3.93ON1037115830.53
TBLA0B082403.93ON1032106830.56
ADR184W5.541ON990112820.58
KLLA0B00957g5.541ON98288820.72
Skud_15.553.93ON1038173810.80
NDAI0G042803.93ON103497810.84
Smik_15.583.93ON1038173810.95
KAFR0C014303.93ON1035152801.1
KNAG0C031705.541ON99486791.3
TPHA0D024305.541ON98889791.5
KLTH0G04092g5.541ON99088782.0
TDEL0D053103.93ON1035215782.0
CAGL0F03157g5.541ON99093762.9
TDEL0A040405.541ON98790763.1
KNAG0E036007.172ON755115763.3
Skud_4.7055.541ON98962754.7
Smik_4.7045.541ON98962754.7
Suva_2.6065.541ON98962745.1
Ecym_40765.541ON98857738.0
Smik_5.1087.137ON28182718.2
ZYRO0D10956g8.699ON610147728.5
YDR430C (CYM1)5.541ON98962729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPR122W
         (1208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  2406   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  2063   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  1947   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...  1853   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...  1209   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...  1178   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...  1134   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...  1103   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...  1054   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....  1027   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...  1002   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   986   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   982   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   971   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   926   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   917   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   884   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   882   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   788   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   621   0.0  
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   162   6e-40
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   160   3e-39
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   159   6e-39
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   155   1e-37
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   154   2e-37
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   154   3e-37
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   154   3e-37
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   151   3e-36
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   149   7e-36
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   149   1e-35
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   148   2e-35
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   148   2e-35
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   148   2e-35
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   148   2e-35
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   147   5e-35
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   146   9e-35
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   145   1e-34
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   144   4e-34
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   143   7e-34
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   135   2e-31
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   120   6e-27
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    57   2e-07
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    56   5e-07
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    55   8e-07
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    55   8e-07
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    53   4e-06
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    53   4e-06
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     52   5e-06
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    51   1e-05
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    51   2e-05
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    51   2e-05
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    50   3e-05
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    49   5e-05
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    49   8e-05
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    48   1e-04
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    48   1e-04
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    48   1e-04
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    47   2e-04
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    47   4e-04
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    46   6e-04
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    45   9e-04
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    45   9e-04
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    45   0.001
Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL09...    44   0.003
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    43   0.006
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    41   0.025
KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa] ...    40   0.039
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    40   0.040
ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} simil...    40   0.048
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    39   0.073
SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa] ...    39   0.074
Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} simila...    39   0.081
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    38   0.17 
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    38   0.18 
KAFR0E03250 Chr5 (647254..650208) [2955 bp, 984 aa] {ON} Anc_5.5...    38   0.22 
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    37   0.26 
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    37   0.37 
ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]...    37   0.43 
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    37   0.46 
KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa...    37   0.53 
TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON} Anc_...    37   0.56 
ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic ...    36   0.58 
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    36   0.72 
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    36   0.80 
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    36   0.84 
Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON...    36   0.95 
KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3....    35   1.1  
KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.5...    35   1.3  
TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {O...    35   1.5  
KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {...    35   2.0  
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    35   2.0  
CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {...    34   2.9  
TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {O...    34   3.1  
KNAG0E03600 Chr5 (719840..722107) [2268 bp, 755 aa] {ON} Anc_7.1...    34   3.3  
Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {...    33   4.7  
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    33   4.7  
Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {...    33   5.1  
Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}...    33   8.0  
Smik_5.108 Chr5 complement(149789..150033,150064..150664) [846 b...    32   8.2  
ZYRO0D10956g Chr4 (924444..926276) [1833 bp, 610 aa] {ON} simila...    32   8.5  
YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}...    32   9.0  

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 2406 bits (6235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1177/1208 (97%), Positives = 1177/1208 (97%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFGDIKPKSAVKE                   QDSSKNDYSDLKTFKILNTTWEKKYKNT
Sbjct: 241  KFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYKNT 300

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
            MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS
Sbjct: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
            YYLASKGWLTGCFAFTSEFA            TNSGWENIKRITTIVLNRLLPSFYVMNI
Sbjct: 361  YYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVMNI 420

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
            DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI
Sbjct: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480

Query: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
            DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD
Sbjct: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540

Query: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600
            ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL
Sbjct: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600

Query: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660
            KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS
Sbjct: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660

Query: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720
            PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK
Sbjct: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720

Query: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780
            TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE
Sbjct: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780

Query: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840
            DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG
Sbjct: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840

Query: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900
            SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY
Sbjct: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960
            LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ
Sbjct: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960

Query: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020
            VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM
Sbjct: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020

Query: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080
            RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT
Sbjct: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080

Query: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140
            SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE
Sbjct: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140

Query: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200
            VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP
Sbjct: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200

Query: 1201 NFFRKAAF 1208
            NFFRKAAF
Sbjct: 1201 NFFRKAAF 1208

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 2063 bits (5346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 991/1208 (82%), Positives = 1087/1208 (89%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MSLREVTNYEVSF+IPLSYSNR HK+CKLPNGILAL+ISDPTDTSSSCSL+VCTGSHNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             DI GLAHLCEHMILSAGSKKYPDPGLFH LIAKNNGSQNA+TTGEQTTFYFELPNTQNN
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GEF FESILDVFASFFK+PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILAN DH
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRFSTGNIHSLSSIPQLKKI LKSSLNTYF +NFFGENITLCIRG QSVNILTKLA+S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFGD+KPKS VKE                    +S KNDY +L+ FKIL+T WEKKY+NT
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDFKILDTVWEKKYQNT 300

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
            MCFQ  PECNSIFINSNK+P+MR LFPVSD+NTRFTKDDIKIYSHLWCELFGDESPGSLS
Sbjct: 301  MCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
            +YL S+GW+T CFAFTSEFA            TNSGW++IK ITT + + LLPSFYV NI
Sbjct: 361  HYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSFYVKNI 420

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
            D+L+TFLKEQNLIDL  FLYQSSE+LPMEECS LS  LQ++LECLTP N+FKGFKSLIEI
Sbjct: 421  DHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFKSLIEI 480

Query: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
            DDPNIEKYE TKAN++WWTGQAIKFQNFLKS M HDN RLLLLG+IKS  IF  ++NKS+
Sbjct: 481  DDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHIIENKSE 540

Query: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600
            I TDFFYEFEYYT +VHLA +NK++  SSYEFNFP  NLFLPD +SDPLKL+QLFLECSL
Sbjct: 541  IRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLFLECSL 600

Query: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660
            KSKFATLRPQIYSEPTR +PQLVSEN NYEMWILKEDPNFAS+NKSVVSFEVLGLGIKPS
Sbjct: 601  KSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGLGIKPS 660

Query: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720
            PEATIHLEVLAQ LFIITSS LYPALRIGYTYEIASSSKG+VTLRFTISGFPEGVF IVK
Sbjct: 661  PEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGVFKIVK 720

Query: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780
            TFVDTLKLIATDPTFLSKDTLRKARI VR+KY++ASSDNCVKLAS+GLLIVLE++IWTL+
Sbjct: 721  TFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEFIWTLQ 780

Query: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840
            DRINALELTE+ESF++FC LFW+NPK LVL +QGSL+YAD IN YLN NFTQHLK+ NEG
Sbjct: 781  DRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLKVCNEG 840

Query: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900
            SK TI LYP PSTK+LD+GTNAFISYNGHQDDPNNSIVYFIQTAQRDDI+NL LTFLTEY
Sbjct: 841  SKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENLALTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960
            LFSLTLVPDLRN+KQIGYIVLGGLRVLTDTVGIH+TVMSGSS HNLET+INEYLSYL+LQ
Sbjct: 901  LFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINEYLSYLELQ 960

Query: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020
            VL+  TE DFR++LLEPFL LLKQNS  +FE SAGPVDLLNEIVANVQNGDNYTLNN+QM
Sbjct: 961  VLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDNYTLNNRQM 1020

Query: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080
            +QHRKVRNKI E RLNFQE++EM++I FLQKLTLKKYL FF++KISIYS QRSK+SIMI 
Sbjct: 1021 KQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISIMIA 1080

Query: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140
            SPMAE++IASR++FLQLEAFLKI GFAIKNEDLKKIVEHS+G+P+LLVKNLFT+FR+RNE
Sbjct: 1081 SPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRKRNE 1140

Query: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200
             FKLGTVVLQEILKIIGMN KQ YGS+LGFSS + EGQ+++ FW ND  P++PLQELP+P
Sbjct: 1141 AFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVIPLQELPDP 1200

Query: 1201 NFFRKAAF 1208
            NFFRK  F
Sbjct: 1201 NFFRKYVF 1208

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1947 bits (5045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 937/1208 (77%), Positives = 1053/1208 (87%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MSLREV NYEV  YIPLSYSNRTHK+CKLPNGILAL+ISDPTDTSSSCSL+VCTGSHNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            KD  GLAHLCEHMIL+AGSK+YPD GLFHTLIAKNNGSQNA+TTGEQTTFYFELPN+Q+N
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GEF FE ILDVFASFFK PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAAR+LAN DH
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRFSTGNIHSLSSIPQLKKI LK+SLN YF+NN+FGENIT+CIRGPQSVNIL KLA+S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFGDIKPK++V+                     D SKND+  L++FKIL T WE+KYKN+
Sbjct: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
             CF+  P  N+IFINSNK P++R LFPVSDKNTRFTK+DIKIYSHLWCELFGDESPGSL 
Sbjct: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
             YL S+GW+T CFAFTSEFA            TNSGWE+IK ITT + ++LLPSFYV NI
Sbjct: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
            DYLITFLKEQNLID+  FLYQSSED+PMEECS LS ILQ++LE LTP N+FKGFKSLIEI
Sbjct: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480

Query: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
            DDPNI+KYEN++AN+QWW GQAIKFQNFLKS MNH+N RLL+LGN+KS  +FDK++ +S+
Sbjct: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540

Query: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600
            + TDFFYEFEYYT  V L  D++ ++ S YEFNFPT N+FLPD ++DPLKLQQLFLECSL
Sbjct: 541  MYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600

Query: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660
            KSKFATLRPQI SEPT+  PQLVS+N NYEMW+LKEDPNF SDNKS+VSFE+LGLGIKPS
Sbjct: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660

Query: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720
            PEATIHLEVLAQ LFIITSS+LYPALR+GYTYEIASSSKGNVTLRFTISGF EGV+TI K
Sbjct: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720

Query: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780
            TFVDTLK IATD TFLSKDT+RKARILVR KY+ ASSDNCVKLAS+GLLIVLE+Y+WTL+
Sbjct: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780

Query: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840
            DRI+ALELTE  SF++FC+LFW NPK LVL +QG+LEYAD IN YLNNNFTQHLK+SNE 
Sbjct: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840

Query: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900
            ++PTI LYP PSTK+LD+GTN F+SYNGHQDDPNNSIVYFIQTA+R+DI+++TLTFLTEY
Sbjct: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960
            LFSLTLVPDLRNKKQIGYIVLGGLRVLT+TVGIHITVMSG   HNLE +INEYLSYLQLQ
Sbjct: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960

Query: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020
            VLN FTE DFRRILLEPFL LLKQNS  + E S+GPV+LLNEIVANVQNGDNYTLNN+QM
Sbjct: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020

Query: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080
            +QHRK+RNKI E R +FQ+++EM DI FLQ LTLK+YL FFESKISIYS QRSKLSIMIT
Sbjct: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080

Query: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140
            SPMAE++I SRKMFLQLEAFLKI GFAIK+EDLK IV++SKG+P+LL+KNLFT FRRRNE
Sbjct: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140

Query: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200
             FKLG VVLQEI KII ++ KQRY SILGF     E Q+IEKFW  D  PI+PLQ LP+P
Sbjct: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200

Query: 1201 NFFRKAAF 1208
            N FR+ A 
Sbjct: 1201 NVFRRDAL 1208

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score = 1853 bits (4800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/1218 (74%), Positives = 1037/1218 (85%), Gaps = 10/1218 (0%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MSLREV+NYE+ FYIPLSY NRTHK+CKLPNGILALIISDPTD+SSSCSL+VCTGSHNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            +DI GLAHLCEHMIL+AGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQ+N
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  FES LDVFASFFKEPLFNPLLI KEIYAIQSEHEGN+SSTTKIFYHAAR+LAN DH
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS FSTGNIHSLSS+P L+KI +K+SLNTYF+NNF+GEN+TLC+RG QSVNILTKLA+S
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYS----------DLKTFKILN 290
            KFGDI  K+ +K                    QD+SK              +L+  KI +
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 291  TTWEKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCEL 350
            T WE+KY +  CF+   + NSIFINS+K PI+R LFPVSDKNTRFTK+DIK+YSHLW EL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 351  FGDESPGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNR 410
            FGDESPGSLS+YL SKGW T  FAF SEFA            T +GW +++ I T + ++
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 411  LLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNI 470
            LLPSF   NID+LI FL+EQNLID+  FLYQ+SEDLPMEECS LSGILQ++LECLTP NI
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 471  FKGFKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGN 530
            FKGFKSLIEI+DPNIEKYEN K N+QWWTGQAIKFQNFLKSFMNH+N R+LLLG+IKS N
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540

Query: 531  IFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLK 590
            +FDK++++S+I T+FFYEFEYY   VHL+ D+K+HS S YEFNFPT N FLPD V+DPLK
Sbjct: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600

Query: 591  LQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSF 650
            LQQL+LECSLKSKFATLRPQI SEP    PQLVS+N NYEMW+LKEDPNF SDN SVVSF
Sbjct: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660

Query: 651  EVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISG 710
            EV+GLGIKPSPEATIHLEVLAQ LFI TSS LYPALR GYTYEIASSSKGNVTLRFTISG
Sbjct: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720

Query: 711  FPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLI 770
            F EGVF I K FVDTLKLI TDPTF SKD LRKARILVR+KY++ASSDN VKLAS+GLLI
Sbjct: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780

Query: 771  VLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNF 830
            VLE+Y+WTL+DRI+ALELT++ES + FC LFW+NPK L L +QG+L+YAD IN YLNNNF
Sbjct: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840

Query: 831  TQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIK 890
            TQHLK+ +EG++PTIRLYP P+TK++D GTNAFIS NGHQDDPNNS+ YFIQTAQRD+I+
Sbjct: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900

Query: 891  NLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRI 950
            NLTLTFLTEY+FS TLVPDLRNKKQIGYIVL GLR+LTDT+GIHITVMSGSS H+LET+I
Sbjct: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960

Query: 951  NEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNG 1010
            NEYLSYL+ QVLN FTE  FR +LLEPFL LLK+N+  + +  +GP +LLNEIVANVQNG
Sbjct: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANVQNG 1020

Query: 1011 DNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSA 1070
            D+Y LNN+QM+ HR++RN I+E RL+FQE++EM+DI FLQKLTLKKYL FF S+ISIYS 
Sbjct: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080

Query: 1071 QRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKN 1130
            QRSKLSIMITSPMAE+EIASRKMFLQLEAFLKI GFAIK+ DL+KIVE SKG+P+LL+KN
Sbjct: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140

Query: 1131 LFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSP 1190
            LFT+FR+R+E FKLGTVVL+EI KII +N KQ YGS+LGFSS+D E Q I+K+W +D  P
Sbjct: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200

Query: 1191 IVPLQELPEPNFFRKAAF 1208
            IVPL+ELP P+ FRK AF
Sbjct: 1201 IVPLRELPGPDVFRKYAF 1218

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1209 bits (3128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1197 (52%), Positives = 835/1197 (69%), Gaps = 12/1197 (1%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS +E+ +++V  Y+PL+YSNR HK+C LPNG+L L+ISDP DT +SCSL+V +GSHNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            KDI GLAHLCEHMIL+AGSK YPDPGL+H  ++KNNG  NAFTTGEQTTFYFE+PN  + 
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  F+ ILD+FASFFKEPLFNPLL +KEIYAIQSEH+GN+SS TKI YHA R+L++P H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS+FSTGN+++L+SIP+L+ + L+ +L  YF+ N++   +TLC+RGPQSVNILTK ALS
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFGDIK  +A+                     ++ S  +  DL++F IL  +W +KY + 
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKN--DLESFNILEESWRQKYCDI 298

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
             CF +  + N IFI S+K P +R+LFPV+D  TRFTK +IKI+  LWCELFGDE+ GSL 
Sbjct: 299  PCFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLC 358

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
            YYL  K W+T C+A+TS FA            T++GWEN   I  IVL +L+ +F    +
Sbjct: 359  YYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYV 418

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
              L  F+++QN IDL+ FLYQ  +  PMEECS LS +LQ+DL+      IFKG   + ++
Sbjct: 419  HELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDM 478

Query: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
             + N+    N++ N +WW  QAIKFQ+F+K FMN  N R++LLG+++      K + ++ 
Sbjct: 479  HEGNVGGI-NSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQNT 537

Query: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600
            + T+ FYEFEY  + ++L +     S ++YEF  P  N F+P        L+QLFLE SL
Sbjct: 538  LTTEPFYEFEYKISTINLKAS---QSVNTYEFCIPHKNKFIPSACKGDGVLEQLFLESSL 594

Query: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660
            KS+++ L  QI S     KPQLV  NQ YEMW LKED N   D KS+VSFEVL   +K S
Sbjct: 595  KSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKGS 654

Query: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720
            PE TIHLE+L Q +F + S  LYPA+++GY YEI++SSKG+V LRFTI GF EG+  +++
Sbjct: 655  PENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLIE 714

Query: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780
              + T+  I T P F SK+ LR+AR+LVR+ Y+NA++DNCVKLAS+GLLIVLE+ +W+LE
Sbjct: 715  IIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSLE 774

Query: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840
            DRI+ALE   + SF++FC  F    K+L LF+QG+L YAD IN++LN NFT+HL I+ + 
Sbjct: 775  DRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHLDINKDT 834

Query: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900
            S P   L    ST  L  GTN F  Y G  DDPNNSIVYFIQT  R D    TLT  TEY
Sbjct: 835  SLP---LNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEY 891

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960
            + SLTLVP+LRNKKQIGY+V+GGLRVLTDT+G++ITVMSGS   +LE++I+EY+++++  
Sbjct: 892  IMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENG 951

Query: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020
            VLNR TE  F R   + +L LL  N+  +    +GP +LLNEIV NVQ G +  LN+  M
Sbjct: 952  VLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSM 1011

Query: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080
            + HR+ RN+I++ + NF ++   IDI  ++KLTL  YL FF+ KISI+S  RSKLSIMIT
Sbjct: 1012 KLHRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMIT 1071

Query: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140
            S MA K+I +RK +LQLEAFLKI GF IK E L++IV+ + GN  LL+KNLF YFR RNE
Sbjct: 1072 SSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNE 1131

Query: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQEL 1197
             +KL TVVL+E++K+   +LKQ Y   L    +D + + ++  WN   S  V L+++
Sbjct: 1132 GWKLCTVVLKEVVKMSITSLKQHYNWSLSTKKEDKD-KSVD--WNGPVSSTVELKKV 1185

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1208 (49%), Positives = 808/1208 (66%), Gaps = 19/1208 (1%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS ++V NY+  FYIP  YS+R HK+C+LPNGIL L+ISDP DT S+CSL+V TGSHNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             D+ GLAHLCEHM+L+AGSK YP+ GL+H+++ KNNG+QNAFTTGEQTTFYFE+P TQN+
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  F+ ++DVF+SFFKEPLFNPLL +KEIYAIQSEHEGNISS  KI YHA R++AN DH
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS+FSTGNI++LSSIPQLKKI LK +L  YF  NF+G  +TLC+RGPQSVN LTKL +S
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFGDI+  + +K                      S +   +DL+ + IL +TW+ KY+  
Sbjct: 241  KFGDIRANNGLKRSKFGSISSRLSISSF-----QSKERQPTDLEQYNILKSTWKPKYREA 295

Query: 301  MCFQQFPE-CNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSL 359
             CF    +  N IFI SNK   +R LFPV DK ++F+   + ++ + WCELFGDE+ GSL
Sbjct: 296  PCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSL 355

Query: 360  SYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMN 419
             Y L  K W+T CFA+TSEF+            TN+GW+N+ +I  IVL+  + +F    
Sbjct: 356  CYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDKP 415

Query: 420  IDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIE 479
             D L  FLKEQN IDL+ FLYQ +E  PMEECS +S +LQ+DLE L    +FKG  ++ +
Sbjct: 416  TDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISD 475

Query: 480  IDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKS 539
                +    +  +   + W  QA +FQ FLK FMN  N+ L LLGN K  +       +S
Sbjct: 476  CYSNDNNTVDMIEYEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSL-----RS 530

Query: 540  DICTDFFYEFEYYTANVHLASDNKFHS--NSSYEFNFPTGNLFLPDCVSDPLKLQQLFLE 597
             I   +F   +  + N+      +F    ++ Y F  P  N F+P    D   LQQLFLE
Sbjct: 531  IIRIRYFLLMQCMSLNILNVIYLRFPKLLSTQYTFQVPPPNAFIPPSCQDVTILQQLFLE 590

Query: 598  CSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGI 657
             SLKS+F+T R Q+ +      P L+S N +YEMW L    + + D KS++SFE+    +
Sbjct: 591  SSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRSM 650

Query: 658  KPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFT 717
             PSPE +I+LE+L+Q L  + S  LYP++R+GY+YEI+SS KG++ L+ TI GF EG+ +
Sbjct: 651  IPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGIIS 710

Query: 718  IVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIW 777
            I+ T V TL  I   P F SK+ LR++R+LVRN Y+ A+SDNCV LAS+GLLI+LE+ +W
Sbjct: 711  ILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNMW 770

Query: 778  TLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKIS 837
            TL+DR+ ALE  ++ SF++FC  F   P ++ L +QG+L+Y + IN YLN N T HL+ S
Sbjct: 771  TLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNLTHHLECS 830

Query: 838  N-EGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTF 896
            N +  K +  L    ST  L+ G+N +  YNGH DDPNNSIVYFIQT  R + + +TLT+
Sbjct: 831  NVKNEKQSSTL----STILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTY 886

Query: 897  LTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSY 956
             TEY+ SLTLVPDLRNK+QIGY V GGLR LT T+GIHITVMSG S  +LE +I+EY++Y
Sbjct: 887  FTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAY 946

Query: 957  LQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLN 1016
            L+  +LN  TE  F     + +L+LL  +   + E S GP DLLNE+VANVQ+G+   LN
Sbjct: 947  LEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELN 1006

Query: 1017 NKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLS 1076
            +  M+ H+   N+I+  R  F+ D E++DI  ++ LT K++L FF  K+SI S  RSK+S
Sbjct: 1007 SHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKIS 1066

Query: 1077 IMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFR 1136
            +MI SPMAE EI +RK FLQL+AFLK+ GF I +E L+ IVE + G P  L+K+LF YFR
Sbjct: 1067 VMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFR 1126

Query: 1137 RRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQE 1196
             RNE  +L TV+L+E++K+   +LK RY   +  SS+    ++    W+ DT P +PL+E
Sbjct: 1127 ERNEALRLCTVILKEVVKVSASSLKHRYTPKVS-SSKMKPKRQSSSNWDQDTEPAIPLKE 1185

Query: 1197 LPEPNFFR 1204
            + + N F+
Sbjct: 1186 IKDLNEFK 1193

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1134 bits (2934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1217 (48%), Positives = 813/1217 (66%), Gaps = 32/1217 (2%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS  EV +++V    PLSYSNRTHK+C LPNGI  L+ISDP DTSS+CSLTV TGSHNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             +I GLAHL EHMIL+AGSK+YPDPGL+H LI+KNNGSQNAFTTGEQTTFYFELP+T   
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  F+ +LDVFASFFK PLFN  +I+KEIYAI++EH  N+S  TKI YH+ R+LAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS+F+TGNI SL +  QL+ I +KS L  YF  +F    +TLC+RGP SVN+LTKLA++
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSS--KNDYSDLKTFKILNTTWEKKYK 298
            KF DIK ++ ++                    +DS   +  YS +++  IL   W K+Y 
Sbjct: 241  KFSDIKSQNDLQRNKFGSISSK----------RDSRQPRQGYSKIESSNILENIWSKRYA 290

Query: 299  NTMCF-QQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPG 357
            N  CF  +  + NSIFI S K P++R LFP+S ++T FT+ +I ++S+ WC LFGDES G
Sbjct: 291  NLPCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEG 350

Query: 358  SLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYV 417
            SL ++L  KGW T   ++ S FA            TNSG   I  I  ++  +++     
Sbjct: 351  SLMHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTT 410

Query: 418  MNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSL 477
             +   +  FL EQN+I+ V FLY+  E  PMEECS LSG+LQ++++ L    +FKG  S+
Sbjct: 411  KHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSI 470

Query: 478  IEIDDPNIEKYEN-TKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLG-NIKSGNIFDKM 535
             ++     +  E+ T   IQW T  AIKFQNFL +FMN++N+RLL LG N K   +  K 
Sbjct: 471  TQLYSGKNQYSESMTDGKIQW-TAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKE 529

Query: 536  KNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLF 595
            K + +  TDFFYEF++Y         +      +Y F  P+ NLF+P        LQQ F
Sbjct: 530  KKRIEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYLQQAF 589

Query: 596  LECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWIL----KEDPNFASDNKSVVSFE 651
             E SLKSK A+LRPQ+  E     P LVS++ NYEMW L       P+  S  K++V+FE
Sbjct: 590  QESSLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRS--KTIVTFE 647

Query: 652  VLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGF 711
            ++   + PS E+TIHLE+LAQ LF + SS LYP+L++GY+Y+IASSSKG+V L+FTISGF
Sbjct: 648  LISTNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGF 707

Query: 712  PEGVFTIVKTFVDTLKLIATDP--TFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLL 769
             EG+  +++  + ++  IA D    +++ + LRKAR+LVR KY  A  +NC KL SVGLL
Sbjct: 708  SEGLLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLL 767

Query: 770  IVLEKYIWTLEDRINALELTELESFEKFC--FLFWRNPKHLVLFMQGSLEYADAINRYLN 827
            I+LE ++WTLEDRI+ALE T++ SF+ F   FLF  +  +  LF+QG+L+ A  I+ YLN
Sbjct: 768  ILLESFLWTLEDRIDALEDTDMTSFKNFVNEFLF-ESFNYFTLFIQGNLDRAHEIHHYLN 826

Query: 828  NNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRD 887
            +N T HL I      P   +   P TK L +G+N F++Y+GH++DPNN+IVYFIQ+  R 
Sbjct: 827  DNLTHHLDI-----LPEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRS 881

Query: 888  DIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLE 947
            D    TLT  TEYL S+TL+PDLR+KKQIGYIV+GG+RVL D++G+HITV+SG+   +LE
Sbjct: 882  DSIAYTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLE 941

Query: 948  TRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANV 1007
             +I+EY+++L+  +L R TE +FR   ++ +L++L   +     G+AG  +LLN+IV+NV
Sbjct: 942  DKIDEYMNFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNV 1001

Query: 1008 QNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISI 1067
             NG+   LN+ +MR+H+++ N+I++   +F +D E+I+   ++ LTLK Y+ FF+ KISI
Sbjct: 1002 ANGEYEILNSSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISI 1061

Query: 1068 YSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILL 1127
            +S +RSKLS+M+TSPM E EI +RK+FLQLEAFLKI GFAIK+  LK+IV+ + G P ++
Sbjct: 1062 HSNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVV 1121

Query: 1128 VKNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNND 1187
            +K L + FR RNE +KL   VL+E+LK  G  LK RYG +L   ++      +EK  N  
Sbjct: 1122 LKLLLSEFRERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYS 1181

Query: 1188 TSPIVPLQELPEPNFFR 1204
              P++PL+ + + N F+
Sbjct: 1182 VKPVIPLKRIEDLNIFK 1198

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1216 (47%), Positives = 791/1216 (65%), Gaps = 16/1216 (1%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS  EV NY++ FY P+SY  RT+K+C+LPNG+L L+ISDP ++S  CSL+V TGSHNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            K+I GLAHLCEHMIL+AGSKKYP+PGL+H LIAKN G QNA+TTGEQTTFYFELPN    
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
                FE I+DVFASFFK+PLFN  L SKEIYAI+SEH GN S+ TKIFYHA R+LAN +H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS FSTGNI++LSS PQL+KI LKS L++YF+ NF  EN+TLCI+GPQSVNILTK+A+ 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSK------------NDYSDLKTFKI 288
             F DIK  +++K+                      S                S L + KI
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 289  LNTTWEKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWC 348
            L   W  KY N +CF   P+ N+I + SNK P++RL+FPV     +F+K+++  + +LWC
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 349  ELFGDESPGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVL 408
            E  GDES  S+   L ++ ++T   AFTS+FA            T+ G  N+  I   ++
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 409  NRLLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPP 468
               +P       + L  FL E + IDL++FL++ SE  PMEECS LSG++Q DL+ L P 
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 469  NIFKGFKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKS 528
             +FK    ++    P I  +  +  + QWW  +A  +Q FL+ +MN D +R+ LL +   
Sbjct: 481  CLFKQSPMIVGNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSE 540

Query: 529  GNIFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDP 588
               F K  ++  + TD FYEF+Y   +V      +   +      FP  N ++P+     
Sbjct: 541  KQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELGRSL 600

Query: 589  LKLQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVV 648
            L L+++  + S +S+   L     S+ TR  P+L  +   YEMW++++    +++ K++V
Sbjct: 601  LYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTIV 660

Query: 649  SFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTI 708
            +F++L L + P+P+ T+HLE+L Q L+++ S  LYP+L++GYTYEIASSSKG+V L FT+
Sbjct: 661  TFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFTL 720

Query: 709  SGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGL 768
            SG+ +G+  +VKT + T   IA D    SK  LR+ARIL R KY++A+++NC KLASVGL
Sbjct: 721  SGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLASVGL 780

Query: 769  LIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNN 828
            +I+LEKYIW LEDR+NALE +++ SF++FC  F R+ K+L L +QG+L+ A+ IN+YLN+
Sbjct: 781  IIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKYLND 840

Query: 829  NFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDD 888
            +FT HL    +  K T  +    +TK L+ GTN    + GH DDPNN IVYFIQT +RDD
Sbjct: 841  SFTNHL--GEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDD 898

Query: 889  IKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLET 948
             K L LT  TEYL SLTLVPDLRNKKQIGY+V GG+RVL+DTVGIHITVMSGS+  +LE 
Sbjct: 899  KKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEE 958

Query: 949  RINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQ 1008
            +I+EYL +L+ +VL + +E  F +  ++ +L+ +  +ST     +AGP ++L+ I ANVQ
Sbjct: 959  KIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQ 1018

Query: 1009 NGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIY 1068
             GD   LN+ QM  HR+++N+I   R NF  D    D++F++ LTLKKYL FFE  ISI 
Sbjct: 1019 AGDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISIS 1078

Query: 1069 SAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLV 1128
            S  RSKLS+ ITSPMA +EI +RK FLQLE FLK+NGF I N+ LK +V  S+G P  L 
Sbjct: 1079 SVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLF 1138

Query: 1129 KNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDT 1188
            K LF YF  R E +K   +V  E+LKII +++K  +  I   SS+  +   I+  W++  
Sbjct: 1139 KLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFP-SSKQSDSSNIQT-WSSSV 1196

Query: 1189 SPIVPLQELPEPNFFR 1204
             P + L ++ + + F+
Sbjct: 1197 KPAITLTKVNDVHIFK 1212

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/1211 (45%), Positives = 801/1211 (66%), Gaps = 29/1211 (2%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            M  +++  Y++ F  P S+  RTHK+CKLPNG+L L+ISDPT+ SS+CSL+V +GSHNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             +I GLAHLCEHM+L+AGS+KYPDPG +H +I KN GSQNAFTTGEQT+FYFELPN  ++
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
             +  F+  LDVFASFF EPLFN  LI+KE YAI+SEH+ N+SS  KIFY A R+LAN +H
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRFSTGNI +L+SIP LK + LK+ L+ YF+ NF    +TLC+RGPQS++ L KLAL+
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDL--KTFKILNTTWEKKYK 298
            KF  IK                             S N++ ++  K   I   TW  KY+
Sbjct: 241  KFSLIKNNPQ----------RYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKNTWLPKYR 290

Query: 299  NTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGS 358
              +CF    +   IFI S+K P +R +FP  ++NTRFT  DIKI +HLW ELFGDESPGS
Sbjct: 291  GQLCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGS 350

Query: 359  LSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVM 418
             S++L SKGW+T  +AF SE A            T +G++N+  I  ++  + +P+    
Sbjct: 351  FSHWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQK 410

Query: 419  NIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLI 478
            N   L  F+ +QN IDL+ FLYQ++E  PMEEC  LS ++QDDLE L P  IFKG   +I
Sbjct: 411  NTLELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMI 470

Query: 479  EIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNK 538
            +    NI  Y   K + +WW GQAIKFQ+FLK FM   NMR+++ GN +   +  +  + 
Sbjct: 471  DEQHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQL--EELSS 528

Query: 539  SDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLEC 598
             +   D FYEFEY+  +  +   +    N+ Y F  P  +  +PD      +L+++  + 
Sbjct: 529  QEFQVDLFYEFEYFKRD-GIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDS 587

Query: 599  SLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIK 658
            S KS+ A L   I++   +  P LVS+N  +EMW++ +D + +   KS+VSFE+ GL ++
Sbjct: 588  SQKSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLE 647

Query: 659  PSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTI 718
              P  T++LE+L Q +FI+ S  +YP+L++G+T EI +S+KG++ L FTISGF + + + 
Sbjct: 648  ACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSF 706

Query: 719  VKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWT 778
            VK+ ++T+K I+ DP FLSK+TLR+ARILVRNKY+NA+++NC  + S+GL IVLEKY+WT
Sbjct: 707  VKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWT 766

Query: 779  LEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLK--- 835
            LEDR+ ALE  ++++F++FC  F  + K+L LF+QG L  AD +N YL+ +FT HL    
Sbjct: 767  LEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGI 826

Query: 836  ISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLT 895
               +G   T+      +TK L+ GTNA + + G +DDPNNSI+YFIQT +R+D    TLT
Sbjct: 827  YETQGKTFTVE-----TTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLT 881

Query: 896  FLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLS 955
              T ++ SL L  +LRNK+Q+GY+V+GGLR+L+++VG+HIT+MSG S  +LET+I+EYL 
Sbjct: 882  NFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLW 941

Query: 956  YLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTL 1015
            YL+ Q L +  E  F +  +  +L LL          S+GP DLL+E+VANVQ GD+  L
Sbjct: 942  YLESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEIL 1000

Query: 1016 NNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKL 1075
            +++ M++H+K++ +I + + +F  + E +D   + +++L++YL+FF+  ISI+S  RSK+
Sbjct: 1001 SSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKI 1060

Query: 1076 SIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYF 1135
            SIMI+S +AEK+I ++K+FLQLE FLKI GFAI  ++LK IVE S G P +L   L++ F
Sbjct: 1061 SIMISSSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCF 1120

Query: 1136 RRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQ 1195
            R RN+  +L +V+L E+ K++  +L+ RYG++    +   + QE    W+ D  P + L+
Sbjct: 1121 RTRNDALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQE----WSTDVKPALDLK 1176

Query: 1196 ELPEPNFFRKA 1206
             + + NFF++ 
Sbjct: 1177 VIEDINFFKRV 1187

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score = 1027 bits (2655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1208 (44%), Positives = 767/1208 (63%), Gaps = 44/1208 (3%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS  +V +  V F+ PLSYSNRTHK+C+LPNGIL L+ISDPT++ S+CSLTV  GS+ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             D+ G+AHLCEHM+L+ GSKKYP PG +H +I KNNGS NAFTTGEQTTFYFELP+    
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
             E  FE  +D+FASFF EPLF+  LI+KEIYAIQ+EH+ N+S+ TKI YHA R+L +  H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRF+TGN+ SL +  +LK   L++ L+ +F  N+    +T+C+RGP SVN L KLA+S
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
            KFG+++P  A ++                      + ND      F IL T W       
Sbjct: 241  KFGELRPHKANEKVQAAL-----------------TPND-----GFNILQTRWGHTKAAN 278

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
             CF    E N+I ++S K+PIMR LFPV  K TRFTK D  I+   W ELFGDES GS  
Sbjct: 279  NCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFC 338

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
            ++L  KGW+T C+A+ S F+            TNSGW NI+ I   ++  L+P F   + 
Sbjct: 339  HFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHT 398

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
              L  FL EQ  IDL+ FLY ++E+ PM ECS L  +LQ+D+  L    IF G   ++  
Sbjct: 399  VQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSPMVLNE 458

Query: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
                    EN ++  +WW GQAIKFQ+FLK FMNH NMRL+LLG ++  ++         
Sbjct: 459  QSTQGLFSENEESQ-KWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKI 517

Query: 541  ICTDFFYEFEYYTANVHLASDNKFHSN--SSYEFNFPTGNLFLPDCVSDPLKLQQLFLEC 598
              TD FY+F Y+T  + L    K H+N  + Y+F+ P  N F P    +   L +     
Sbjct: 518  AGTDPFYDFAYFTCKLSL---RKPHANILNDYKFSIPPKNEFKPSWAENFPSLMRKLYYS 574

Query: 599  SLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIK 658
            S KS+ A+L   I S+     PQLVS+N+NY+MW+L + P  +  +K++VSFE+    I+
Sbjct: 575  STKSQQASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQ 634

Query: 659  PSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTI 718
            PSPE T++LE+LAQ + +  +S LYP+L++G+T+EI  SS+G+V L   ISG+ + +  +
Sbjct: 635  PSPENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKV 694

Query: 719  VKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWT 778
            +++    ++ + ++ +F S++  RKARI VR+ Y  A  ++ + +AS+GLL+V+EKY+W+
Sbjct: 695  IESLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWS 754

Query: 779  LEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISN 838
            L+DRI+A+E  +L++F+ F   F    K L LF+QG L +AD IN  L+ N T HL    
Sbjct: 755  LQDRIDAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHL---- 810

Query: 839  EGSKPTIRLYPP-PSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFL 897
             G++   +  P   STK LD  TN ++ Y G +DDP NS VY+IQT  RDD    TLT L
Sbjct: 811  HGTQTDFQREPEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTAL 870

Query: 898  TEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYL 957
            + Y+ S TL P+LRNK+QIGY+V+GGLR+L + VG+HI++MS      LE +INEYL YL
Sbjct: 871  SAYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYL 930

Query: 958  QLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNN 1017
            + +VL   TE  FR   L+ FLNL  + +  +    +GP DL+++IVANVQ+GD+  LN+
Sbjct: 931  EREVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNS 990

Query: 1018 KQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSI 1077
              M++H+++RN+IA+GR  F +    I+ + LQ+LT+  YL FF  +ISI+S  R+KLS+
Sbjct: 991  SFMKKHKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSV 1050

Query: 1078 MITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRR 1137
            M+ SPM ++EI +R+++ Q++AFLK++G  I+   L+++V+ SKG P+LL K L+  F  
Sbjct: 1051 MVKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHS 1110

Query: 1138 RNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQEL 1197
            R+E +KL TV+L+E+LK++ +NLK R+      ++ +         W   ++P   L  +
Sbjct: 1111 RHETWKLCTVMLRELLKMLTVNLKFRHQRQTNMAASE---------WG--STPATGLTLI 1159

Query: 1198 PEPNFFRK 1205
             + N +RK
Sbjct: 1160 KDINIYRK 1167

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1210 (44%), Positives = 753/1210 (62%), Gaps = 35/1210 (2%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS   V N++V FY P+S S+R+H+V +L NG+L L+IS+P + ++SC+L+V TGSHNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            K+I GLAH CEHMILSAGSK YPDP  +H +I+KN GSQNAFTTGEQTTF FELPN  N+
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
             E  F+ +LD+F+S FK+PLFN LL++KEIYAI SEH  N SS  KIFYHA R+LAN DH
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS+FSTG+I +LS I QL K+ L++ +  YF+NNF+ EN+ LCI+GPQS+N L KL  S
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSD-----LKTFKILNTTWEK 295
            KF DIK     +                       S+N  +D     L++FKIL+  W +
Sbjct: 241  KFNDIKGLPISRPLRTKNQPWLKL----------KSRNFSNDGFGLGLESFKILSRNWLQ 290

Query: 296  KYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDES 355
            KY N   F      N++ ++S K+P +RL+FP+  + TR TK +I + S  WCELFGDES
Sbjct: 291  KYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDES 350

Query: 356  PGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSF 415
             GSL +++    ++T   AF S FA            TN+GW+N++ I  +  N+ +P  
Sbjct: 351  EGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIV 410

Query: 416  YVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKG-- 473
                   L  FL E N I+L+ FLYQ      MEECS LS +L  D+E L P  I KG  
Sbjct: 411  IECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNP 470

Query: 474  FKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFD 533
                 EID   +  +  ++ +  WW G AIKFQ+F+K F+N +N+RL+L+G++K   +  
Sbjct: 471  MNDCNEIDS-ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMK 529

Query: 534  KMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQ 593
                   +  + +YEFEY+      ++        SY F+ P  N+FLP    +   ++ 
Sbjct: 530  TDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKN 589

Query: 594  LFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVL 653
              L  S +S+ A L     +      P+L+ +N  YEMW+ +ED      +KS+V+FE++
Sbjct: 590  ALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEII 649

Query: 654  GLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPE 713
               + P P  T+ LE+L + L  + SS LYP+ +IGYTYEIA+SSKG+V + FT+SGF E
Sbjct: 650  STHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSE 709

Query: 714  GVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLE 773
            GV+ I++  V TL  I      +++D  RK+RI VRNKY+ A+S N   L ++GLLIVLE
Sbjct: 710  GVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLE 769

Query: 774  KYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQH 833
            KY+W LE R+ ALE T++ESF++F   F+ N  ++ LF+QG   Y D IN +L+ N T H
Sbjct: 770  KYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGH 829

Query: 834  LKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLT 893
            L       +  +++   P++  L  G+N FI++ G +DDPNNSIVYFIQT  R D  + T
Sbjct: 830  L----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYT 885

Query: 894  LTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEY 953
            LT  T +L SLTLVPDLR +KQ+GYIVLGGLR L+ TVG+HIT+ S S  H LE +I EY
Sbjct: 886  LTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945

Query: 954  LSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNY 1013
            LSYL+  +L+      FR   ++ +LN++     ++ E    PV+L++ I ANV++G N 
Sbjct: 946  LSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG-NL 1004

Query: 1014 TLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRS 1073
                + M+ HR++R +I+  R NF+++ E ID+  ++ L    Y+ FF+ KISIYS+ RS
Sbjct: 1005 DRVGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRS 1064

Query: 1074 KLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFT 1133
            K+S+M++SPM+  EI +RK+FLQLE+FLK+ GF I  E L+KIV  S G P +L+K LF 
Sbjct: 1065 KISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFR 1124

Query: 1134 YFRRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVP 1193
            YF  R E  K+ TV+L+EI + +  +LK      LG        ++   F   + SP VP
Sbjct: 1125 YFASRGESLKICTVMLKEITRQLSSSLKN-----LG-------ARKSPNFERPNGSPTVP 1172

Query: 1194 LQELPEPNFF 1203
            L E+ +P+ +
Sbjct: 1173 LTEIVDPDAY 1182

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1184 (44%), Positives = 746/1184 (63%), Gaps = 44/1184 (3%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            M+   V NY++ F IPL++S+RTHK+CKLPNG+LAL+ISDP D +S CS+TV TGSHNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            K + GLAHLCEHM+ +AGSKKYPD   +H  ++K  G+ NA+TTGEQTTF+  +PN    
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  F+ ILD+F+SF KEPLFN   ++KEIYAIQSEH+ N+SS +KI Y A R++AN +H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFS+FSTGNIH+L ++P +  + L++ L  YFE NF   NIT+CI+G QSVNILTKLAL+
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLK---TFKILNTTWEKKY 297
             FG I+   A K                    +DS +++   LK   +F+IL   W+ KY
Sbjct: 241  NFGYIQSSRAAK----------GNVIRRSISKRDSIRSNGKKLKKIESFRILEKAWKAKY 290

Query: 298  KNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPG 357
            K+  CF      N + I SNK   MR LFPV++    FT  ++KI+S +W ELFGDES G
Sbjct: 291  KDIKCFDD--RNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKG 348

Query: 358  SLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYV 417
            SL  Y   K W+T    + S+F             T SGWEN++ I + V    L     
Sbjct: 349  SLHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRW 408

Query: 418  MNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSL 477
             N++ L   L E   I+ +++LYQ  E L  + CS+L+ +LQ  L       +FK   +L
Sbjct: 409  ENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNL 468

Query: 478  IEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGN-IKSGNIFDKMK 536
            IE+++   +  EN      WW  QA+KFQNF+  FM   N++L LLG+ +K    F+   
Sbjct: 469  IELNN---DHSENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFELGS 525

Query: 537  NKSDICTDFFYEFEYYTANVHLAS--DNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQL 594
               D  TD +Y F+Y  ++++     D    + + Y    P+ NLF+P    +   LQQ+
Sbjct: 526  QNKDWSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNLANLQQI 585

Query: 595  FLECSLKSKFATLRPQIYSEPTRT----KPQLVSENQNYEMWIL---KEDPNFASDNK-- 645
            F+E SL+S+FA L+PQ+   PT      KP+LV+ + +YEMWIL   KE  + AS ++  
Sbjct: 586  FMEYSLRSRFAVLQPQV---PTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDRIP 642

Query: 646  --SVVSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVT 703
              S V+F +  L + PS   T+HLE+L + L  + +S LYP+L++ Y YEIA+S KG+V 
Sbjct: 643  KQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGDVQ 702

Query: 704  LRFTISGFPEGVFTIVKTFVDTLKLIATDPT---FLSKDTLRKARILVRNKYKNASSDNC 760
            L  TI GF +GV  I    + TL+LI  DP     ++   LRKARI VR+KY+ ASS+ C
Sbjct: 703  LCCTICGFSDGVVKITDYILSTLRLIG-DPATANIVTNSLLRKARIQVRSKYEAASSEIC 761

Query: 761  VKLASVGLLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPK--HLVLFMQGSLEY 818
            VKLAS+GLLIVLE+ +WTLEDR+ ALE +++ SF++FC  F  N    +L LF+QG + Y
Sbjct: 762  VKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMRY 821

Query: 819  ADAINRYLNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIV 878
            AD +N  +++  T HL  S+  S PT       ST  L  G N ++ Y G  DDPNNSIV
Sbjct: 822  ADEVNCLIHSKLTHHLN-SSRCSTPTTDYR--RSTTVLKPGVNYYVEYPGQGDDPNNSIV 878

Query: 879  YFIQTAQRDDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVM 938
            +F+Q   R+D    TL   T YL  LTLVPDLR KKQIGY+VLGGLR++TDTVG+HITVM
Sbjct: 879  HFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVM 938

Query: 939  SGSSGHNLETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVD 998
            S     +LE +I+EY+ YL+  VLN  TE  F  I L+P++ L+ +++  + + S GP +
Sbjct: 939  SAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTN 998

Query: 999  LLNEIVANVQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYL 1058
            LL+EI  NVQNG +  L    M++H+++ N I     +F + ++++D + +Q LTL +Y+
Sbjct: 999  LLSEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYM 1058

Query: 1059 AFFESKISIYSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVE 1118
             FF+ K+S  S  RSK+SIMI SPM  +EI +R+MFLQ+E FLK+ GFAIK+ +L+ IV 
Sbjct: 1059 TFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVN 1118

Query: 1119 HSKGNPILLVKNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQ 1162
             S+G+P  L+++L  +F+ R E +KL  V+ +E+ K++ + +++
Sbjct: 1119 KSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLLALGVRR 1162

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1217 (45%), Positives = 788/1217 (64%), Gaps = 37/1217 (3%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS      +++ FY+P SYSNR  K+C+LPNGILAL+ISD + T+++CS++V TGSH+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
            +DI G+AHLCEHMIL+AGSKKYP PGLFH ++A NNGSQNAFTTGEQTTFYFELP +   
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
             + TF  ILD+F+SFFK+PLFN +L +KEIYAI+SEH+GN+S+T+KI YHA R+L+N  H
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PF  FSTGNIH+LS +  LKK  LK  L  YF+NN+F  N+T+CI+GPQS+N LTKLAL+
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDS-----SKNDYSDLKTFKILNTTWEK 295
             FGDIK K  + +                     S       N+  DL+ FK+L+  W  
Sbjct: 241  NFGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNAWLD 300

Query: 296  KYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDES 355
            KY + +CF      N+IF++S+K PI+RLLFP+S+K TRFTK DIKIYS++WC +FGDE+
Sbjct: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360

Query: 356  PGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLN---RLL 412
             GS   YL    W+T C+AF S FA            TN+G + ++ I  I+L    +LL
Sbjct: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420

Query: 413  PSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFK 472
               +  N+ Y   FL E N+I ++ F+    E  PM+ECS+LSG+LQ++ +   P  +F 
Sbjct: 421  VDNFTENLAY---FLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFY 477

Query: 473  GFKSLIEIDDPNIEKYENTKAN-IQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKS-GN 530
            G + L+  ++   +K      N   +W GQAIKFQ FLK FMN +N++++ +G+I    N
Sbjct: 478  GSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKN 537

Query: 531  IFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLK 590
            + + +K  S   TD +YEFEY    +   S         Y F +P  N +LP    +   
Sbjct: 538  VLNIVKEMSK-KTDLYYEFEYQKLKI---SKKSRICPRDYPFTYPIKNEYLPKFGYNLGL 593

Query: 591  LQQLFLECSLKSKFATL-RPQIYSEPTRTKPQLVSENQNYEMWI-LKEDPNFASDNKSVV 648
            L+ + L     S+  +   PQ+  E  + K  LVS+N  +++W+  K   +  S++  +V
Sbjct: 594  LRNILLNNLESSRTVSFYMPQVSEEEDQNK--LVSQNDMHKLWVNPKNSKDQLSESPCIV 651

Query: 649  SFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTI 708
            SF+++   I+ SPE+T+HLE++ Q L  +  + LYPAL +GYT+EI+ S +G+V+L FT+
Sbjct: 652  SFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTL 711

Query: 709  SGFPEGVFTIVKTFVDTL-KLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVG 767
            SGF EG+F I+K  ++   +L ++D   ++K   R+ARILVR+KY++A+SD+CVKLASVG
Sbjct: 712  SGFSEGIFKIIKECINIFGELTSSD--LITKKEFRRARILVRDKYEDAASDSCVKLASVG 769

Query: 768  LLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLN 827
            LLI+LE+ +WTLE+RI+ALEL +LE F +F   F++N   L L+++G+LEYAD IN Y +
Sbjct: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYFS 828

Query: 828  NNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRD 887
            +    HL    +  K    L   PSTK L  GTN +    G  DDPNNSIVYFIQT    
Sbjct: 829  DKLVHHLTKRLDYPKEDT-LQSLPSTK-LISGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886

Query: 888  DIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLE 947
            + K L+LT LT ++ S +LVP+LRNKKQIGY+V GGLR L+DTVG+HIT+MS     ++E
Sbjct: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946

Query: 948  TRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANV 1007
              I +Y+SYL+  +L    +  F+   L  +++L+     K  E ++GP++++NEI+ANV
Sbjct: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006

Query: 1008 QNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISI 1067
              GD+  LN+++++ H+K +N++  G     E+ + +DI FL+ L L KYL FF+  IS 
Sbjct: 1007 HGGDSAILNSEKIKNHKKNKNELF-GDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSIST 1065

Query: 1068 YSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILL 1127
             S +RSKLSI I SPM E+E+ +RK+FLQL+ FLKI GF IK+ +L++IVE + G P LL
Sbjct: 1066 NSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLL 1125

Query: 1128 VKNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQR---YGSILGFSSQDGEGQEIEKFW 1184
             K LF  F+ R+E +K  ++VL+EILK+I M++KQ+    GS    S Q  E      F 
Sbjct: 1126 FKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSE------FH 1179

Query: 1185 NNDTSPIVPLQELPEPN 1201
            N+      PL+++ + N
Sbjct: 1180 NDHIITPTPLEKVEDIN 1196

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  971 bits (2511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1204 (41%), Positives = 743/1204 (61%), Gaps = 26/1204 (2%)

Query: 9    YEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAH 68
            ++V+ Y P+S S R+H++ +L N +LAL+ISDP++T +SC+++V TGSHNDP ++ GLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESI 128
             CEHM+LS+GSKKYP+P  FH  + +NNGS+NA TTGEQT+FYFE+P+T +     FE +
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTG 188
            +D+ A+ FKEP+F+ +L++KEIYAI SEH GN S+ +K+ YHA R+LAN +HPFS FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  NIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPK 248
            N+ +L+++P++ K+ LK+ L  YF+ +F  E + +CIRG QS+N L+KLA  KFGDI   
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPGS 249

Query: 249  SAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNTMCFQQFPE 308
            +A                         + +  + L   +IL  TW  +Y     F   P+
Sbjct: 250  AAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPVFTPRPK 309

Query: 309  CNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLSYYLASKGW 368
             NS+ I S K P++R +FPV+  +TRFT  +I  Y+  WC++ GDE  GS  ++L    +
Sbjct: 310  YNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLRQNNY 369

Query: 369  LTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNIDYLITFLK 428
            ++   AF+S FA            TN GW N+  I  +     + +    ++  +  +L 
Sbjct: 370  ISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSKIGQYLS 429

Query: 429  EQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEIDDPNIEK- 487
            E N IDL+ FLYQ  E  PME C++L   L  DL  + PP I K    + + +DP I+K 
Sbjct: 430  ELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCNDPRIQKI 489

Query: 488  --YENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSDICTDF 545
              Y  ++ +  WW GQAIKFQ F+K F   +N+++++LG +     +    N   +  D 
Sbjct: 490  GSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYS---NSMQLTADT 546

Query: 546  FYEFEYYTANVHL----ASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSLK 601
             YE++Y  A + +    A DN+      YEF+ P+ N FL         +++  L  S +
Sbjct: 547  HYEYDYLKAYIEITELEAIDNE------YEFHIPSPNQFLVPVGHKLSYIKKALLAASAQ 600

Query: 602  SKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSP 661
            S+ ++L     S+  +T P L  +N  YE+W  +ED N +  +KS+VS EV+   +KP+P
Sbjct: 601  SENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAP 660

Query: 662  EATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKT 721
            E T+ LE+L Q LF I S  LYPA R GYTYE++ SSKG+V L  T+SGF EG+  I+  
Sbjct: 661  EYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNI 720

Query: 722  FVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLED 781
             +D+L  +  D   +SK   R+AR++VR KY+ A+S+NC  LAS+GLLIVLE  +WTLED
Sbjct: 721  ILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLED 780

Query: 782  RINALELTELESFEKFCFLFWRNPKHLVLFMQGS-LEYADAINRYLNNNFTQHLKISNEG 840
            R+NALE  ++ESF +F  LF     +L L +QGS L  AD +N  ++   T H+     G
Sbjct: 781  RLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLETG 840

Query: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900
                +     P+T  + +G+N  +  +G  DDPNNSIVYFIQT  RD+    TLT  TE+
Sbjct: 841  KNILVE----PTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEF 896

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960
            L S+TLVPDLR KKQIGY+VLGGLRVL+DTVG+HIT MS +    LE +I+EYLSYL+  
Sbjct: 897  LMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESM 956

Query: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020
            VL +     F+   L  FL L++ NS  + E ++GP +L+++I ANV++G      +  M
Sbjct: 957  VLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQN--GSMAM 1014

Query: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080
            + H+++RN+I+  R NF+E+ E I+   ++ LTL++Y+AFF  KIS+YS  R+K+S+M+T
Sbjct: 1015 KSHKRIRNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVT 1074

Query: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140
            SPM++ E+ S+ MFLQ+E+FLK+ GF I +EDLK I+  S G P +L+K+LF+YFR R E
Sbjct: 1075 SPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGE 1134

Query: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200
              KL T +++EI+K       +  GS    S+         +  +   +P VPL E+ + 
Sbjct: 1135 SIKLLTAIVKEIVKQAS---NKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDV 1191

Query: 1201 NFFR 1204
            N +R
Sbjct: 1192 NSYR 1195

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1203 (41%), Positives = 744/1203 (61%), Gaps = 33/1203 (2%)

Query: 9    YEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAH 68
            ++V  Y P+S SNR+H++ +L N +L  +ISDP++T +SC++++ TGSHNDP +I GLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   LCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESI 128
             CEHM+LS+GSK++P+P  FH  ++KNNGSQNA T+GEQT+FYFELP++Q++    F+ +
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTG 188
            + + A   KEP+F+ +LI+KEIYAI SEH GN SS TK+ YHA R+LA+P+HPF +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  NIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPK 248
            NI +L+++P+L K+ LK+ L  YF  +FF EN+ LC+RGPQS+N L+K+A ++F DI   
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249

Query: 249  SAVKEXXXXXXXXXXXXXXXXXXXQDSSKN-DYSDLKTFKILNTTWEKKYKNTMCFQQFP 307
              ++                     D ++N     L++F+IL   W  +Y     F + P
Sbjct: 250  PTLQVPRLLRWRSSSSF--------DKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTP 301

Query: 308  ECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLSYYLASKG 367
              NSI + S+K P++R +FP++  +TRFT  ++  Y+ +WCEL GDE  GSL +YL S  
Sbjct: 302  MHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHS 361

Query: 368  WLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNIDYLITFL 427
            ++T   A++S FA            TN GW N+++I  IV   L+P+     +  L  ++
Sbjct: 362  YITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYI 421

Query: 428  KEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEIDD---PN 484
             E N +DL+ FLYQ  E  PM+ C+ L   L  DL  +    + K   +  E ++    N
Sbjct: 422  SELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVAN 481

Query: 485  IEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSDICTD 544
            +  Y   + +  WW G+A+KFQ F+  FM+ D +R++LLGN+ S   F+   N   I TD
Sbjct: 482  LGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNL-SKCYFN--CNPDKITTD 538

Query: 545  FFYEFEYYT--ANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSLKS 602
             ++E+EY     ++ +   +  H    Y F  P  N F+         ++   L  S++S
Sbjct: 539  TYFEYEYVKIFIDLEVLGCDDIH----YRFTIPGPNPFMVPVGHKLSFIKHALLASSVQS 594

Query: 603  KFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSPE 662
            + + L     S+  R  P+L  +N  YE+W+ +ED + +  +KS+ S E++   ++P+PE
Sbjct: 595  ENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPE 654

Query: 663  ATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTF 722
             T+HLE+L Q L+ I    LYPA R GYTYE++ SSKG+V L  TISGF +G+  ++K  
Sbjct: 655  YTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKII 714

Query: 723  VDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDR 782
            VD +  ++ D   + KD  RKARILVR KYK ASS++CV LAS+GLLI+LE  +W LEDR
Sbjct: 715  VDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDR 774

Query: 783  INALELTELESFEKFCFLFWRNPKHLVLFMQGS-LEYADAINRYLNNNFTQHLKISNEGS 841
            + ALE   +ESF  F   F     +L + +QGS +  AD IN YL+   T H+  +++  
Sbjct: 775  LEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN- 833

Query: 842  KPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYL 901
                RL   P+T  + +G+N F    G  DDPNNSIVYFIQT +RD+    TLT LTE++
Sbjct: 834  --VCRL-SEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFI 890

Query: 902  FSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQV 961
             S TLVPDLR KKQIGYIVLGGLRVL+DTVG+HIT M+GS    LE +INEYL+YL+  V
Sbjct: 891  MSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMV 950

Query: 962  LNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQMR 1021
            L + T   F+   ++  L+LL  NS  + E ++GP +L+++I ANV +G   T  +  M+
Sbjct: 951  LAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNT--SLAMK 1008

Query: 1022 QHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMITS 1081
             H+++R +I+  R NF ED E +D   LQ L L +Y+ FF  +ISIYS +R+KLSIM+ S
Sbjct: 1009 SHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYS 1068

Query: 1082 PMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNEV 1141
             M+++E+  + ++LQ+E+FLK+ GF I ++DL  IV+ SKG P  L+K L +YFR + E 
Sbjct: 1069 AMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGES 1128

Query: 1142 FKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEPN 1201
             KL + VL+E++K     L  +       S+  G    ++   +   +P + L+++PE N
Sbjct: 1129 LKLLSTVLREVVK----QLFSKATPDSSSSTPSGTHGSLQAM-SQHVTPAITLEQVPEVN 1183

Query: 1202 FFR 1204
             +R
Sbjct: 1184 SYR 1186

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1209 (41%), Positives = 727/1209 (60%), Gaps = 38/1209 (3%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS     N+++ FY P+S S+R  K+C+L NG+L  +ISDP+DT  SCS++V TGSHNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
             +  GLAHLCEH ILS GSKKYP    +H ++A+N GS NA+TTGE TTFYFELP   ++
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            GE  F+  LDV AS  K PLF+ +LI+KEIYAI+SEH  N +   K  YHA+R+LANP H
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRF TGN  +L ++P L K  +K++L ++ +  +   N++LC+RG QS+N LTKLA+ 
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  KFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNT 300
             FGD+ P S                         S+K     +  FKIL   W  KYK+ 
Sbjct: 241  FFGDL-PASGQNIARPSSSSLF------------SNKGTAQSMPYFKILKYEWTPKYKDV 287

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
              F Q    N + I S+K P++RL+FPVS K+TR +  DI  +S  WC+ FGDES GSL+
Sbjct: 288  RAFSQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLA 346

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
              L   G ++G  +  S FA            T  GW+NI  I  I+ +  +P       
Sbjct: 347  DCLKGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKT 406

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
            + +   L E N I+L+ FLYQS+E  PM+ C+ LS  L  DLE L P  + KG   LIE 
Sbjct: 407  EDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG-SPLIEC 465

Query: 481  DDPN--IEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNK 538
            +  +  I  Y     +  WW G+AIKFQN +  F+N  N+R ++LG+    N    +++ 
Sbjct: 466  NQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRST 525

Query: 539  SDICTDFFYEFEYYTANVHLAS---DNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLF 595
            +   TD +YEF+Y  A V + S   D+  ++  +Y F+ P+ + FLP        ++Q  
Sbjct: 526  TK--TDAYYEFDYRIAYVDMLSIQLDD--YTAPNYHFHAPSYDTFLPMVARKLSLIKQAL 581

Query: 596  LECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGL 655
               S +++ A+L     S+  +T P+L  +N NYE+W+ +E+ + +  +KS+VSFE++  
Sbjct: 582  QVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISK 641

Query: 656  GIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGV 715
             +  SP+ T++LE+L Q L    S+ LYP+ ++GYTYEI+ SSKG+V L  T+SGFPEGV
Sbjct: 642  SVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGV 701

Query: 716  FTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKY 775
            + ++K  V+ +K  ++     SK   R+ARI VR+KY+ A++ NC  LAS+GLLI+LE+ 
Sbjct: 702  YNLIKIIVEEIKSFSSRDIISSK-VFREARIAVRSKYEEAAAANCTALASLGLLIILEEC 760

Query: 776  IWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLK 835
            +W +EDR+ ALE    E+F  FC  F  +P ++ LF+QG +   + IN +L  + T HL+
Sbjct: 761  MWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLE 820

Query: 836  ISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLT 895
             + E   P +R    P  K L  GTN F+  N   DDPNNSIVYFIQT +R+D +  T T
Sbjct: 821  DTREYQGP-VR---EPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYT 876

Query: 896  FLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLS 955
             L E+  SLTLVPDLRNKKQIGY V GGLR+L+ ++G+HIT MS S   +LE +I EYLS
Sbjct: 877  CLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLS 936

Query: 956  YLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTL 1015
            YL+  +L+  TE +F+   +  +  +++ N   + + +AGP DL+ +I ANV++G N   
Sbjct: 937  YLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG-NLEE 995

Query: 1016 NNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKL 1075
                MR H+  +N+I+  R NF  + E ++   L+ +TL ++ +FF  KISIYS +RSKL
Sbjct: 996  QGSAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKL 1055

Query: 1076 SIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYF 1135
            S+MI SPM  +EI+ +++FLQ+E+FLK+ G  I + DL  I+E S G    +++ LF YF
Sbjct: 1056 SVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYF 1115

Query: 1136 RRRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQ 1195
                E  KL  V+++EI K + ++LK          SQ     +  +  +   +  +PL 
Sbjct: 1116 SANGETMKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLT 1167

Query: 1196 ELPEPNFFR 1204
            E+ + N FR
Sbjct: 1168 EIKDVNQFR 1176

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1207 (40%), Positives = 727/1207 (60%), Gaps = 42/1207 (3%)

Query: 6    VTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAG 65
            V +++V+FY P+S SN+  ++C+L NGIL L+ISDP DTS S S++V +GSH DP ++ G
Sbjct: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLG 67

Query: 66   LAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTF 125
            LAHLCEH ILSAGSKK+P    +H ++A+N GS NA+TTGE TTFYFELP + ++GE  F
Sbjct: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127

Query: 126  ESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRF 185
            + +LD  AS FK P+F+   I+KEIYAI+SEH  N +ST K  YHA R+LANP HPFSRF
Sbjct: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187

Query: 186  STGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
             TGN  +L   P L K+ +K++L  YF+ N+    + LC+RGPQS+N L KLA   FGD+
Sbjct: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247

Query: 246  KPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDL--KTFKILNTTWEKKYKNTMCF 303
             P S  ++                   + SS     DL  +     N+  + + ++    
Sbjct: 248  -PASRDRDPTRPPLKK-----------RPSSGVASQDLHVRPLDFKNSKQQTQVQDAF-- 293

Query: 304  QQFPEC-NSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLSYY 362
               P+  N + I S+K P++RL+FPVS K+TR T +DI   S  WC+ FGDE  GSL++ 
Sbjct: 294  --VPDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHC 351

Query: 363  LASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNIDY 422
            L +   + G  A  + F+            TN GW + + I T++ +  +P         
Sbjct: 352  LKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKD 411

Query: 423  LITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEID- 481
            +   L E N  DL++FLYQ +E   ME C+ LS  L    E L P  + KG   LIE + 
Sbjct: 412  IAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQ 470

Query: 482  DPN-IEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540
            +P+ I  Y  +  +  WW G+AIKFQNF+  F+N  N+R+++LGN    ++   + + S 
Sbjct: 471  NPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK 530

Query: 541  ICTDFFYEFEYYTANVHLAS-DNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECS 599
              TD +YEF Y  + + + S   + +    + F  P  ++FLP        ++Q     S
Sbjct: 531  --TDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASS 588

Query: 600  LKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKP 659
             +S+ + L     +   +T P+L  +N N+E+W+ +ED + +  +KS++S EV    I+ 
Sbjct: 589  NRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEA 648

Query: 660  SPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIV 719
             P  T+ LEVLAQ L    S+ LYP+ ++GYTYEI+ S+KG+  L FTISGFPEGV  +V
Sbjct: 649  CPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMV 708

Query: 720  KTFVDTLK-LIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWT 778
            +  +D  K LI +D   ++    RKAR+ VRNKY+ A+S N   LA++GLLIVLE+ +W 
Sbjct: 709  RVIIDQTKSLINSDT--VTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWP 766

Query: 779  LEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISN 838
            +EDR++ALE  ++ESF  FC  F   P +L +F QG L Y + I+ +L++  T HL    
Sbjct: 767  VEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLS-RR 825

Query: 839  EGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLT 898
               +P +R    P T  L  GTN FI  +   +DP++SIVYFIQT  RDD + L+LT LT
Sbjct: 826  TWHEPAVR---EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLT 882

Query: 899  EYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQ 958
            E+L S+TLVPDLR KKQIGY V  GLR+L+ T+G+HIT MS S   +LE++I++YL+Y++
Sbjct: 883  EFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYME 942

Query: 959  LQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNK 1018
              VL+  +E +F+   +  F  + ++ +      +AGP DLL +I ANV +G N      
Sbjct: 943  HDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSG-NLPEQGA 1001

Query: 1019 QMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIM 1078
             MRQH+++RN+I+  R NF  D E  D+  L+ LTL ++  FF+ KISI S  RSKLS+M
Sbjct: 1002 AMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVM 1061

Query: 1079 ITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRR 1138
            + SP++  EIA +++FLQ+E++LK+ G  I + +L+ IVE S+G P  L++ LF +F  R
Sbjct: 1062 VASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLAR 1121

Query: 1139 NEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELP 1198
             E  +L  V+L+E+ K + ++LK R  +    ++  G  Q + K    + S  VPL E+ 
Sbjct: 1122 GETLRLCNVILKELSKAVVLSLKPRPTN----NNSAGVLQNVRK----EVSTAVPLIEV- 1172

Query: 1199 EPNFFRK 1205
            + N FR+
Sbjct: 1173 QANHFRQ 1179

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1159 (41%), Positives = 695/1159 (59%), Gaps = 27/1159 (2%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            MS  +V NY++  YIP S     +K+C+LPNGIL ++ISDP+   +SCSL+V TGSHNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
              I GLAHLCEHMILSAGSKKYPDP  +H LI+++NGS NA+TTGEQTTFYFE+P    +
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
             E  FE +LD+F+S FK+PLF    ++KEIYAI+SEH+GN  + TKI YHA R+LAN  H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
            PFSRFSTGNI +L    +L K   K  L +YF+ N+   N+TLCI+GPQSVN+LTK AL+
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  KFGDI-----KPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSD--LKTFKILNTTW 293
             F  I        + +K                       SK +  D  L+ F IL+  +
Sbjct: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300

Query: 294  EKKYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGD 353
              KYK+  CF++ P  N+IFI S K PI+RLLFP+   +  F KDD+  +  +WCELFGD
Sbjct: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360

Query: 354  ESPGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLP 413
            E+  SL Y+L     +T CFAF S FA            T +G +N + I   + N  + 
Sbjct: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420

Query: 414  SFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKG 473
                 N   L  FL E N ID++ F+ +  ED  M+E S++S  LQ++L    P  + K 
Sbjct: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE 480

Query: 474  FKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFD 533
            F  + +  +  I  +E  + +  WW  +A  FQ FLK ++N  N+R+L LG+I++     
Sbjct: 481  FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFTT 540

Query: 534  KMKNKSDICTDFFYEFEYYT------ANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSD 587
              ++     TD FY+FEY T      AN     D+ F +        P  N F+P+ +  
Sbjct: 541  LTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN-----IGIPKRNTFMPE-IGK 594

Query: 588  PLKLQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSV 647
             L +    LE  LK   +   P IY+    +KP LV +N N E W+L      +S   S+
Sbjct: 595  SLAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHSSTESSI 654

Query: 648  VSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFT 707
             SFE+    IKPSP +T+HLEVL Q L I+ +  LYPALR+GYTYEI +S  G+V L  T
Sbjct: 655  FSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMIT 714

Query: 708  ISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVG 767
            ISGF  G+ ++++  +     I+     ++   L +AR++ R KY++A+S N VKLASVG
Sbjct: 715  ISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVG 774

Query: 768  LLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLN 827
            LLI+LEK++WTLEDR +ALE +++ SF  FC  F+++ K++  F+ G+ E A  ++  + 
Sbjct: 775  LLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIY 834

Query: 828  NNFTQHLKIS-NEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQR 886
            +++     IS N   K  I      ST  L  G N +  + G + D NN I YFIQT +R
Sbjct: 835  DHWILSDTISLNYFEKNNIL-----STCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889

Query: 887  DDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNL 946
            ++    TLT LT+Y+    LV +LRN+KQ+GY+V GG+R LT+T+G+HIT+MS +   +L
Sbjct: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949

Query: 947  ETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVAN 1006
            E  I+EY+  L+   +    E  F+   L PF+N +++++   F      V+L++++VAN
Sbjct: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDDVVAN 1008

Query: 1007 VQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDH-EMIDISFLQKLTLKKYLAFFESKI 1065
            VQ GD+     +QM+ H  ++ +I   R+     + E ID++ ++KLTLK+YL FF + I
Sbjct: 1009 VQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATI 1068

Query: 1066 SIYSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPI 1125
            SI S  RSK+SI I S MA++EIA+RK+FLQL  FLK+ G  IK ++LK+IVE S+G P 
Sbjct: 1069 SINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128

Query: 1126 LLVKNLFTYFRRRNEVFKL 1144
             L+K +  YF++++E  KL
Sbjct: 1129 KLLKEIVKYFKKKDEAKKL 1147

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1167 (38%), Positives = 687/1167 (58%), Gaps = 49/1167 (4%)

Query: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
            M+   V   +V  Y P+S SNR H+  +L NGI AL+ISDP ++ +S   +V TGSHNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN- 119
             ++ GLAHLCEHMI+S+ SKK+P    +H L+ + NG+QNAFTTGEQT+FYFE+PN+ N 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPD 179
             G+  F+ ++ V A     P+F    I+KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSRFSTGNIHSLSSIPQL--KKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKL 237
              FSRFSTGNI++L+  P +  K I LK+ L  ++ +NF  ENI++ IRG QS++ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  ALSKFGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKY 297
              + FGD + KS +K                              +++FK L   W  +Y
Sbjct: 241  VQTTFGDFRTKSTIKSQSF-------------------------SIESFKKLQKVWAARY 275

Query: 298  KNTMCFQQFPEC-NSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESP 356
               +  +Q PE  NSI I S+K PI+RL+FPVS +   F++ ++KI+S +W +LFGDES 
Sbjct: 276  TEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESS 335

Query: 357  GSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWE-NIKRITTIVLNRLLPSF 415
            GS+    +++  LT      S+F             TNSGW+  ++ + T +    LP F
Sbjct: 336  GSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFF 395

Query: 416  YVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFK 475
              ++ D +  +L E N I+L+ F+YQ  ++  M++CS L   L   L+C  P  I     
Sbjct: 396  QSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCEDPQFILNNSI 452

Query: 476  SL-IEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDK 534
            +        +I  Y  +  + +WW  QA KF +F+K++M+ +N +L+ LG+++S +    
Sbjct: 453  AFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKS 512

Query: 535  MKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQL 594
             +  +++  D  Y F+Y  + + L         S  +F  P+   FL     +   L+Q 
Sbjct: 513  RQVPTNVKFDEHYRFQYELSLIKL----NHVKMSPKDFRLPSSTAFLFGLEKNLSALKQS 568

Query: 595  FLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLG 654
                  KS+ + L     S+  +T P+L+S+N+NYE+W+ KE+ +    ++SV++ E++ 
Sbjct: 569  LTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSSRSVITIELIN 627

Query: 655  LGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEG 714
            +G++PS + T++LE+L Q L+   +  LYP+ R+GY Y+IA++++G+V L  TI+GFP+G
Sbjct: 628  MGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQG 687

Query: 715  VFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEK 774
            V  I++  +D +  I      ++    R +RILVR KY+ A+  N   LAS+G+LI+LEK
Sbjct: 688  VAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEK 747

Query: 775  YIWTLEDRINALELTELESFEKFCFLFWRNPK--HLVLFMQGSLEYADAINRYLNNNFTQ 832
             + TLE+R++ALE  ++ESF+ FC   W  PK  ++ L +QG L  A+ +N+Y++     
Sbjct: 748  ELTTLEERLDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAETVNQYMDG-IIH 805

Query: 833  HLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNL 892
            HL   N       RL  P + K L QG+N FI     ++DP NS+VYFI+T  R +  + 
Sbjct: 806  HLSGPNVNQTSVFRLREPETIK-LAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDY 864

Query: 893  TLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINE 952
            T++ L EY  S+TLVPDLRNKKQIGY+VLGGLR+LTDT+GIHI+VMS    H +E RI E
Sbjct: 865  TMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEE 924

Query: 953  YLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGD- 1011
            YL YL+  VL   TE +F+  +L+ ++ L+K NS ++   +AGP +L+ +I A+V +G+ 
Sbjct: 925  YLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984

Query: 1012 --NYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYS 1069
              N       + QH+K++++I+     F E    +D+  L KLTL+++   F  KISI S
Sbjct: 985  PSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILS 1042

Query: 1070 AQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVK 1129
             QR KLS+   +PM + +I    M +QL+ FLK  GF I  ++L++IV  + G P  L K
Sbjct: 1043 LQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFK 1102

Query: 1130 NLFTYFRRRNEVFKLGTVVLQEILKII 1156
             LF +FR + +  +L T+VL+EI+K I
Sbjct: 1103 ELFHHFRTQGQSLRLCTLVLKEIVKQI 1129

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1189 (32%), Positives = 631/1189 (53%), Gaps = 80/1189 (6%)

Query: 3    LREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKD 62
            + +V  + V FY+PL + NR +K+ +LPNGI  +IISD  +  +SCSLTV  GSHNDP  
Sbjct: 2    ITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPAT 61

Query: 63   IAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN-G 121
            + GLAHLCEHMIL+AGS  +P PGLFH+LIAK NG  NA+TTGEQT+FYF++P   N+ G
Sbjct: 62   VPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEG 121

Query: 122  EFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHP 181
               FE +L VF+S FK PLF   +++KEIYAIQSEHE N ++  K+ Y A R+LAN +HP
Sbjct: 122  TLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHP 181

Query: 182  FSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSK 241
            FSRF TG++++L + P  + I ++  L +YF +NF+GENITLC+RGPQS+N L KL +  
Sbjct: 182  FSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQN 241

Query: 242  FGDIKPKSAVKEXXXXXXXXXXXXXXXXXXXQDSSKNDYSD-LKTFKILNTTWEKKYKNT 300
            F DIKP   +                     +DS    + + LK   IL   W  +Y + 
Sbjct: 242  FNDIKPLPVLP--------------TAIGNNRDSDTELFEETLKRLNILYDVWAPRYTSL 287

Query: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360
             CF    + N I +NS+     R++ P+   +TR      ++++++  EL G+E  GS  
Sbjct: 288  PCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGSFC 347

Query: 361  YYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNI 420
            ++L    W+  C+ + SEFA             ++G+  I+ I  ++   L+P +  M  
Sbjct: 348  HFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNMPS 407

Query: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480
            D L  F+KEQ +I+ + F+Y      PMEE S LS  LQ DL         +G K L+  
Sbjct: 408  DDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHN-------RGIKYLLMK 460

Query: 481  DDPNIEKYENTKAN--IQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDK---- 534
                +  YE       + +W     KF+ FL+  M   N +++    I +   F K    
Sbjct: 461  SPSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVI----IPTSEPFTKTVRN 516

Query: 535  -MKNKSDI----CTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPL 589
              KN   +     TD +YEF Y   +V             Y+F+FP  N F+P    +  
Sbjct: 517  LFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVIF---PYQFSFPGPNEFIPPKYRNLD 573

Query: 590  KLQQLFLECSLKSKFATLRP--QIYSEPTRTKPQLVSENQNYEMWILK-EDPNFA----S 642
             L ++    S ++ F+ LRP  ++ +   R+ P+LV + ++ E+W     D  F+    +
Sbjct: 574  TLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNA 633

Query: 643  DNKSVVSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNV 702
            D KS V+ +++   I+P+P +++HL ++ + + +     LY   ++G+++ + ++  G++
Sbjct: 634  DIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSM 693

Query: 703  TLRFTISGFPEGVFTIVKTFVDTLKLIATDPTF-LSKDTLRKARILVRNKYKNASSDNCV 761
            +    ++G   G+  I++   D +++I T P + L+   +RKAR+ +R++Y+ A+  + V
Sbjct: 694  SFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSV 753

Query: 762  KLASVGLLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQ-GSLEYAD 820
            K+ + GLL+ LE ++W+ E+R++ALE +++E F +F   F+R  KH  +F Q  S    D
Sbjct: 754  KIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNID 813

Query: 821  AINRYLNNNF-TQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVY 879
             I RY+     T  +   N+     +R      T+ L  G    I   G  +DPNN +  
Sbjct: 814  KIARYVVQRIVTPGIPEGNDALVECVR--DDGHTRMLKPGEERHIKLIGRDNDPNNCVFS 871

Query: 880  FIQTAQRDDI--KNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITV 937
            +++ A  + I  K   +   T+YLF LTLVP+LRNK+Q+GY V GGL +L + VG+++ V
Sbjct: 872  YLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVV 931

Query: 938  MSGSSGHNLETRINEYLSYLQLQVLNRFTEF--DFRRIL--LEPFLNLLKQNSTKQFEGS 993
            +S +S  ++E  I  Y ++++  + +   +   D+ +I+   +P + LL  +     E  
Sbjct: 932  VSSTSPEHIEQEIESYYAHVRQYLSDNVDQIWRDYSKIINDRDPLMYLLDHDVWYNIERE 991

Query: 994  AGPV-DLLNEIVANVQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKL 1052
               + +   + VAN Q    Y    K + +   V   I+ GR             +    
Sbjct: 992  NSDIPEYSRDHVANCQRVFKY----KDLIELLVVDTPIS-GR----------HPDYTPPF 1036

Query: 1053 TLKKYLAFFESKISIYSAQR-----SKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFA 1107
            ++++YL F +S I  Y  +R       +S+ + SPM ++++  R++  QLE+FLK+ G  
Sbjct: 1037 SMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLV 1096

Query: 1108 IKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNEVFKLGTVVLQEILKII 1156
            I   DL  I+  + G    + K L+  F+R+NE  K    V  E  K I
Sbjct: 1097 IPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSI 1145

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  162 bits (411), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 227/984 (23%), Positives = 394/984 (40%), Gaps = 177/984 (17%)

Query: 14  YIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHM 73
           +I     +R+++  KLPN + AL+I DPT   ++ +L V  G+  DP+ + GLAH CEH+
Sbjct: 54  FIKPDLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHL 113

Query: 74  ILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFA 133
           +   GS+K+PD   + + ++K+ GS NA+T+   T +YFE+     N E  + + LD F+
Sbjct: 114 LF-MGSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV-----NHEHLYNA-LDRFS 166

Query: 134 SFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSL 193
            FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGN+ +L
Sbjct: 167 GFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITL 226

Query: 194 SSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKSAVKE 253
              P+   + ++  L  ++ +++    + LCI G + ++ L+  A   F D++       
Sbjct: 227 GENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVR------- 279

Query: 254 XXXXXXXXXXXXXXXXXXXQDSSKNDYSDLKTFKILNTTWEKKYKNTMCFQQFPECNSIF 313
                               + +  +YS     KILN T  +K       ++  +     
Sbjct: 280 ------------------NTNRALPEYSS----KILNETHLQKIIQVKPVKELRK----- 312

Query: 314 INSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLSYYLASKGWLTGCF 373
                   + + F V D +  +         HL   L G E  GSL  YL +KGW     
Sbjct: 313 --------LEISFMVPDMDRHWQSKP----PHLLSHLIGHEGSGSLLAYLKAKGWANELS 360

Query: 374 AFTSEFAXXXXXXXXXXXXTNSGWENIKRITTIVLNRLLPSFYVMNIDYLITFLKEQNLI 433
           A     +            T  G E+ K +   +   +      +  D++  F++ QN I
Sbjct: 361 AGGHTVSKDNAFFSIDVELTKDGLESYKEVVHSIFQYIEMLRNSLPQDWI--FVELQN-I 417

Query: 434 DLVSFLYQSSEDLPMEECSKLSGILQDD---LECLTPPNIFKGFKSLIEIDDPNIEKYEN 490
              +F ++   + P    S L+ +L+ +   +E +   N+F         D+P       
Sbjct: 418 SRANFKFKQKGN-PASTVSALARLLEKEYIPVENILSTNVFTK-------DEPQT----- 464

Query: 491 TKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSDICTDFFYEFE 550
                           N+++S +  +N R+ L+                D+ TD      
Sbjct: 465 --------------LMNYVQS-LTLENSRITLIS--------------QDLETD------ 489

Query: 551 YYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSLKSKFAT---L 607
                    S+ K++       N+P        C S  L  Q   L     ++F     L
Sbjct: 490 ---------SNEKWYKTDYKVINYPED--MRKKCKSPGLNTQ---LRLPRPNEFVANNFL 535

Query: 608 RPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSPEATIHL 667
             ++ S     +P L+ + +  ++W  K+D  +       VS ++      P   A++  
Sbjct: 536 VDKLESVTPSEEPLLLKDTKLSKLWFKKDDRFWQPRGYIYVSLKL------PHTHASVLN 589

Query: 668 EVLAQALFIITSSFLYPALRIGYTYEIA----SSSKGNVTLRFTISGFPEGVFTIVKTFV 723
            +L+     + + FL     + Y    A    S  K N  L  T+SGF + + T++  F+
Sbjct: 590 SMLSTIYVQLANDFLKD---LQYDASCANLNLSFVKTNQGLDITLSGFNDKLVTLMTRFL 646

Query: 724 DTLKLIATDPT------FLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIW 777
             +K     PT      F  K T     +L    Y         +++ V   ++ E+  W
Sbjct: 647 QGVKDFK--PTEERFKIFKDKTTQHLKNLLYEVPYS--------QISGVYNSLINERS-W 695

Query: 778 TLEDRINALELTELESFEKFC-----FLFWRNPKHLVLFMQGSLEYADAINRYL-NNNFT 831
           ++E+++N +E    E    F       L++    H  L  + ++E    IN  L  N   
Sbjct: 696 SVEEKLNVVEHITFEQLLAFIPTVFEELYYETLVHGNLKFEEAIEIESLINDILITNENH 755

Query: 832 QHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKN 891
            +L++ N      +R Y  P  K           +     D  N +   IQ   + D+ N
Sbjct: 756 NNLQVKNN----RLRSYFIPKGKTY--------RFEKELKDSKN-VNSCIQHVTQLDVYN 802

Query: 892 LTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLET 948
             L+ L+     +   P    LR K+Q+GY+V         T  I I V S  +   LE 
Sbjct: 803 EELSALSGLFAQMIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEW 862

Query: 949 RINEYLSYLQLQVLNRFTEFDFRR 972
           RI E+ S     +L   +E DF +
Sbjct: 863 RIEEFYSKFG-AILKDMSEEDFDK 885

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  160 bits (405), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 137/234 (58%), Gaps = 7/234 (2%)

Query: 12  SFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCE 71
           S +I     +R+++  +LPN + ALII DPT   S+ +L V  G+ +DP+++ GLAH CE
Sbjct: 38  SDFIKPDLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCE 97

Query: 72  HMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDV 131
           H++   GS+K+PD   + + ++K+ GS NA+T  + T +YF++ +    G       LD 
Sbjct: 98  HLLF-MGSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQVNHEHLKG------ALDR 150

Query: 132 FASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIH 191
           F+ FF  PLF+     KEI A+ SE++ N+ +     Y   + L+NP HP+ +FSTGN+ 
Sbjct: 151 FSGFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLK 210

Query: 192 SLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
           +L+ IP+ K + +++ L  ++   +    + LC+ G + ++ L+  A   F D+
Sbjct: 211 TLNEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDV 264

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 126/308 (40%), Gaps = 45/308 (14%)

Query: 699 KGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSD 758
           K N  L  TI+GF + +  ++  F++ LK    D         RK   + + K K   ++
Sbjct: 608 KTNEGLDITITGFNDKLIILLTRFLEGLKAFKPD---------RKRFEIFKEKSKQHLNN 658

Query: 759 NCVKL--ASVGLLI--VLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQG 814
              ++  + V  L   ++ +  WT E+++  +E    E  E F    +         + G
Sbjct: 659 QLYEIPYSQVSSLYNSLVNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEE-MFFETLVHG 717

Query: 815 SLEY--ADAIN---RYLNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGH 869
           +++Y  AD I+   + L +N   + +I N      IR Y  P  K     T+ + +    
Sbjct: 718 NIKYEEADQIDSLIQMLRSNSVSNSQIKN----ARIRSYVLPLGK-----THRYEAKLAD 768

Query: 870 QDDPNNSIVYFIQTAQRDD----IKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLR 925
             + N+ I Y IQ    D+    I  L    L E  F       LR K+Q+GY+V     
Sbjct: 769 TQNVNSCIQYVIQLGVYDEALSAIGRLFAQMLHEPCFDT-----LRTKEQLGYVVFSSSL 823

Query: 926 VLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEFDFR-------RILLEPF 978
               T  I I + S  +   LE RI  +L     + L   ++ DF        + LL+ +
Sbjct: 824 NNHGTANIRILIQSEHTTPYLEWRIESFLEQFG-KTLKEMSDRDFENHKDALCKTLLQKY 882

Query: 979 LNLLKQNS 986
            N+ +++S
Sbjct: 883 KNMKEESS 890

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  159 bits (403), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 141/248 (56%), Gaps = 8/248 (3%)

Query: 1   MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
           M+     N+ +SF  P     R+++  +LPN + AL+I+DP    ++ SL V  GS NDP
Sbjct: 25  MTAASYKNHNLSFQKP-DLDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120
           + + GLAH CEH++   GS+K+PD   + + ++K+ G  NA+T    T ++FE+     N
Sbjct: 84  EPLPGLAHFCEHLLF-MGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI-----N 137

Query: 121 GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180
            E  F + LD F+ FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N  H
Sbjct: 138 AEHLFGA-LDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240
           P+ +FSTGNI +L  +P+ + + ++  L  ++++++    + LCI G + ++ L +    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 KFGDIKPK 248
            F D+K K
Sbjct: 257 LFNDVKNK 264

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 135/348 (38%), Gaps = 41/348 (11%)

Query: 619 KPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSPEATIHLEVLAQALFIIT 678
           +P L+ E +  ++W  K+D  +       +SF++             HL +L   L  + 
Sbjct: 531 EPHLLKETELGKLWYKKDDRFWQPRGHIYISFKL----------PHTHLSLLNSMLTTLY 580

Query: 679 SSFLYPALR-IGYTYEIA----SSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDP 733
              +  +L+ + Y    A    S +K N  L  T+SGF + +  ++  F+  +K    + 
Sbjct: 581 VQLINDSLKDLQYDASCANLHASLTKTNQGLDITVSGFNDKLIILLTRFLQGIKSFKPNS 640

Query: 734 TFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALE---LTE 790
                   +  + L  + Y+   S       S+     + +  WT  ++++AL+     +
Sbjct: 641 DRFQIFKDKTIQHLQNSLYEVPYSQMSTLYNSL-----INERTWTTTEKLSALDKISYDQ 695

Query: 791 LESFEKFCF--LFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKPTIRLY 848
           L +F    F  L++ +  H  L    ++E    +   L  N   +L+I N+     +R Y
Sbjct: 696 LLTFIPTIFEELYFESLIHGNLKYDEAMEIDSLVKLLLTENNILNLQIQND----KLRSY 751

Query: 849 PPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVP 908
             P  K           Y     DP N +   IQ   + DI +  L+        +   P
Sbjct: 752 ILPKGKTF--------RYETDLKDPKN-VNSCIQHVTQIDIYSEELSAKCALFAQMIHEP 802

Query: 909 ---DLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEY 953
               LR K+Q+GY+V         T  I I V S  S   LE RI+ +
Sbjct: 803 CFDTLRTKEQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDNF 850

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  155 bits (391), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 9   YEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAH 68
           Y ++F  P    +R ++  +LPN +  L+I D T   ++ SL V  G+  DP+ + GLAH
Sbjct: 8   YNLNFAKP-DLDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGLAH 66

Query: 69  LCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESI 128
            CEH++   GS+KYPD   + + ++ N GS NA+T    T ++FE+     N E   E  
Sbjct: 67  FCEHLLF-MGSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEI-----NYEH-LEGA 119

Query: 129 LDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTG 188
           LD F+ FF  PLF+     KEI A+ SE++ N+ S     Y   + L+N  HP+ +FSTG
Sbjct: 120 LDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTG 179

Query: 189 NIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
           NI +L +IP  + + ++  L  ++ N++    + L I G + ++IL   A S F D+K
Sbjct: 180 NIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDVK 237

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 110/272 (40%), Gaps = 39/272 (14%)

Query: 696 SSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNA 755
           S SK    L  T+SGF   +  ++++F+  +K             L K+R L+  +    
Sbjct: 577 SFSKTGQGLDITVSGFNHKILILLESFLKGIKNFK----------LEKSRFLIFQEKYIQ 626

Query: 756 SSDNCVKLASVGLL-----IVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVL 810
              N +     G +      V++   W+++++++ ++    E  E F    + N  +   
Sbjct: 627 QLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQKLTFEDLENFLPTIF-NEVYFES 685

Query: 811 FMQGSLEYADA------INRYLNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFI 864
            + G+ E +DA      + +Y++ +   + +I N+  +  +          L +G     
Sbjct: 686 LVHGNFEKSDAAEVNQLVEKYISGSI-HNPQIRNDRLRSYV----------LQKGET--Y 732

Query: 865 SYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVP---DLRNKKQIGYIVL 921
            Y    +DP N +   IQ   +  + N  L  L+     +   P    LR K+Q+GY+V 
Sbjct: 733 RYETLLEDPEN-VNSCIQHVTQIGLYNDRLAALSSLFAQIINEPCFNILRTKEQLGYVVF 791

Query: 922 GGLRVLTDTVGIHITVMSGSSGHNLETRINEY 953
                   T  I I V S  +   LE RI+E+
Sbjct: 792 SSSLNNYGTTNIRILVQSEHTTEYLEWRIDEF 823

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  154 bits (390), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 130/226 (57%), Gaps = 7/226 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R+++  +LPN + AL+ISDPT   ++ SL V  G+  DP+ + GLAH CEH++   GS+
Sbjct: 49  DRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLF-MGSE 107

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           K+PD   + + ++K+ G  NA+T  + T ++FE+      G       LD F+ FF  PL
Sbjct: 108 KFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEINYEHLKG------ALDRFSGFFSCPL 161

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ S     Y   + L+  DHP+ +FSTGN+ +L  IP+ K
Sbjct: 162 FNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESK 221

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
            + ++  L  ++  N+    + LCI G + ++ L+    S F D+K
Sbjct: 222 NVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVK 267

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 128/291 (43%), Gaps = 36/291 (12%)

Query: 695 ASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLK-LIATDPTF-LSKDTLRKARILVRNKY 752
            S SK N  L  ++SGF + +  ++  F+  +K    T   F + KD  +  + L  + Y
Sbjct: 609 VSLSKTNQGLDISLSGFNDKLIILLTRFLQGIKDFKPTSERFQIFKD--KTIQHLKNSMY 666

Query: 753 KNASSDNCVKLASVGLLIVLEKYIWTLEDRIN---ALELTELESFEKFCF--LFWRNPKH 807
           +   S    +++S+   ++ EK  W  E+++N    L L +L SF  F F  LF+     
Sbjct: 667 EVPYS----QMSSLYNALINEK-TWLPEEKLNMMNKLTLDQLNSFIPFIFDELFFE---- 717

Query: 808 LVLFMQGSLEYADAIN--RYLNNNFTQHLKISN-EGSKPTIRLYPPPSTKDLDQGTNAFI 864
              F+ G+L+Y +AI     ++   +    ++N +     +R Y  P  K     T  + 
Sbjct: 718 --CFVHGNLKYDEAIEIESLIDLLMSSKENLTNSQYENEKLRSYLLPKNK-----TYRYE 770

Query: 865 SYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVP---DLRNKKQIGYIVL 921
           +    + + N+ I + IQ     DI +  L+ +      +   P    LR K+Q+GY+V 
Sbjct: 771 TLLKDRKNVNSCIQHVIQV----DIYSEELSAICGLFAQMLHEPCFDTLRTKEQLGYVVF 826

Query: 922 GGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEFDFRR 972
                   T  I I V S  S   LE RI+E+       +LN  ++ DF +
Sbjct: 827 SSTLNNHGTANIRILVQSEKSTPYLEWRIDEFYKKFG-DLLNGMSDEDFTK 876

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  154 bits (389), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 136/238 (57%), Gaps = 8/238 (3%)

Query: 8   NYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLA 67
           ++ V F  PL   +R ++  +LPN + AL+I DPT   ++ +L V  GS  DP+D+ GLA
Sbjct: 43  DHGVKFTKPL-LDDRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLA 101

Query: 68  HLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFES 127
           H CEH++   GS K+P+   + + ++K+ G  NA+T+   T ++F++     +G      
Sbjct: 102 HFCEHLLF-MGSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVNQESLHG------ 154

Query: 128 ILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFST 187
            L  F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  +NP+HPF +FST
Sbjct: 155 ALLRFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFST 214

Query: 188 GNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
           GN+ +L  IP+ K + ++  L  ++++++    + LC+ G + ++ +++     F D+
Sbjct: 215 GNLKTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDV 272

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 80/392 (20%), Positives = 158/392 (40%), Gaps = 49/392 (12%)

Query: 614 EPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGL--GIKPSPEATIHLEVLA 671
           EP + +P L+ +++  ++W  K+D  +       VS ++      +  S   T+++E++ 
Sbjct: 537 EPLQ-EPLLLKQDRQSKVWYKKDDRFWVPKGHIYVSMKLAHTYSSVVNSMLTTLYVELIN 595

Query: 672 QALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIAT 731
             L  +       +L I +        K N  L  ++SG+ E +  ++K +++ +     
Sbjct: 596 DYLKDLEYDAQVASLHISF-------RKTNQGLDLSLSGYNEKMAILLKRYLEGIANFQP 648

Query: 732 DPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALELTEL 791
                ++D  +  +  +  K  N   +      S     V+ +  WT+ +++  ++  + 
Sbjct: 649 -----AEDRFKIYQDKLLQKLNNHLYEVPYSQVSDVFNSVINERAWTIANKLEVVKQLKF 703

Query: 792 ES--------FEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKP 843
           E         FE+F F       H     + +LE AD + R L     Q+ ++  + SKP
Sbjct: 704 EHLKLFIPAIFEQFSFEILV---HGNFSCEAALE-ADNLVRALAPRDVQNFQL--KSSKP 757

Query: 844 TIRLYPPPSTKDLDQGTNAFISYNGHQDDPN--NSIVYFIQTAQRDDIKNLTLTFLTEYL 901
              L P   T         F       DD N  + I +  Q     +  +   +   + L
Sbjct: 758 RSVLLPQGKT---------FCYQQMLADDKNINSCIQHVTQFGSYSEELSAKASLFAQ-L 807

Query: 902 FSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQV 961
                   LR K+Q+GY+V         TV + + + S      LE+RI+ +L  +  QV
Sbjct: 808 IDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKMG-QV 866

Query: 962 LNRFTEFDFRR-------ILLEPFLNLLKQNS 986
           L   ++ +F R        LL+ + NL ++N+
Sbjct: 867 LQEMSDEEFERHKVALCKTLLQRYKNLSEENT 898

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  154 bits (389), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 132/225 (58%), Gaps = 9/225 (4%)

Query: 22  RTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKK 81
           R+++  +LPN + AL+I DP    ++ SL V  G+  DP+ + GLAH CEH++   GS+K
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGLAHFCEHLLF-MGSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+     N +  F + LD FA FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEI-----NHQHLFGA-LDRFAGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L NP+HP+ +FSTGNI +L ++P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFSTGNIETLGTLPKENG 244

Query: 202 IKLKSSLNTYFENNFFGENIT-LCIRGPQSVNILTKLALSKFGDI 245
             ++  L   F NNF+  N+  LCI G + ++ L+    + F DI
Sbjct: 245 QNVRDEL-LQFHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDI 288

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  151 bits (381), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 131/226 (57%), Gaps = 7/226 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R+++  +LPN + AL+ISDPT   ++ +L V  G+  DP+++ GLAH CEH++   GS 
Sbjct: 44  DRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLF-MGSS 102

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           K+P+   + + ++K+ GS NA+T  + T +YF++     N E  +   LD F+ FF  PL
Sbjct: 103 KFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQV-----NYEHLY-GALDRFSGFFTGPL 156

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGN+ +L + P+  
Sbjct: 157 FNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKEL 216

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
            + ++  L  ++  ++    + LCI G + ++ +TK     F D+K
Sbjct: 217 GLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDVK 262

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  149 bits (377), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 136/240 (56%), Gaps = 10/240 (4%)

Query: 8   NYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLA 67
           N+++SF  P    +R ++  +LPN + AL+I DP    ++ +L +  G+  DP++I GLA
Sbjct: 47  NHKISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLA 105

Query: 68  HLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFES 127
           H CEH++   GS K+PD   + + ++K+ G+ NA+T  + T +YF++ +    G      
Sbjct: 106 HFCEHLLF-MGSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNHEDLRG------ 158

Query: 128 ILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFST 187
            LD F+ FF  PLFN     KEI A+ SE++ N+ +     Y   +   +P HP+ +FST
Sbjct: 159 ALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFST 218

Query: 188 GNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENIT-LCIRGPQSVNILTKLALSKFGDIK 246
           GN+ +L   P+ + + ++  L  ++ N F+  NI  LC+ G + ++ +++     F D++
Sbjct: 219 GNLKTLGETPKNQGLDIRDELLKFY-NKFYSANIMKLCVLGREDLDTMSEWVYELFKDVR 277

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 910 LRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYL 954
           LR K+Q+GY+V         TV + + + S      LE+RI+ +L
Sbjct: 820 LRTKEQLGYVVFSSALSTHGTVNLRLLIQSERDSSYLESRIDSFL 864

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  149 bits (376), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 130/225 (57%), Gaps = 9/225 (4%)

Query: 22  RTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKK 81
           R+++  +LPN + AL+I DP    ++ SL V  G+  DPK++ GLAH CEH++   GS+K
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLF-MGSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+     N +  F + LD F+ FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV-----NHQHLFGA-LDRFSGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGNI +L ++P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPKENG 244

Query: 202 IKLKSSLNTYFENNFFGENIT-LCIRGPQSVNILTKLALSKFGDI 245
           + ++  L   F  NF+  N+  LCI G + ++ L+      F D+
Sbjct: 245 LNVRDEL-LKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKDV 288

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 881  IQTAQRDDIKNLTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLRVLTDTVGIHITV 937
            IQ   + D+ +  L+ L+     L   P    LR K+Q+GY+V         T  I I +
Sbjct: 800  IQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILI 859

Query: 938  MSGSSGHNLETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPV 997
             S  +   LE RIN +      QVL    E DF +   E   N L Q      E SA   
Sbjct: 860  QSEHTTPYLEWRINNFYETFG-QVLRDMPEEDFEK-HKEALCNSLLQKFKNMAEESA--- 914

Query: 998  DLLNEIVANVQNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEM 1043
                   A +  GD Y   ++Q ++ + V N   +  ++F E++ M
Sbjct: 915  ----RYTAAIYLGD-YNFTHRQ-KKAKLVANITKQQMIDFYENYIM 954

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 133/229 (58%), Gaps = 7/229 (3%)

Query: 14  YIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHM 73
           +I     +R+++  +LPN   AL+I D +   S+ SL V  G+  DPK++ GLAH CEH+
Sbjct: 65  FIKPDLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHL 124

Query: 74  ILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFA 133
           +   GSKK+P+   + + + K+ GS NA+T  + T ++FE+ +   +G       LD F+
Sbjct: 125 LF-MGSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEINHEHLHGA------LDRFS 177

Query: 134 SFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSL 193
            FF  PLFNP   SKEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGN+ +L
Sbjct: 178 GFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTL 237

Query: 194 SSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKF 242
             +P+ + + +++ L  ++ +++    + LC+ G + ++ ++    + F
Sbjct: 238 DEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLF 286

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 128/225 (56%), Gaps = 7/225 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R ++  +LPN +  L++ D     S+ SL V  G+  DP+D+ GLAH CEH++   GSK
Sbjct: 66  DRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLF-MGSK 124

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           K+P+   + + ++K+ G+ NA+T  + T +YF +     N E  +++ LD F+ FF  PL
Sbjct: 125 KFPNENEYASFLSKHGGASNAYTASQNTNYYFHV-----NHENLYDA-LDRFSGFFSCPL 178

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L NP HP+ +FSTGN  +L SIP+ K
Sbjct: 179 FNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSK 238

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
            + ++  L  ++  ++    + L I G + ++ L + A   F D+
Sbjct: 239 GVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDV 283

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 56/272 (20%), Positives = 115/272 (42%), Gaps = 23/272 (8%)

Query: 688 IGYTYEIA----SSSKGNVTLRFTISGFPEGVFTIVKTFVDTL-KLIATDPTFLSKDTLR 742
           + Y  E A    S  K N  L  ++SG+ + +  ++  F + + KL   +  F+    + 
Sbjct: 613 LAYNAECAGLEISLRKTNQGLDLSLSGYNDKLLVLLARFFEGIQKLFLREERFM----VL 668

Query: 743 KARILVRNKYKNASSDNCVKLASVGLLI--VLEKYIWTLEDRINALELTELESFEKFCFL 800
           K R++   K  N   D       +G L   ++ +  WT +++++  E    +    F   
Sbjct: 669 KQRLI--QKLHNHLYD--TPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLANFVPT 724

Query: 801 FWRNPKHLVLFMQGSLEYADAINRY-LNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQG 859
            +    +  L + G+  + +A+  Y L ++   +   ++EG    +R Y  P+      G
Sbjct: 725 IYEQ-MYFELLVHGNFSHEEALEVYDLVSSLVPNEIRNSEGRNSKLRSYFIPAG-----G 778

Query: 860 TNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYI 919
              + +    +++ N+ I   IQ     ++ +   + L + + +      LR ++Q+GY+
Sbjct: 779 AYHYETALADKENVNSCIQKVIQLGAYSELLSAKGSLLAQ-MVNEPCFNTLRTEEQLGYV 837

Query: 920 VLGGLRVLTDTVGIHITVMSGSSGHNLETRIN 951
           V         TV + I V S  S   LE+RI+
Sbjct: 838 VFSSKLNTHGTVNLRILVQSERSSSYLESRID 869

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 130/225 (57%), Gaps = 7/225 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R ++  +LPN + AL+ISD     ++ +L V  GS  DP+ + GLAH CEH++   G++
Sbjct: 59  DRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLF-MGNE 117

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           KYPD   + + ++K+ GS NA+T  + T +YF L     N E  + + LD F+ FF  PL
Sbjct: 118 KYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL-----NHENLYPA-LDRFSGFFSCPL 171

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L N +HP+ +FSTGNI +L  IP+LK
Sbjct: 172 FNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLK 231

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
            I +++ L  + +NN+    + LC+ G + ++ L       F D+
Sbjct: 232 GIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV 276

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 134/237 (56%), Gaps = 8/237 (3%)

Query: 10  EVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHL 69
           +V F  P    +R ++  +LPN + ALII D T   ++ +L V  G+  DP+++ GLAH 
Sbjct: 50  KVQFLKP-DLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHF 108

Query: 70  CEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESIL 129
           CEH++   GS+K+PD   + + ++K+ GS NA+T  + T ++FE+     +G       L
Sbjct: 109 CEHLLF-MGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHLHG------AL 161

Query: 130 DVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGN 189
           D F+ FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N DHP+ +FSTGN
Sbjct: 162 DRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGN 221

Query: 190 IHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
           + +L   P+   + ++  L  ++  N+    + LCI G + ++ L++ A   F D+K
Sbjct: 222 LETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVK 278

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 124/299 (41%), Gaps = 36/299 (12%)

Query: 699 KGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSD 758
           K N  L  TISGF E +  ++K FV+ ++    +P    K+     +    +  KN   +
Sbjct: 622 KTNQGLDITISGFNEKLLILLKRFVEGVQ--GFEP---KKERFEVFKDKTVHHLKNQMME 676

Query: 759 NCVKLASVGLLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEY 818
                 S     V+ +  W  ++++   E  + E  + F    + +  +   F+ G+LE 
Sbjct: 677 VPYSQISGLYNSVVNERTWPTKEKLEVAEKLKFEQLDNFVRAIY-DGMYYESFVHGNLES 735

Query: 819 ADA------INRYLNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDD 872
            +A      ++ +L  +  +++ + +      +R Y  P  K     T+ +      +++
Sbjct: 736 KEAREVDSLVSTFLKKDDIKNIDVQSN----RLRSYIIPKGKSYAYETDLY-----DENN 786

Query: 873 PNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVPD---LRNKKQIGYIVLGGLRVLTD 929
            N+ I + +Q     D+ N  L+ L+     +   P    LR K+Q+GY+V         
Sbjct: 787 VNSCIQHVVQL----DVYNEKLSALSGLFAQMLHEPCFDILRTKEQLGYVVFSSSLNNHG 842

Query: 930 TVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEFDFR-------RILLEPFLNL 981
           T  I I V S  +   LE RI+E+      ++ N   E DF        + LL+ F N+
Sbjct: 843 TANIRILVQSEHTTPYLEWRIDEFYKTFGEKLRN-MDEEDFNKHKEALCKTLLQKFKNM 900

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 136/244 (55%), Gaps = 8/244 (3%)

Query: 2   SLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPK 61
           ++    N+ + F  PL   +R ++  +LPN +  L+I D     ++ +L V  GS  DP+
Sbjct: 37  TMASYVNHNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPE 95

Query: 62  DIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNG 121
           ++ GLAH CEH++   GS KYP+   + + ++K+ G  NA+T+ + T ++F++    N G
Sbjct: 96  NLPGLAHFCEHLLF-MGSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQV----NQG 150

Query: 122 EFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHP 181
                  LD F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  ++P+HP
Sbjct: 151 --NLHGALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHP 208

Query: 182 FSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSK 241
           + +FSTGN+ +L  +P+ + + ++  L  ++  ++    + LC+ G + +++L++     
Sbjct: 209 YHKFSTGNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDL 268

Query: 242 FGDI 245
           F D+
Sbjct: 269 FKDV 272

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 910 LRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEFD 969
           LR K+Q+GY+V         TV + I + S      LE+RI+ +L+ +  Q+L   +E +
Sbjct: 816 LRTKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLESRIDAFLAKMG-QILQDMSEEE 874

Query: 970 FRR-------ILLEPFLNLLKQNS 986
           F R        LL+ + NL ++NS
Sbjct: 875 FERHRTALCKTLLQRYKNLSEENS 898

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  146 bits (368), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 74/226 (32%), Positives = 129/226 (57%), Gaps = 7/226 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R+++  +LPN + AL+ISDP    ++ S+ V  G+  DP+++ GLAH CEH++   GS+
Sbjct: 90  DRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLF-MGSE 148

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           K+PD   + + ++K+ G  NA+T    T ++FE+ +   +G       LD F+ FF  PL
Sbjct: 149 KFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEVNHEHLHG------ALDRFSGFFTGPL 202

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
            N     KEI A+ SE++ N+ +     Y   + ++N +HP+ +FSTGNI +L   P   
Sbjct: 203 MNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKL 262

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
            +  ++ L  ++ +++    + LCI G Q ++ L+  A   F D+K
Sbjct: 263 GLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDVK 308

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 81/376 (21%), Positives = 153/376 (40%), Gaps = 61/376 (16%)

Query: 619 KPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSPEATIHLEVLAQALFI-- 676
           +P L+ +N   ++W  K+D  +       VS ++      PS ++ I +  L   L++  
Sbjct: 577 EPHLILDNDISKVWYKKDDRFWQPRGYIYVSMKL------PSCQSGI-VNSLLNGLYVDQ 629

Query: 677 ---ITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIA-TD 732
                    Y A         +S+++G   L  TISGF + +  ++  F++ +KL   ++
Sbjct: 630 INDYMKDLQYDASCANLNLSFSSTNQG---LDITISGFNDKLLVLLSRFIEGVKLYQPSE 686

Query: 733 PTFLSKDTLRKARILVRNKYKNASSDNC------VKLASVGLL--IVLEKYIWTLEDRIN 784
             F              N +KN +  N       V  + +G L   ++ +  W ++++++
Sbjct: 687 ERF--------------NIFKNKAIQNLKNSLFEVPYSQMGTLYNTIMNESTWPIKEKLD 732

Query: 785 ALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHL---KISNEGS 841
            LE    + F  F    + N  +    + G++ Y +A+     N+  + L   KI N   
Sbjct: 733 VLEALTFDQFVSFVPSIY-NEFYFDALVHGNIRYEEAMEA---NDLLKSLASFKILNLHV 788

Query: 842 KPT-IRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQ----TAQRDDIKNLTLTF 896
           + + +R Y  P  +      +        +D+ N+ I + +Q    T +   +  L    
Sbjct: 789 RNSRLRSYILPEGESYRYEIDM-----EDKDNLNSCIQHVVQLGLYTEELSALSGLFAQM 843

Query: 897 LTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSY 956
           + E  F       LR K+Q+GY+V         T  + I V S  S   LE RI+E+   
Sbjct: 844 IREPCFDT-----LRTKEQLGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEFYKK 898

Query: 957 LQLQVLNRFTEFDFRR 972
              + LN  +E DF +
Sbjct: 899 FG-ESLNNMSEEDFEK 913

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  145 bits (367), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 128/225 (56%), Gaps = 7/225 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R+++  +LPN + AL+I D     ++ +L V  G+  DP+ + GLAH CEH++   GS+
Sbjct: 46  DRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEHLLF-MGSE 104

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           KYPD   + + ++K+ G+ NA+T  + T +YFE+     N E  F   LD FA FF  PL
Sbjct: 105 KYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV-----NHEHLF-GALDRFAGFFTCPL 158

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ S     Y   + L N +HP+ +FSTGN  +L  IP   
Sbjct: 159 FNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIPTSN 218

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
            I ++  L  +++ ++    + LC+ G + ++ L+  A S F D+
Sbjct: 219 GIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQDV 263

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 129/225 (57%), Gaps = 9/225 (4%)

Query: 22  RTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKK 81
           R+++  +LPN + AL+I DP    ++ SL V  G+  DP+ + GLAH CEH++   GS+K
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLF-MGSEK 130

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+     N +  F++ LD F+ FF  PLF
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNYFFEV-----NHQHLFDA-LDRFSGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGNI +L + P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENG 244

Query: 202 IKLKSSLNTYFENNFFGENIT-LCIRGPQSVNILTKLALSKFGDI 245
           + ++  L   F  +F+  N+  LCI G + ++ L+      F ++
Sbjct: 245 LNIRDEL-LKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKNV 288

 Score = 36.6 bits (83), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 94/392 (23%), Positives = 156/392 (39%), Gaps = 58/392 (14%)

Query: 619 KPQLVSENQNYEMWILKEDPNFASDNKSVVSFEV--LGLGIKPSPEATIHLEVLAQALFI 676
           +P L+  +    +W  K+D  +       +SF++      I  S  +T++++++  AL  
Sbjct: 557 EPILLLSDGGSRLWYKKDDRFWQPRGYIYLSFKLPHTHASIVNSMLSTLYIQLVNDALKD 616

Query: 677 ITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPT-- 734
           +        LRI +       SK N  L  T SGF E +  ++  F+  +   + +P   
Sbjct: 617 LQYDAACADLRISF-------SKTNQGLDITASGFNEKLIILLTRFLQGV--TSFEPKKD 667

Query: 735 ---FLSKDTLRKARILV-------RNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRIN 784
               L   T+R  + L+        + Y NA   N    ++V  L V EK   T E  IN
Sbjct: 668 RFEILKDKTIRHLKNLLYEVPYSQMSNYYNALI-NERSWSTVEKLQVFEKL--TFEQLIN 724

Query: 785 ALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKPT 844
            +       F  F  L   N KH     + ++E    I   + NN   +L+++N      
Sbjct: 725 FIPTIYEGVF--FETLIHGNIKH-----EEAVEVDSLIKSLITNNIN-NLQVANN----R 772

Query: 845 IRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSL 904
           +R Y  P  K           Y     D  N +   IQ   + D+ +  L+ L+     L
Sbjct: 773 LRSYLLPKGKSF--------RYETALKDSQN-VNSCIQHVTQLDVYSEELSALSGLFAQL 823

Query: 905 TLVP---DLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQV 961
              P    LR K+Q+GY+V         T  I I + S  +   LE RIN +      Q+
Sbjct: 824 IHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFG-QI 882

Query: 962 LNRFTEFDFRR-------ILLEPFLNLLKQNS 986
           L   T+ DF +        LL+ F N+ ++++
Sbjct: 883 LRDMTKEDFEKHKEALCNSLLQKFKNMAEESA 914

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  143 bits (361), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 126/225 (56%), Gaps = 9/225 (4%)

Query: 22  RTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKK 81
           R+++  +LPN + AL+I DP    ++ SL V  G+  DP+++ GLAH CEH++   GS+K
Sbjct: 73  RSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGLAHFCEHLLF-MGSEK 131

Query: 82  YPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLF 141
           +PD   + + ++K+ GS NA+T  + T ++FE+ +    G       LD F+ FF  PLF
Sbjct: 132 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLLG------ALDRFSGFFSCPLF 185

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKK 201
                 KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGNI +L   P+   
Sbjct: 186 QKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFSTGNIETLGESPKENG 245

Query: 202 IKLKSSLNTYFENNFFGENIT-LCIRGPQSVNILTKLALSKFGDI 245
           + ++  L   F  +F+  NI  LCI G + ++ L++     F D+
Sbjct: 246 LNIRDEL-LKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKDV 289

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 82/385 (21%), Positives = 149/385 (38%), Gaps = 44/385 (11%)

Query: 619 KPQLVSENQNYEMWILKEDPNFASDNKSVVSFEV--LGLGIKPSPEATIHLEVLAQALFI 676
           +P L+  +    +W  K+D  +       +SF++      +  S  +T++++++  AL  
Sbjct: 558 EPMLLLSSGMSRLWYKKDDRFWQPRGYIYLSFKLPHTHASVINSMLSTLYIQMINDALKD 617

Query: 677 ITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFL 736
           +        LRI +        K N  L  T SGF E +  ++  F+  +  ++ +P   
Sbjct: 618 LQYDAACADLRISFV-------KTNQGLDITASGFNEKLIVLLTRFLQGV--VSFEP--- 665

Query: 737 SKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALELTELESFEK 796
            KD     +       KN   +      S     ++ +  W+  +++   E    E    
Sbjct: 666 KKDRFEILKDKTIRHLKNLLYEVPYSQMSNYYNSLINERSWSTAEKLQVFEKLTFEQLNS 725

Query: 797 FC-----FLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEGSKPTIRLYPPP 851
           F       +F+    H  +  + ++E    I   + NN   +L++SN      +R Y  P
Sbjct: 726 FIPTIYEGVFFETLVHGNIKHEEAIEVDSLIKSLIANNI-DNLQVSNN----RLRSYLLP 780

Query: 852 STKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVP--- 908
             K           Y     DP N +   IQ   + D+ +  L+ L+     L   P   
Sbjct: 781 KGKSF--------RYETDLKDPKN-VNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFD 831

Query: 909 DLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEF 968
            LR K+Q+GY+V         T  I I + S  +   LE RIN +      Q L   T+ 
Sbjct: 832 TLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFG-QHLKDMTQE 890

Query: 969 DFRR-------ILLEPFLNLLKQNS 986
           DF +        LL+ F N+ ++++
Sbjct: 891 DFDKHKEALCNSLLQKFKNMSEESA 915

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 125/228 (54%), Gaps = 7/228 (3%)

Query: 21  NRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           +R ++  +LPN +   +I D +   ++ +L V  G   DP+D+ GLAH CEH++   GS+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLF-MGSE 135

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
           K+P+   + + ++ + G+ NA+T+ + T +YF +    N+G       LD F+ FF  PL
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMV----NHGNLY--DALDRFSGFFTSPL 189

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           F+    +KE+ A+ SE++ N+ S         R L NP HPF +FSTGN  +L   P+ +
Sbjct: 190 FSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSR 249

Query: 201 KIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPK 248
            I+++  L  +++  +    + L I G + ++ L+  A   F D+  K
Sbjct: 250 GIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVPDK 297

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 94/471 (19%), Positives = 190/471 (40%), Gaps = 69/471 (14%)

Query: 631  MWILKEDPNFASDNKSVVSFEVLGL--GIKPSPEATIHLEVLAQALFIITSSFLYPALRI 688
            +W  K+D  +  +    VSF++      +  S  +T+++E++  +L       LY A   
Sbjct: 575  LWYKKDDRFWVPEGHVYVSFKLPHSYSSVVNSMLSTLYVEMVKDSL----KDLLYNAECA 630

Query: 689  GYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLKLIATDPTFLSKDTLRKARILV 748
             +      +++G   L  +++G+ + +  ++ + ++ ++    DP     D L+K  +L 
Sbjct: 631  NFEVSFVKTNQG---LDLSLTGYNDKMTLLLTSILEGIRNF--DPKKERFDVLQK--LLC 683

Query: 749  RNKYKNASSDNCVKLASVGLLI--VLEKYIWTLEDRINALELTELESFEKFCFLFWRNPK 806
            +  Y    +   V  + +G+L   ++    WT  +++   +    E F+ F    +    
Sbjct: 684  QKLYNRLYN---VPYSQIGVLYNSLINDRSWTPSEKLKVTKQLTFEHFKAFVPSIYEQ-M 739

Query: 807  HLVLFMQGSLEYADAI--NRYLNNNFTQHLKISN-EGSKPTIRLYPPPSTKDLDQGTNAF 863
            +    + G+     AI  N Y+ +     +K S    ++P  R Y  P  K     T  F
Sbjct: 740  YFETLVHGNFPENQAIELNSYICSLIPNQIKHSGARNNRP--RSYMLPEGKTYRYETTLF 797

Query: 864  ISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGG 923
                  +++ N+     IQ     +  N   + L + L +      LR ++Q+GY+V   
Sbjct: 798  -----DEENVNSCFEMVIQLGMYSEDMNAKGSLLAQ-LINEPCFNTLRTEEQLGYVVWSS 851

Query: 924  LRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLK 983
             +    +  + I V S S    +E+R++++L+                      F + L+
Sbjct: 852  KQNTHASTNLRILVQSESDTVYIESRVDKFLN---------------------NFADTLR 890

Query: 984  QNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQMRQHR-KVRNKIAEGRLNFQEDHE 1042
              S + FE   G   L N ++   +N          MR+   +    I  G  NF     
Sbjct: 891  SMSEQAFEKHKGA--LCNTLLQKFKN----------MREENFRFIGAIFSGDYNFLCKER 938

Query: 1043 MIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMITSPMAEKEIASRKM 1093
               I  ++ LT +  + F+E    I S + SKL+I + S  A++E   R++
Sbjct: 939  EAKI--IRSLTQQHMIDFYERH--ILSQKSSKLNIHLKS-QAKQESTLREI 984

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  120 bits (302), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 127/232 (54%), Gaps = 10/232 (4%)

Query: 22  RTHKVCKL-PNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSK 80
           R ++  KL  N + ALII D T   ++ +L V  G+  DP ++ GLAH CEH++   GSK
Sbjct: 39  RNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHLLF-MGSK 97

Query: 81  KYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPL 140
            +P+   + + + +N G  NA+T    T ++FE+     N    FE+ L  F+ FFK PL
Sbjct: 98  NFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEI-----NHANLFEA-LRRFSCFFKTPL 151

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI+AI SE++ N+ +     Y   + L+N +HP+ +FSTG+  +L    +  
Sbjct: 152 FNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLLENTETL 211

Query: 201 KIKLKSSLNTYFENNFFGENI-TLCIRGPQSVNILTKLALSKFGDIKPKSAV 251
            + ++  L  ++ N ++  NI  LCI G + +  L++ A   F ++  K+ +
Sbjct: 212 NLNIREELIKFY-NKWYSSNIMNLCIIGREDLGTLSRWAKILFENVPNKNVI 262

 Score = 32.7 bits (73), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 130/644 (20%), Positives = 243/644 (37%), Gaps = 128/644 (19%)

Query: 344 SHLWCELFGDESPGSLSYYLASKGWLTGCFAFTSEFAXXXXXXXXXXXXTNSGWENIKRI 403
           S++   LFG +  GS+S  L ++  +TG  + +   +            T  G    ++I
Sbjct: 310 SYILSHLFGHKGNGSISSLLKNQQLITGISSGSENISKENSLFSLNFDLTEDGINQYEKI 369

Query: 404 TTIV------LNRLLPSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGI 457
             IV      LN  LP  ++ N         E   I   SF Y+   + P    S+LS  
Sbjct: 370 IKIVFQYIKMLNSNLPQEWIYN---------ELKGISDNSFKYKQKIN-PASTVSQLSKR 419

Query: 458 LQDDLECLTPPNIFKGFKSLIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDN 517
           ++   +   P N     +   E D   + KY                    LK F+  DN
Sbjct: 420 ME---KTFIPINNILSHELFYEYDPQQLNKY--------------------LK-FLTPDN 455

Query: 518 MRLLLLGNIKSGNIFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTG 577
            R++L+    +G       +KS+      Y  + Y   + L   +    NS  E   P  
Sbjct: 456 SRIMLVSKNLNG------LHKSEKWYGTKYGVKDYPDGL-LKDLSNIKENS--ELYLPHK 506

Query: 578 NLFLPDCVSDPLKLQQLFLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKED 637
           N F+                CS+K        ++ +   + +P L+ ++   ++W  K+D
Sbjct: 507 NEFISTT-------------CSVK--------KVENHVAQIEPYLLKDDNISKLWYKKDD 545

Query: 638 PNFASDNKSVVSFEVLGLGIKPSPEATIHLEVLAQALFIITSSFL-----YPALRIGYTY 692
             +       VS ++      P   +++   VL      + +  L     Y A    Y  
Sbjct: 546 TFWLPRATIFVSIKL------PHTHSSLVANVLTSFYINLVNDALQDLRCYAACADLY-- 597

Query: 693 EIASSSKGNVTLRFTISGFPEGVFTIVKTFVDTLK-LIATDPTFLSKDTLRKARIL-VRN 750
              S +K N  L  T++G  + +  ++K +++ +K  +  +  F   + ++K  I  + N
Sbjct: 598 --VSLNKTNQGLDLTLTGLNDKLLILLKRYLEGIKSFVPNEERF---EVIKKQTIQSLTN 652

Query: 751 KYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVL 810
           +  +      +++  +   ++ E+  W++E+ +  ++  +    + F    ++      L
Sbjct: 653 RLYDVP---YIQMGDIYSSLINERS-WSVEENLKVVQDIDFPQLQDFIPTIYQE-----L 703

Query: 811 FMQ----GSLEY-----ADAINRYLNNNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTN 861
           F +    G+++Y      D++ R L  N  ++ ++ N+     +R Y  PS K       
Sbjct: 704 FFETLAFGNIQYEQAQEVDSLVRTLIPNTIKNSQVKND----RLRSYIIPSGKTF----- 754

Query: 862 AFISYNGHQDDPNN---SIVYFIQTAQRDDIKNLTLTFLTEYLFSLTLVPDLRNKKQIGY 918
               Y   Q D NN    I Y  Q     +     ++ L + +        LR K+Q+GY
Sbjct: 755 ---KYEVFQKDKNNLNTCIQYICQFGIYSEYLAAVVSLLAQIMHE-PCFNTLRTKEQLGY 810

Query: 919 IVLGGLRVLTDTVGIHITVMSGSSGHNLETRI----NEYLSYLQ 958
           IV         T  + I V S  S   L+ RI     ++LSYL+
Sbjct: 811 IVFSSSLSNHGTCNLSIMVQSEYSTDYLQFRIENFLKDFLSYLK 854

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           ++ +LPNG+     + P   ++S  + V  GS  +     G AH  EH+    G+K    
Sbjct: 30  RISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFK-GTKNRTQ 88

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +  + Q +        LDV +      + +P
Sbjct: 89  VGI--ELEIENLGSHLNAYTSRENTVYYAK--SLQED----IPRALDVLSDILTRSVLDP 140

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             + +E   I  E E       ++ +     ++  + P  R   G I ++ SI Q     
Sbjct: 141 KAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGRTILGPIENIKSIQQ----- 195

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
               L  Y   N+ G+ + L   G    + L +     FG I PKS
Sbjct: 196 --RDLKEYISTNYKGDRMALVGAGAVDHDELVRYGEKYFGHI-PKS 238

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 94/228 (41%), Gaps = 18/228 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+     + P  +S++  + V  GS  +     G AH  EH+    G+K    
Sbjct: 23  RTSVLPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAFK-GTKNRTQ 81

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   +  +N GS  NA+T+ E T +Y +   TQN       + +D+ +    + + + 
Sbjct: 82  VGIEMEI--ENIGSHLNAYTSRENTVYYAKTL-TQN-----IPNAVDILSDILTKSVLDT 133

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ +I Q     
Sbjct: 134 NAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNIKTIQQ----- 188

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKSAV 251
               L  Y   N+ G+ + L   G    + L + A   FG I PKS +
Sbjct: 189 --RDLREYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFGHI-PKSEI 233

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 95/238 (39%), Gaps = 18/238 (7%)

Query: 13  FYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEH 72
           F  PL+ +  + +   L NG+       P  +S++  + V  GS  +     G AH  EH
Sbjct: 11  FSRPLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAHFLEH 70

Query: 73  MILSAGSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDV 131
           +    G+K     G+   L  +N GS  NA+T+ E T +Y +   TQN       + +DV
Sbjct: 71  LAFK-GTKNRTQVGI--ELEIENIGSHLNAYTSRENTVYYAKTL-TQN-----IPNAVDV 121

Query: 132 FASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIH 191
            +      + +   I +E   I  E E       ++ +     +   D P  R   G I 
Sbjct: 122 LSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIE 181

Query: 192 SLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
           ++ +I        +  L  Y   N+ G+ + L   G      L + A   FG I PKS
Sbjct: 182 NIKTIQ-------RRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKYFGHI-PKS 231

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 92/223 (41%), Gaps = 17/223 (7%)

Query: 29  LPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLF 88
           LPNG+     S P   +++  + V TGS  + +   G AH  EH+    G++     G+ 
Sbjct: 38  LPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAFK-GTQNRSQTGI- 95

Query: 89  HTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNPLLIS 147
             L  +N GS  NA+T+ E T +Y +      + +      +D+ A      + +P  I 
Sbjct: 96  -ELEIENIGSHLNAYTSRENTVYYAK------SLKQDIPKAVDILADILTRSVLDPKAIE 148

Query: 148 KEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIKLKSS 207
           +E   I  E E       ++ +     +   + P  R   G I ++ SI        +S 
Sbjct: 149 RERDVIIRESEEVDKMYDEVVFDHLHTITYKNQPLGRTILGPIKNIKSIQ-------RSD 201

Query: 208 LNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKSA 250
           L  + E ++ G+ + L   G    + L + A   FG ++   A
Sbjct: 202 LQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFGHVRKSEA 244

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 88/220 (40%), Gaps = 17/220 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+       P  +S++  + V  GS  + +   G AH  EH+    G+K    
Sbjct: 28  RTSVLPNGLTVATEWMPNTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAFK-GTKNRSQ 86

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +      + +      +D+ +      + +P
Sbjct: 87  KGI--ELEIENIGSHLNAYTSRENTVYYAK------SLKEDIPKAVDILSDILTRSVLDP 138

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ SI       
Sbjct: 139 EAIERERDVIIRESEEVDKMYDEVVFDHLHEVTYKDQPLGRTILGPIKNIQSI------- 191

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFG 243
            +  L+ Y  +N+ G+ + L   G      L + A   FG
Sbjct: 192 TRDDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYAQRCFG 231

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 91/226 (40%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +  KLPNG+       P  +S++  + V  GS  +     G AH  EH+    G++    
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +      + E      +D+ +    + + + 
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK------SLEEDIPKAVDILSDILTKSVLDS 137

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ SI       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            +S L  Y   N+ G+ + L   G      L + A   FG + P+S
Sbjct: 191 TRSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFGHV-PRS 235

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 95/233 (40%), Gaps = 17/233 (7%)

Query: 14  YIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHM 73
           +I  + S  T +   LPNG+       P  +S++  + V  GS  +     G AH  EH+
Sbjct: 15  FIHQAASIPTTRTSILPNGLTVATELIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHL 74

Query: 74  ILSAGSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVF 132
               G++     G+   L  +N GS  NA+T+ E T +Y +      + +      +D+ 
Sbjct: 75  AFK-GTQNRSQKGI--ELEIENIGSHLNAYTSRENTVYYAK------SLKEDIPKAVDIL 125

Query: 133 ASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHS 192
           +    + + +P  I +E   I  E E       ++ +     +   D P  R   G I +
Sbjct: 126 SDILTKSVLDPRAIERERDVIIRESEEVDKMHDEVVFDHLHAITYKDQPLGRTILGPIKN 185

Query: 193 LSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDI 245
           + SI        ++ L  Y   N+ G+ + L   G  + + L + A   FG +
Sbjct: 186 IKSI-------TRNDLREYITKNYKGDRMVLAGAGAVNHDELVEYAQKYFGHL 231

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 92/226 (40%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +  KLPNG+       P  +S++  + V  GS  +     G AH  EH+    G++    
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +  + Q +        +D+ +    + + + 
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK--SLQED----IPKAVDILSDILTKSVLDN 137

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ SI       
Sbjct: 138 SAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            ++ L  Y   N+ G+ + L   G      L + A   FG + PKS
Sbjct: 191 TRTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHV-PKS 235

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 88/223 (39%), Gaps = 17/223 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           ++  L NG+       P  ++++  + V  GS  +     G AH  EH+    G++    
Sbjct: 26  QISVLANGLTVASERIPNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAFK-GTQNRTQ 84

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +      + E      +D+ +      + +P
Sbjct: 85  TGI--ELEIENIGSHLNAYTSRENTVYYAK------SLENDIPQAVDILSDILTRSVLDP 136

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ +I       
Sbjct: 137 RAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLGRTILGPIKNIKTIQ------ 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
            +  L  Y   N+ G+ + L   G    + L   A + FG I+
Sbjct: 191 -RDDLQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFGHIR 232

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 91/223 (40%), Gaps = 17/223 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+       P  +S++  + V  GS  +     G AH  EH+    G++    
Sbjct: 26  RTSTLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTENRSQ 84

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
             +   L  +N GS  NA+T+ E T +Y +  + QN+        +++ +    +   +P
Sbjct: 85  RAI--ELEIENIGSHLNAYTSRENTVYYAK--SLQND----IPKAVEILSDILTKSTLDP 136

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +A  D P  R   G I ++ SI       
Sbjct: 137 RAIERERDVIIRESEEVDKMYDEVVFDHLHDIAYKDQPLGRTILGPIKNIKSIS------ 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
            ++ L +Y   N+ G+ + L   G    + L   A   FG ++
Sbjct: 191 -RTDLKSYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFGHLQ 232

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 88/228 (38%), Gaps = 27/228 (11%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   L NG+       P   S++  + V  GS  +     G AH  EH+    G+K    
Sbjct: 30  RTSVLDNGLTVATEFIPNTASATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTKNRSQ 88

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYF-----ELPNTQNNGEFTFESILDVFASFFKE 138
            G+   L  +N GS  NA+T+ E T +Y      ++P             +D+ +    +
Sbjct: 89  RGI--ELEIENIGSHLNAYTSRENTVYYAKSLREDIPKA-----------VDILSDILTK 135

Query: 139 PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQ 198
            + +P  I +E   I  E E       ++ +     +A  D P  R   G I ++ SI  
Sbjct: 136 SVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYRDQPLGRTILGPIKNIKSIK- 194

Query: 199 LKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
                 ++ L  Y   N+ G+ + L   G    + L   A   FG +K
Sbjct: 195 ------RTDLQNYIMTNYKGDRMVLASAGSVDHDNLVAYAQKYFGHLK 236

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 92/226 (40%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +  KLPNG+       P  +S++  + V  GS  +     G AH  EH+    G++    
Sbjct: 27  RTSKLPNGLTIASEYIPNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +  + Q +        +++ +    + + + 
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK--SLQED----IPKAVEILSDILTKSVLDS 137

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ SI       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            +S L  Y   N+ G+ + L   G      L + A   FG + PKS
Sbjct: 191 TRSDLKNYITKNYKGDRMVLAGAGAVDHEKLVEHAQKYFGHV-PKS 235

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 92/231 (39%), Gaps = 26/231 (11%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           ++ KL NG+       P  ++++  + V  GS  +     G AH  EH+     SK+   
Sbjct: 28  EISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQK 87

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
                 L  +N GS  NA+T+ E T +Y +          T +  L +      + L N 
Sbjct: 88  Q---IELDIENIGSHLNAYTSRENTVYYAK----------TLKENLPLAVDILSDILTNS 134

Query: 144 LL----ISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQL 199
            L    I +E   I  E E       ++ +     +A  D P  R   G I ++ SI   
Sbjct: 135 KLEKNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLGRTILGPIKNIKSIN-- 192

Query: 200 KKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKSA 250
                +S L  Y  +N+ G+ + L   G  +   L KLA   FG + PK +
Sbjct: 193 -----RSDLVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFGHL-PKGS 237

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 90/231 (38%), Gaps = 28/231 (12%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   L NG+       P  ++++  + V  GS  + +   G AH  EH+    G+K    
Sbjct: 21  RTSVLNNGLTVATERIPEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAFK-GTKDRTQ 79

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYF-----ELPNTQNNGEFTFESILDVFASFFKE 138
            G+   L  +N GS  NA+T+ E T +Y      ++P             +D+ +     
Sbjct: 80  SGI--ELEIENIGSHLNAYTSRENTVYYAKSLRDDIPRA-----------VDILSDILTR 126

Query: 139 PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQ 198
            + +P  I +E   I  E E       ++ +     +A  D    R   G + ++ SI  
Sbjct: 127 SVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLGRTILGPVKNIKSI-- 184

Query: 199 LKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
                 +  L  Y   N+ G+ + L   G    + L K A   FG I PKS
Sbjct: 185 -----TRKDLKDYITKNYKGDRMVLAGAGAVDHDDLVKQAERFFGHI-PKS 229

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 99/257 (38%), Gaps = 34/257 (13%)

Query: 1   MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60
           +++R ++       +P     RT ++ +L NGI       P  ++++  + V  GS  + 
Sbjct: 8   LAVRRLSTAAAGGTVP-----RT-QISQLSNGITVASEVLPNTSTATVGIFVDAGSRAEN 61

Query: 61  KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYF-----EL 114
               G AH  EH+    G+      G+   L  +N GS  NA+T+ E T +Y      ++
Sbjct: 62  SRNNGTAHFLEHLAFK-GTTNRSQVGI--ELEIENIGSHLNAYTSRENTVYYAKSLKEDI 118

Query: 115 PNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARI 174
           P             +D+ +        NP  I +E   I  E E       ++ +     
Sbjct: 119 PKA-----------MDILSDILTRSTLNPKAIERERDVIIRESEEVDKMYDEVVFDHLHA 167

Query: 175 LANPDHPFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNIL 234
           +   D    R   G I ++ SI        +  L  Y   N+ G+ + L   G    + L
Sbjct: 168 ITYKDQALGRTILGPIENIKSIQ-------RKDLAEYISTNYTGDRMALVGAGSVDHDKL 220

Query: 235 TKLALSKFGDIKPKSAV 251
            +     FG I+ KSAV
Sbjct: 221 VEYGERYFGHIR-KSAV 236

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 91/226 (40%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +  +LPNG+       P  +S++  + V  GS  +     G AH  EH+    G++    
Sbjct: 27  RTSRLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T +Y +  + Q +        + + +    + + + 
Sbjct: 86  QGI--ELEIENIGSHLNAYTSRENTVYYAK--SLQED----IPKAVGILSDILTKSVLDN 137

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +   D P  R   G I ++ SI       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            +S L  Y   N+ G+ + L   G      L + A   FG + PKS
Sbjct: 191 TRSDLKNYITRNYKGDRMVLAGAGAVDHEELVEYAQKYFGHV-PKS 235

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 90/226 (39%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+       P  +S++  + V  GS  +     G AH  EH+    G+K    
Sbjct: 30  RTSVLPNGLTVASERLPNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAFK-GTKNRSQ 88

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
            G+   L  +N GS  NA+T+ E T ++ +      + E      +++ +      + +P
Sbjct: 89  TGI--ELEIENIGSHLNAYTSRENTVYFAK------SLEEDVPRAVEILSDILTRSVLDP 140

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +A  +    R   G I ++ +I       
Sbjct: 141 KAIERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALGRTILGPIKNIKTI------- 193

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            +  L  Y + N+ G+ + L   G      L + A   FG I PK+
Sbjct: 194 TREDLKNYIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFGHI-PKA 238

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 88/226 (38%), Gaps = 18/226 (7%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           +   LPNG+       P  ++++  + V  GS  + +   G AH  EH+    G++    
Sbjct: 29  RTSVLPNGLTVASEFIPNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFK-GTQNRSQ 87

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
             +   L  +N GS  NA+T+ E T +Y +      + E      +++ +      + +P
Sbjct: 88  TDI--ELEIENIGSHLNAYTSRENTVYYAK------SLEGDVPKAVNILSDILTRSVLDP 139

Query: 144 LLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQLKKIK 203
             I +E   I  E E       ++ +     +A    P  R   G I ++ SI       
Sbjct: 140 KAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLGRTILGPIKNIKSIS------ 193

Query: 204 LKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPKS 249
            +  L +Y   N+ G+ + L   G      L   A    G I PKS
Sbjct: 194 -RKDLKSYITENYKGDRMVLAAAGAVDHEKLVDYAQKYLGHI-PKS 237

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 87/228 (38%), Gaps = 27/228 (11%)

Query: 25  KVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPD 84
           K   L NG+       P  +++S  + V  GS  +     G AH  EH+     + +   
Sbjct: 61  KTTVLSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTRSQR 120

Query: 85  PGLFHTLIAKNNGSQ-NAFTTGEQTTFYFE-----LPNTQNNGEFTFESILDVFASFFKE 138
                 L+ +N GS  NA+T+ E T +Y +     +PN            +D+ +    +
Sbjct: 121 D---IELVIENLGSHLNAYTSRENTVYYAKTLKDNIPNA-----------IDILSDILTK 166

Query: 139 PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSIPQ 198
              +   I +E   I  E E       ++ +     +   D P  R   G I ++++I  
Sbjct: 167 STLDKNAIERERSVIIRESEEVDQMYDEVVFDHLHEIVYKDQPLGRTILGPIKNINTIQ- 225

Query: 199 LKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIK 246
                 ++ L  Y   N+ G+ + L   G  +   L K A   FG +K
Sbjct: 226 ------RNDLQNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVK 267

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 86/227 (37%), Gaps = 17/227 (7%)

Query: 18  SYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSA 77
           SY  ++  + +L NG+       P   +++  + V  GS  +     G AH  EH+    
Sbjct: 5   SYLQQSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFK- 63

Query: 78  GSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFF 136
           G++K     +   L  +N GS  NA+T+ E T +Y +               +D+ +   
Sbjct: 64  GTEKRSQKKI--ELDIENIGSHLNAYTSRENTVYYAKTLKEN------VPQAIDILSDIL 115

Query: 137 KEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSI 196
            +   +   I +E   I  E E       ++ +     +A  D    R   G I ++ SI
Sbjct: 116 TKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSI 175

Query: 197 PQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFG 243
                   +  L  Y   N+ G+ + L   G    N + K A   FG
Sbjct: 176 T-------RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 215

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 86/227 (37%), Gaps = 17/227 (7%)

Query: 18  SYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSA 77
           SY  ++  + +L NG+       P   +++  + V  GS  +     G AH  EH+    
Sbjct: 15  SYLQQSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFK- 73

Query: 78  GSKKYPDPGLFHTLIAKNNGSQ-NAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFF 136
           G++K     +   L  +N GS  NA+T+ E T +Y +               +D+ +   
Sbjct: 74  GTEKRSQKKI--ELDIENIGSHLNAYTSRENTVYYAKTLKEN------VPQAIDILSDIL 125

Query: 137 KEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHSLSSI 196
            +   +   I +E   I  E E       ++ +     +A  D    R   G I ++ SI
Sbjct: 126 TKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSI 185

Query: 197 PQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFG 243
                   +  L  Y   N+ G+ + L   G    N + K A   FG
Sbjct: 186 T-------RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 225

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 70/155 (45%), Gaps = 26/155 (16%)

Query: 8   NYEVSFYIPLSYSNRTHKVCKLPNGILALIIS---------DPTDTSSSCSLTVCTGSHN 58
           NY++   I     NR   + +L    + LI S         D  DT++      C G   
Sbjct: 20  NYKIGDLISGYQVNRVVPIPELQITAIDLIHSKTASKHLHIDTVDTNN----VFCVGFKT 75

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYP--DPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPN 116
           +P D  G+AH+ EH  L  GSKKYP  DP  F  L    +   NA T  + T + F   N
Sbjct: 76  NPPDSTGVAHILEHTTL-CGSKKYPVRDP-FFKMLNRSLSNFMNAMTGHDYTMYPFATTN 133

Query: 117 TQNNGEFTFESILDVFASFFKEPLFNPLLISKEIY 151
           +++     F+++ DV+     +  F+PLL  ++ +
Sbjct: 134 SKD-----FKNLQDVYL----DATFSPLLKQEDFF 159

>Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL098C
           - Hypothetical ORF [contig 184] FULL
          Length = 1040

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GSKKYP  GL  T       S NA+T  +QT +        +
Sbjct: 53  PTD-SGVPHTLEHLIF-MGSKKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
            G   F+++L V+      P  +    + E+Y +  E
Sbjct: 106 AGWLGFKNLLPVYLDHVLHPTISDHACTTEVYHVDPE 142

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 44/106 (41%), Gaps = 10/106 (9%)

Query: 51  TVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTF 110
            V T   ND    +G+ H  EH+I   GSKKYP  GL  TL      S NA+T  +QT +
Sbjct: 47  AVATECPND----SGVPHTLEHLIF-MGSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
                  Q      F+ +L V+      P         E+Y I  +
Sbjct: 102 TLTSAGWQG-----FKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQ 142

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 13/103 (12%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFY-FELPNT 117
           +P +  G+ H+ EHM L  GS KYP    F  ++ ++  +     TG   TFY F   N 
Sbjct: 75  NPPNATGVPHILEHMTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFYPFATTNK 133

Query: 118 QNNGEFTFESILDVFASFFKEPLFNPLLISKEIY--AIQSEHE 158
            +     FE++ DV+     +  FNPLL  ++ Y    + EHE
Sbjct: 134 AD-----FENLRDVYL----DATFNPLLKPEDFYQEGWRLEHE 167

>KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1042

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 7/97 (7%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GSKK+P  GL  T       S NA+T  +QT +       Q 
Sbjct: 53  PTD-SGVPHTLEHLIF-MGSKKFPYKGLLDTAGNLCMSSTNAWTATDQTVYTLTSAGWQG 110

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
                F+ +L V+      P       + E+Y +  E
Sbjct: 111 -----FKKLLPVYLDHVLHPTITDDACTTEVYHVDPE 142

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 69/169 (40%), Gaps = 11/169 (6%)

Query: 64  AGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEF 123
           +G+ H  EH+I   GS++YP  GL  T       + NA+T  + T   +EL +    G  
Sbjct: 56  SGVPHTLEHLIF-MGSQRYPRKGLLDTAGGITMSTTNAYTASDHTA--YELVSA---GWL 109

Query: 124 TFESILDVFASFFKEPLFNPLLISKEIYAIQSE---HEGNISSTTKIFYHAARILANPDH 180
            F+ +L V+      P       + E+Y +       +G + S  +   H +  +A  + 
Sbjct: 110 GFKKLLPVYLDHLLHPTLTEHAFTTEVYHLDPNDLTDKGVVYSEMEAREHESSDVAILEK 169

Query: 181 PFSRFSTGNIH--SLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRG 227
               F  GN +   +  + +  +    + +  +    +  +NI L I G
Sbjct: 170 GRQMFPEGNGYRSEVGGLTKHLRTLTNAEVRAFHAEMYTPDNICLVICG 218

>ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} similar
           to uniprot|Q12496 Saccharomyces cerevisiae YOL098C
           Hypothetical ORF
          Length = 1028

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 57/158 (36%), Gaps = 34/158 (21%)

Query: 8   NYEVSFYIPLSYSNRT--------HKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHND 59
           +Y   +++    S+RT        HK   L  G  A+    PTD+               
Sbjct: 12  DYAPQYHLTKYVSSRTRLQLVHINHKTSPLVQGYFAVATECPTDS--------------- 56

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
                G  H  EH++   GS+KYP  GL  T       S NA+T  +QT +       Q 
Sbjct: 57  -----GAPHTLEHLVF-MGSQKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTLTTAGWQG 110

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEH 157
                F+ +L V+      P         E++ I  +H
Sbjct: 111 -----FKKLLPVYLDHILNPTLTDESCLTEVHHIDPDH 143

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 39.3 bits (90), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P +  G+ H+ EH  L  GSKKYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPNSTGVPHVLEHTTL-CGSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFFPFATTNA 133

Query: 118 QNNGEFTFESILDVFASFFKEPLFNPLLISKEIY--AIQSEHEGNISSTTKIFYHAA 172
           ++     F ++ DV+     +   NPLL  ++ Y    + EH+     TT I +   
Sbjct: 134 KD-----FNNLRDVYL----DATLNPLLKQEDFYQEGWRLEHDTVTDVTTPIVFKGV 181

>SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1069

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 7/97 (7%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GS+K+P  GL  T       S NA+T  +QT +        +
Sbjct: 82  PTD-SGVPHTLEHLIF-MGSRKFPFKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 134

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+      P         E+Y +  E
Sbjct: 135 AGWLGFKKLLPVYLDHVLNPTLTDEACCTEVYHVDPE 171

>Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} similar
           to Ashbya gossypii AFR334W
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 54/138 (39%), Gaps = 17/138 (12%)

Query: 64  AGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEF 123
           +G  H  EH+I   GSKKYP  GL          + NA+T  +QT +     +  + G  
Sbjct: 56  SGAPHTLEHLIF-MGSKKYPWKGLLDISGGITMSNTNAWTATDQTVY-----SLTSAGWV 109

Query: 124 TFESILDVFASFFKEPLFNPLLISKEIYAIQ-----------SEHEGNISSTTKIFYHAA 172
            F+ +L V+      P       + E+Y I            SE EG  S+   I     
Sbjct: 110 GFKKLLLVYLDHIVNPRLTDEACTTEVYYIDPKDLVDKGVVYSEMEGIESAAYSITNLEV 169

Query: 173 RILANPDHPFSRFSTGNI 190
           + L  P+    R  TG +
Sbjct: 170 QRLMFPEGNAYRSETGGL 187

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 10/106 (9%)

Query: 51  TVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTF 110
            V T   ND    +G+ H  EH+I   GS KYP  GL  T+      S NA+T  +QT +
Sbjct: 47  AVATECGND----SGVPHTLEHLIF-MGSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
                   + G   F+ +L ++      P         E+Y I  +
Sbjct: 102 TL-----TSAGWTGFKKLLPMYLEHIINPTLTDDAYVTEVYHIDPD 142

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 17/108 (15%)

Query: 40  DPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYP--DPGLFHTLIAKNNG 97
           D  D +++ S++  T    +P D  G+ H+ EH  L  GS+KYP  DP  F  L    + 
Sbjct: 60  DSADKNNTFSISFKT----NPPDCTGVPHILEHTTL-CGSQKYPVRDP-FFKMLNRSLSN 113

Query: 98  SQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNPLL 145
             NA T  + T F F   N     E  F+++ DV+     +   NPLL
Sbjct: 114 FMNAMTAHDYTFFPFSTTN-----ETDFKNLRDVYI----DATLNPLL 152

>KAFR0E03250 Chr5 (647254..650208) [2955 bp, 984 aa] {ON} Anc_5.541
           YDR430C
          Length = 984

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 53  CTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFY 111
           C G   +  D  G+ H+ EH  L  GS++YP    F  ++ ++  +  NA T  + T F 
Sbjct: 69  CIGFKTNAPDSTGVPHILEHTTL-CGSQRYPVHDPFFKMLNRSVANFMNAMTGPDYTFFP 127

Query: 112 FELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIY 151
           F   N+++     F ++++++     +   NPLL  ++ Y
Sbjct: 128 FATTNSKD-----FNNLIEIYL----DSTLNPLLTEEDFY 158

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GSK++P  GL  T+      S NA+T  +QT +        +
Sbjct: 53  PND-SGVPHTLEHLIF-MGSKQHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
            G   F  IL  + +    P       + E+Y +  E
Sbjct: 106 AGWKGFSKILPAYLNHILFPTLTDDACTTEVYHVDPE 142

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 64  AGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEF 123
           +G  H  EH+I   GSK YP  GL  T    +  + NA+T  +QT +        + G  
Sbjct: 56  SGAPHTLEHLIF-MGSKSYPYKGLLDTAGNLSLSNTNAWTDTDQTVYTL-----SSAGWK 109

Query: 124 TFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGN 160
            F  +L  +      P         E+Y I  E+ G+
Sbjct: 110 GFSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGD 146

>ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]
           {ON} highly similar to uniprot|P32898 YDR430C
           Saccharomyces cerevisiae CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 11/98 (11%)

Query: 55  GSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFEL 114
           G   +P +  G+ H+ EH  L  GS KYP    F  ++ ++  +     TG   TFY   
Sbjct: 71  GFKTNPPNATGVPHILEHTTL-CGSVKYPVRDPFFKMLNRSLSNFMNAMTGPDYTFY--- 126

Query: 115 P-NTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIY 151
           P +T N  +F   ++ DV+     +  FNPLL  ++ Y
Sbjct: 127 PFSTTNRADFA--NLRDVYV----DATFNPLLTPEDFY 158

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFY-FELPNT 117
           +P D  G+ H+ EH  L  GS+KYP    F  ++ ++  +     TG   TFY F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFYPFATANK 133

Query: 118 QNNGEFTFESILDVFASFFKEPLFNPLL 145
            +     F ++ DV+     +  FNPLL
Sbjct: 134 AD-----FANLRDVYI----DATFNPLL 152

>KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1037

 Score = 36.6 bits (83), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 10/115 (8%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GS+KYP  GL  T       + NA+T  +QT +         
Sbjct: 53  PTD-SGVPHTLEHLIF-MGSEKYPYKGLLDTAGNLCMSNTNAWTATDQTVYTL-----ST 105

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARI 174
            G   F+ +L V+      P       + E+Y I  +   ++S    +F   A I
Sbjct: 106 AGWKGFKKLLPVYLDHLFFPTLTEDACTTEVYHIDPD---DLSDKGVVFSEMAGI 157

>TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1032

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 10/106 (9%)

Query: 51  TVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTF 110
            V T   ND    +G  H  EH+I   GSK YP  GL  T       S NA+T  +QT +
Sbjct: 47  AVATECPND----SGCPHTLEHLIF-MGSKSYPYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
                     G   F+++L V+      P         E++ I  E
Sbjct: 102 TL-----TTAGWKGFKTLLPVYLDHLLFPTLTDEACITEVHHIDPE 142

>ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR430C (CYM1)
          Length = 990

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 53  CTGSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFY 111
             G    P D  G+ H+ EH  L  GS+KYP    F  ++ ++  +  NA T  + T + 
Sbjct: 69  SVGFRTPPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTAHDHTFYP 127

Query: 112 FELPNTQNNGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISS 163
           F   N ++     F ++ D++      PL       +E + ++    G+ SS
Sbjct: 128 FATTNQKD-----FANLRDLYLDATLRPLLRHADFLQEGWRLEHRDVGDASS 174

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 55  GSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFEL 114
           G   +P D  G+ H+ EH  L  GS KYP    F  ++ ++  +     TG   TFY   
Sbjct: 71  GFKTNPPDSTGVPHILEHTTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY--- 126

Query: 115 PNTQNNGEFTFESILDVFASFFKEPLFN 142
           P    N E  F ++ DV+      PL N
Sbjct: 127 PFATTN-ETDFANLRDVYLDATLNPLLN 153

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 59/173 (34%), Gaps = 33/173 (19%)

Query: 6   VTNYEVSFYIP----LSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPK 61
           V  Y ++ YI     L   +  HK   L +G  A+    P D                  
Sbjct: 14  VPQYHITKYISERTKLQLVHINHKTSTLVHGYFAVPTECPND------------------ 55

Query: 62  DIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNG 121
             +G  H  EH+I   GSK YP  GL  T    +    NA+T  +QT +        + G
Sbjct: 56  --SGAPHTLEHLIF-MGSKSYPYKGLLDTAGNLSMSITNAWTDTDQTVYTL-----ASAG 107

Query: 122 EFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARI 174
              F  +L  +      P         E+Y I  E   N+S    +F     I
Sbjct: 108 WKGFSKLLPTYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVFSEMEAI 157

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D +G+ H  EH+I   GSK++P  GL  T+      S NA+T  +QT +        +
Sbjct: 53  PND-SGVPHTLEHLIF-MGSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
            G   F  +L  + +    P       + E+Y +  E
Sbjct: 106 AGWKGFSKLLPSYLNHILFPTLTDEACTTEVYHVDPE 142

>Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 59/173 (34%), Gaps = 33/173 (19%)

Query: 6   VTNYEVSFYIP----LSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPK 61
           V  Y ++ YI     L   +  HK   L +G  A+    P D+                 
Sbjct: 14  VPQYHITKYISERTKLQVVHINHKTSTLVHGYFAVPTECPNDS----------------- 56

Query: 62  DIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNG 121
              G  H  EH++   GSK YP  GL  T    +    NA+T  +QT +        + G
Sbjct: 57  ---GAPHTLEHLVF-MGSKSYPYKGLLDTAGNLSLSVTNAWTDTDQTVYTL-----SSAG 107

Query: 122 EFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARI 174
              F  +L  +      P         E+Y I  E   N+S    +F     I
Sbjct: 108 WKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVFSEMEAI 157

>KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 53/152 (34%), Gaps = 30/152 (19%)

Query: 9   YEVSFYIP----LSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIA 64
           Y+++ YI     L   +  HK   L  G  A+    PTD                    +
Sbjct: 17  YQITKYISERTKLQLVHVNHKSSPLVQGYFAVATECPTD--------------------S 56

Query: 65  GLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFT 124
           G  H  EH+I   GS+K+   GL  T       S NA+T  +QT +          G   
Sbjct: 57  GTPHTLEHLIF-MGSQKHHYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TTAGWKG 110

Query: 125 FESILDVFASFFKEPLFNPLLISKEIYAIQSE 156
           F+ +L  +      P         E+Y I  E
Sbjct: 111 FQKLLPAYLDHILNPTLTDAACMTEVYHIDPE 142

>KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.541
           YDR430C
          Length = 994

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN 119
           P D  G+ H+ EH  L  GS KYP    F  ++ K+  +     TG   TF+   P    
Sbjct: 88  PPDSTGVPHILEHTTL-CGSVKYPVHDPFFKMLNKSLANFMNAMTGPHYTFF---PFATT 143

Query: 120 NGEFTFESILDVFASFFKEPLFNPLL 145
           NG   F ++ DV+     + + NPLL
Sbjct: 144 NGR-DFANLRDVYL----DSILNPLL 164

>TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query: 55  GSHNDPKDIAGLAHLCEHMILSAGSKKYP--DPGLFHTLIAKNNGSQNAFTTGEQTTFYF 112
           G   +P D  G+ H+ EH  L  GS KYP  DP  F  L    +   NA T  + T F F
Sbjct: 71  GFKTNPPDSTGVPHILEHTTL-CGSVKYPVRDP-FFKMLNRSLSNFMNAMTAHDYTFFPF 128

Query: 113 ELPNTQNNGEFTFESILDVFASFFKEPLF 141
              N QN+    F+++ DV+      PL 
Sbjct: 129 ATTN-QND----FKNLRDVYIDATLRPLL 152

>KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 990

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 11/88 (12%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFY-FELPNT 117
           +P D +G+ H+ EH  L  GS+KYP    F  ++ ++  +     TG   TFY F   N 
Sbjct: 75  NPPDASGVPHILEHTTL-CGSEKYPVRDPFFKMLNRSLANFMNAMTGHDYTFYPFATANK 133

Query: 118 QNNGEFTFESILDVFASFFKEPLFNPLL 145
            +     F ++ DV+     +  F PLL
Sbjct: 134 AD-----FANLRDVYL----DATFKPLL 152

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 75/215 (34%), Gaps = 43/215 (20%)

Query: 24  HKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAHLCEHMILSAGSKKYP 83
           HK   L  G  A+    PTD+                    G  H  EH+I   GS+++P
Sbjct: 36  HKSSPLVQGYFAVATECPTDS--------------------GAPHTLEHLIF-MGSQQHP 74

Query: 84  DPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESILDVFASFFKEPLFNP 143
             GL  T       S NA+T  +QT +       Q      F+ +L  +      P    
Sbjct: 75  YKGLLDTAGNLCMSSTNAWTATDQTVYTLTSAGWQG-----FKQLLPAYLDHILNPTLTD 129

Query: 144 LLISKEIYAIQ-----------SEHEGNISSTTKIFYHAARILANPDHPFSRFSTGNIHS 192
                E+Y +            SE +   S +  +     + L  P+    R  TG +  
Sbjct: 130 AACLTEVYHVDPDDLSDKGVVFSEMDAIESQSWFVTMLEKQRLMFPEGSGYRSETGGL-- 187

Query: 193 LSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRG 227
               P L++I     +  + ++ +  +N+ L + G
Sbjct: 188 ---TPNLRQIS-NDEIRKFHKDAYSPDNLCLIVSG 218

>CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 Saccharomyces cerevisiae
           YDR430c
          Length = 990

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 11/93 (11%)

Query: 60  PKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNTQ 118
           P D  G+ H+ EH  L  GS+KYP    F  ++ K+  +  NA T  + T F F   N +
Sbjct: 76  PPDATGVPHILEHTTL-CGSEKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFATTNAR 134

Query: 119 NNGEFTFESILDVFASFFKEPLFNPLLISKEIY 151
           +     F ++ DV+ +        PLL  ++ Y
Sbjct: 135 D-----FVNLRDVYLN----STLRPLLKEQDFY 158

>TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {ON}
           Anc_5.541 YDR430C
          Length = 987

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 55  GSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFE 113
           G   +P D  G+ H+ EH  L  GS KYP    F  ++ ++  +  NA T  + T F F 
Sbjct: 71  GFKTNPPDCTGVPHILEHTTL-CGSYKYPVRDPFFKMLNRSLANFMNAMTGPDYTFFPFS 129

Query: 114 LPNTQNNGEFTFESILDVFASFFKEPLFNP 143
             N  +     F ++  V+ S    PL  P
Sbjct: 130 TTNKTD-----FANLRSVYLSSTLNPLLKP 154

>KNAG0E03600 Chr5 (719840..722107) [2268 bp, 755 aa] {ON} Anc_7.172
           YIR007W
          Length = 755

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 11/115 (9%)

Query: 558 LASDNKFHSNSSYEFN-FPTGNLFLPDCVSDPLKLQQLFLECSLKSKFATLRPQIYSEPT 616
           L + N F   S   F  F  G LF P CV + + +Q+      L+ KF      +Y+   
Sbjct: 189 LWATNYFRLASQTMFTLFFAGELFAPKCVVNGVNIQEY-----LQGKFCDAVMTLYARVR 243

Query: 617 RTKPQLVSENQNYEMWILKEDPNFASDNK----SVVSFEVLGLGIKPSPEATIHL 667
              P+L +EN    +  + E PNF    +    S+     L LG  P+P A+  L
Sbjct: 244 ERAPELFTENCVIGLESINE-PNFGYIGQTSLGSIPKERKLKLGSTPTPFASFKL 297

>Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QN 119
           Q+
Sbjct: 134 QD 135

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QN 119
           Q+
Sbjct: 134 QD 135

>Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 33.1 bits (74), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QN 119
           Q+
Sbjct: 134 QD 135

>Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii ADR184W
          Length = 988

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 55  GSHNDPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFY 111
           G   +P D +G+ H+ EH  L A S+KYP    F  ++ ++  +     TG   TFY
Sbjct: 71  GFKTNPPDKSGVPHILEHTTLCA-SQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY 126

>Smik_5.108 Chr5 complement(149789..150033,150064..150664) [846 bp,
           281 aa] {ON} YEL005C (REAL)
          Length = 281

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 738 KDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRINALELTELESFEKF 797
           K +LRK   + RN  K  +S NC+   +  LL   +K I +L +R+ +++ T  +    F
Sbjct: 88  KKSLRKVEHIYRNVSKQRASTNCIN-GNDRLLTNAKKKIDSLNERLTSIDGTVTDIVNSF 146

Query: 798 CFLFWRNPKHLVLFMQGSLEYA 819
             L    PK   L    S+  A
Sbjct: 147 VALDANLPKKAQLLKNDSINEA 168

>ZYRO0D10956g Chr4 (924444..926276) [1833 bp, 610 aa] {ON} similar to
            uniprot|Q99257 Saccharomyces cerevisiae YPL169C MEX67
            Poly(A)RNA binding protein involved in nuclear mRNA
            export component of the nuclear pore ortholog of human
            TAP
          Length = 610

 Score = 32.3 bits (72), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 62/147 (42%), Gaps = 28/147 (19%)

Query: 1009 NGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIY 1068
            NG N   N   + Q +++++++  G  N+Q       ++FL + T          +IS+ 
Sbjct: 2    NGVNNVNNISMLAQQQQLQSRVKIGVRNWQNATVQDLMNFLSRTT----------RISVV 51

Query: 1069 SAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGN----- 1123
             A       M+  P+    +ASR      E+ LK NG      +LK  +    GN     
Sbjct: 52   DA-------MVEGPLVVGHVASRA---DAESLLKWNGIRFAGNNLKFEILSDSGNDGAGA 101

Query: 1124 --PILLVKN-LFTYFRRRNEVFKLGTV 1147
               I L+KN L+  +  + ++  LG +
Sbjct: 102  NSTITLLKNFLYKRYNAQTKMLDLGNL 128

>YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}
           CYM1Lysine-specific metalloprotease of the mitochondrial
           intermembrane space, member of the pitrilysin family;
           degrades proteins and presequence peptides cleaved from
           imported proteins; required for normal mitochondrial
           morphology
          Length = 989

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 59  DPKDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGS-QNAFTTGEQTTFYFELPNT 117
           +P D  G+ H+ EH  L  GS KYP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDSTGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QN 119
           Q+
Sbjct: 134 QD 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,232,612
Number of extensions: 6287357
Number of successful extensions: 18771
Number of sequences better than 10.0: 123
Number of HSP's gapped: 19077
Number of HSP's successfully gapped: 145
Length of query: 1208
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1087
Effective length of database: 39,606,813
Effective search space: 43052605731
Effective search space used: 43052605731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)