Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL273W (SAM4)8.841ON32532517400.0
Suva_13.515na 1ON32532515910.0
Smik_6.4848.841ON32532515800.0
NCAS0D049408.841ON32732613630.0
TPHA0G03760singletonON33132313540.0
SAKL0D01452g8.841ON32732413490.0
KAFR0B00210singletonON32632313370.0
KLTH0C03850g8.841ON32932613320.0
Kwal_27.102558.841ON32932613310.0
Suva_64.1singletonON27327313230.0
NDAI0F00250singletonON32932612891e-179
TDEL0E05690singletonON32832412871e-179
KLLA0D01551g8.841ON33132312821e-178
KNAG0B06970singletonON33231412711e-177
Ecym_46128.841ON32632412251e-170
Suva_16.328.841ON25924912131e-169
TDEL0E00240singletonON32832512151e-168
Suva_16.17singletonON32432511981e-166
Smik_12.1na 2ON32432511681e-161
YLL062C (MHT1)na 2ON32432511441e-157
Skud_12.4na 2ON32532411361e-156
KAFR0L00150singletonON32632510941e-150
KAFR0F04420singletonON32632510341e-141
ABL125W8.841ON33632510261e-139
Skud_101.1singletonON20020010071e-138
Skud_100.1singletonON2002009911e-136
TBLA0B032608.841ON3263219031e-121
TPHA0I002608.841ON3233219021e-121
ZYRO0G14212g8.841ON3253288851e-118
Kpol_1068.78.841ON3233228601e-114
SAKL0D09306gna 3ON3263367221e-93
Kwal_0.322na 3ON3323356501e-82
KLTH0H12716gna 3ON3483376023e-75
AFR410WsingletonON3703315764e-71
YMR321Cna 1ON1051055446e-70
Skud_47.2singletonON96964733e-59
TPHA0O006301.386ON59450703.3
CAGL0B02387g8.850ON47150676.8
CAGL0D00264g7.7ON403116667.9
Smik_8.2944.383ON79674678.3
KLTH0F11704g3.379ON412144668.5
Skud_15.4868.796ON700133668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL273W
         (325 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   674   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   617   0.0  
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   613   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               529   0.0  
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     526   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   524   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       519   0.0  
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   517   0.0  
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   517   0.0  
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        514   0.0  
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       501   e-179
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   500   e-179
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   498   e-178
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             494   e-177
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   476   e-170
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   471   e-169
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       472   e-168
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   466   e-166
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   454   e-161
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   445   e-157
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   442   e-156
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      426   e-150
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               402   e-141
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   399   e-139
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   392   e-138
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   386   e-136
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   352   e-121
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   352   e-121
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   345   e-118
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   335   e-114
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   282   1e-93
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   254   1e-82
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   236   3e-75
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   226   4e-71
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   214   6e-70
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      186   3e-59
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    32   3.3  
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...    30   6.8  
CAGL0D00264g Chr4 complement(31657..32868) [1212 bp, 403 aa] {ON...    30   7.9  
Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W ...    30   8.3  
KLTH0F11704g Chr6 complement(988725..989963) [1239 bp, 412 aa] {...    30   8.5  
Skud_15.486 Chr15 (849169..851271) [2103 bp, 700 aa] {ON} YOR317...    30   8.5  

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/325 (100%), Positives = 325/325 (100%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTSPKDIQEISAAVKKYT
Sbjct: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/325 (89%), Positives = 312/325 (96%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MAR+PLKQ LAD+PKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMFNDFL AGAEILMT TYQTS+KSVSENTPI+TL+ Y+NLL RIVDFSR+CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           +LIGCIGPWGAH+C EFTG+YG  PE+IDFYQYFKPQL+NFNKNDKLDL+GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDESILS+PFYIGLSVHEHGVLRDGTTME +A+VIKDLGDKINPNF  LGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQSPDILESLH+ALPNM LLAYPNSGEVYDTEKKIW+PNSDKLNSWDTVVKQYI SGA
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRT+PKDIQE+SAAVKKYT
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAVKKYT 325

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/325 (93%), Positives = 316/325 (97%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MARLPLKQ LADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESS++RK
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMFNDFL+AGAEILMTTTYQTSYKSVSENTPI+TLSEYNNLL RIVDFSR CIGEDK
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAHICREFTGDYGA PE+IDFYQYFKPQL+NFNKND LDLIGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDES+LS+PFYIGLSVHEHGVLRDGTTM+E+A+VIKDLGDKINPNFS LGINCV
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQSPDILESLHQALP+MALLAYPNSGEVYDTEKKIWLPNSDKLNSWD VVK+YISSGA
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTSPKDIQEI  AVKKYT
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAVKKYT 325

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/326 (76%), Positives = 283/326 (86%), Gaps = 1/326 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R  +K++L  NP KVLVLDGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS +R+
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMF DFL AGAEILMTTTYQTS+KSVSENT I+TL EYN LLNRIV FSR+CIGE K
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYGA PENID+YQYFKPQL+NF  N+ LDLIGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE ILS+PFYIGLSVHE+GVLRDGTTMEEI  + K LG+K+NPN   LGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP-NSDKLNSWDTVVKQYISSG 299
           SFN SP ILE +H+ LP+M L+AYPNSGEVYDT KKIWLP NS+   +W+ VVK+YI +G
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 300 ARIIGGCCRTSPKDIQEISAAVKKYT 325
           ARIIGGCCRT+PKDI EIS AVKK++
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/323 (73%), Positives = 284/323 (87%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MAR  +K +L +NP KVLV+DGGQGTELENRGIKVANPVWSTIPFISESFWSD+SS +RK
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMFNDF+NAGAEILMTTTYQTS+KSVSENTPI+    YN LLNRI+DFSR+CIGE++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIG WGAHIC EF GDYG  PENIDFY+YFKPQL+NF  N+KLDLIGFET+PNIHE
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE ILS+PFYIGLSVHE+G+LRDGT+M+E+A +IK  G+K+NPN + LGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           S+N S DI++S+H+ LPN+ L+AYPNSGE+YDT KKIWLPN + + +WD +VK YI +G 
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGV 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKK 323
           RIIGGCCRT+P DI+ ++ AVK+
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAVKE 323

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/324 (73%), Positives = 283/324 (87%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MAR P+KQF  ++P ++LV+DGGQGTELENRGIKVANPVWSTIPFISESFWS+ESS +R+
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMF+DF+  G+ ILMTTTYQTS+KSVSENTPI+TL EYN LL RIV FSR CIGEDK
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIG WGAH+C EFTGDYGA PE IDF +YF+PQL+NFN ++++DLIGFETIPN+HE
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDESI+S+PFYIGLSVHE+GVLRDGTTM+E+A +IK LGDK+NPN   LGINCV
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFN S  IL SLH+ LP+M ++ YPNSGE+YDT KKIWL N ++  +WD VVK YI +GA
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKY 324
           RIIGGCCRTSP+DI++I  A++KY
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAIEKY 324

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/323 (74%), Positives = 279/323 (86%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R P+K++L +NPKKVLVLDGGQGTELENRGI VANPVWSTIPFISESFWS+ SS +R+
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVK MF DFL+AGA+ILMT TYQTS+KSV+ENTPI+TL EYN LL RIV FSR+CIG++K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYG  PENID+Y YFKPQL+NF +N  LDLIGFET+PN HE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWD++ILS+PFYIGLSVHE+GVLRDGTTM EI   IK LG KINPNF  LGINCV
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SF+ SPDILES+H+ LP+M L+AYPNSGE+YDT KKIWLPN     +W+ VV +YI +GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKK 323
           RIIGGCCRT P DI+++SAAVKK
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAVKK 323

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/326 (74%), Positives = 277/326 (84%), Gaps = 2/326 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58
           M R  +K++LA NP++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+  D SS +
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE 118
           R+IVKEM+ DFL AGA +LMT TYQ S+KSVSENT I TL EY+ LL+RIV FSR+CIG+
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI 178
           DK+L+GCIGPWGAH C EFTGDYG+EPE ID+ QYFKPQL+NF  ND LDLIGFETIPNI
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN 238
           HEL+AILSWD +IL +PFYIGLSVHEHGVLRDGTTM E+A++IK LGDKINPNF  LGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISS 298
           CVS+N SP+IL SLHQ +P + L+AYPNSGEVYDT KKIW P  D   +WD VVK YI S
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 299 GARIIGGCCRTSPKDIQEISAAVKKY 324
           GARIIGGCCRTSPKDI  I+AAV KY
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/326 (73%), Positives = 281/326 (86%), Gaps = 2/326 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58
           M R  +K+FL  NP++VLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS  D+SS +
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE 118
           R+IVKEM++DFL AGA +LMT TYQ S+KSVSENT I+TL EY++LLNRIV FSR CIG+
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI 178
           DK+L+GCIG WGAH C EFTGDYGAEPE IDF QYFKPQL+NF  N+ +DLIGFETIPNI
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN 238
           HEL+AILSWDESI+++PFYIGLSVHE+G+LRDGTTM ++A++IK  GD++NPNF+ LGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISS 298
           CVS+NQS DIL SLH+ LP M L+AYPNSGEVYDT KKIW P + +  SW+ +VK YI S
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 299 GARIIGGCCRTSPKDIQEISAAVKKY 324
           GARIIGGCCRTSPKDI+ I  AV+KY
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKY 326

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/273 (89%), Positives = 261/273 (95%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           MAR+PLKQ LAD+PKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVKEMFNDFL AGAEILMT TYQTS+KSVSENTPI+TL+ Y+NLL RIVDFSR+CIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           +LIGCIGPWGAH+C EFTG+YG  PE+IDFYQYFKPQL+NFNKNDKLDL+GFETIPNIHE
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDESILS+PFYIGLSVHEHGVLRDGTTME +A+VIKDLGDKINPNF  LGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDT 273
           SFNQSPDILESLH+ALPNM LLAYPNSGEVYDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  501 bits (1289), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/326 (70%), Positives = 277/326 (84%), Gaps = 1/326 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R P+K +L++NPKK+L+LDGGQGTELENRGI VANPVWSTIPF+++SFWS +SS +R+
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVK+MFNDFL AGAEILMTTTYQTS+KSVSENT I+TL EY+ LL RIV+FSR+CIGE+K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAHIC EFTG+YG  PE ID+Y+YFKPQL NF +ND LD+IGFETIPN++E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LK ILSW   IL +PFYIGLSVHE+GVLRDGTTM ++A +I  L DK+NPN   LGINCV
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWL-PNSDKLNSWDTVVKQYISSG 299
           S   SPDIL+S+H  LP++ L+ YPNSGEVYDT KKIWL PN +   SWD VV++Y+ +G
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 300 ARIIGGCCRTSPKDIQEISAAVKKYT 325
           ARIIGGCCRT+P DI++IS AV KY+
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  500 bits (1287), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 226/324 (69%), Positives = 282/324 (87%), Gaps = 1/324 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+P+K+ + ++ K++LVLDGGQGTELENRGI+VANPVWSTIPF+SESFW+D SS  RK
Sbjct: 1   MVRIPIKKLVIES-KEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IV+ +F+DF  +G+ ILMT TYQTS+ S+ ENT  +TL+EYN LL+RIV FSR+CIG+++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIG +GPWGAH+C EFTG+YG  PE+ID+Y+YFKPQL+NFN  D++DLIGFET+PN HE
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE+ +++PFYIGLSVH +GVLRDGTTMEEI + IK LG+KI+ NF  LG+NCV
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFN S D+++S+H+ALP+M LLAYPNSGEVYDTEKKIW  N DKL+SWD+VV+ YI +GA
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKY 324
           RIIGGCCRTSP+DI E+SAAVKKY
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKKY 323

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 274/323 (84%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62
           R+P+K++  +NP  VLV+DGGQGTELENRGI VANPVWST+PFI+ESFWS ++S +R IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  KEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYL 122
           K+MF DF+ AGA+ILMT TYQTS+KSVSENTPIRTL EYN LL+RIV FSR+CIGED+YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 IGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELK 182
           IGCIG WGAH+C EFTGDYG  P+ ID+++YF+PQL NF ++  +D+IGFETIPNIHEL+
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 AILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSF 242
           AILSWDE++LS+PFYIGLSVHE+GVLRDGT+M++IA +I  LGDK+N N  F+GINC +F
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 243 NQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGARI 302
           NQS  ILESLH + PNM L+ YPNSGE+YDT KKIWL N ++L +WD VVK YI +GARI
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGARI 301

Query: 303 IGGCCRTSPKDIQEISAAVKKYT 325
           IGGCCRT+  DI+E+  AV KY 
Sbjct: 302 IGGCCRTTVDDIKEVRLAVNKYA 324

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  494 bits (1271), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 270/314 (85%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R P++++L  NP+KVLVLDGGQGTELENRGI VANPVWST+PFI  SFWS++SS +R 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVK MF+ FL+AGAEILMTTTYQTS+KSVSENTPI+ L EY++LL+RIV FSR+CIG DK
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIGCIGPWGAH+C EF GDYG  P  ID+  YFKPQL+NF  ND LDLIGFETIPNIHE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           L+AILSWDE+ILS+PFYIGLSVH +G+LRDG+TM+++A +IK  G K+N N + LGINCV
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SF+ SPDILES+H+ LP+M L+AYPNSGEVYDT KKIWLPN D + +W+ VV +YI +GA
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGA 300

Query: 301 RIIGGCCRTSPKDI 314
           RI+GGCCRTSPKDI
Sbjct: 301 RIVGGCCRTSPKDI 314

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 217/324 (66%), Positives = 261/324 (80%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R  +KQ L  NP ++L++DGGQGTELENRGI VANPVWSTIPFI++SFWSD SS +R+
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IV  MF +++ AGA +LMT TYQ+S+KSVSENT I+TL EYN LL+RIV FSR CIG D 
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+GCIG WGAHIC EF+GDYG  PE I +  YF+PQL NFN  + +D+IGFETIPNIHE
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           L AILSWDESI+ +PFYIG+SVHEHG LRDGTTM ++AQ+ + LG K+NPNF  LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SF  S  ILESLH+ LP + L+AYPNSGE+YDT KKIWL N + + +WD +VK Y+ SGA
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKY 324
           RIIGGCCRT+P DI++I  AVKKY
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKY 324

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  471 bits (1213), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 220/249 (88%), Positives = 238/249 (95%)

Query: 77  LMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGCIGPWGAHICRE 136
           LMT TYQTS+KSVSENTPI+TL+ Y+NLL RIVDFSR+CIGE+K+LIGCIGPWGAH+C E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELKAILSWDESILSRPF 196
           FTG+YG  PE+IDFYQYFKPQL+NFNKNDKLDL+GFETIPNIHELKAILSWDESILS+PF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSFNQSPDILESLHQAL 256
           YIGLSVHEHGVLRDGTTME +A+VIKDLGDKINPNF  LGINCVSFNQSPDILESLH+AL
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 257 PNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQE 316
           PNM LLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYI SGARIIGGCCRT+PKDIQE
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 317 ISAAVKKYT 325
           +SAAVKKYT
Sbjct: 251 VSAAVKKYT 259

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  472 bits (1215), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 211/325 (64%), Positives = 274/325 (84%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+PL++ L D+ +K+LVLDGGQGTE+ENRGI+VANPVWS+IPF+SESFW+DE S  RK
Sbjct: 1   MGRVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IV+E++ DF+++G+++LMT TYQ S+K+++ENT ++TLSEYN+LL+RIV FSR CIG+++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+G +GPW A+   E+TGDYG   ++ID+Y Y+KPQL+NFNK +++D+IG ET+PN HE
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE  +++PFY+ L+ H+ GVLRDGT ME+IAQ IK LG+ +NPNF  LGINCV
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFN S DILE LH ALP M LLAYPNSGEVY+ +KKIWL N  K  SWD+VVK +I+SGA
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTSP+DI ++S AVKKY+
Sbjct: 300 RIIGGCCRTSPQDIADVSIAVKKYS 324

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  466 bits (1198), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 207/325 (63%), Positives = 271/325 (83%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+ +++ + ++P+KVLVLDGGQGTELENRGI + +PVWS  PFIS+SFW + +S++R 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW-ESTSSDRT 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           +V+EM+ DF++AGA +LMT TYQ ++ S+SENT I+TLS+YN  L+R+V F+R  IGED+
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIG IGPW AH+  E+TGDYG+ PE+ID+ Q+FK QL+NFNK+ ++DLIGFET+PN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE+I+S+PFY+GLSVH++G+LRDGTTMEEIA  +K LG KIN +F  LG+NC+
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQS  IL+SLHQALP+M LLAYPNSGEVYDT+ K W     K NSW+ VV+++I +GA
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTS KDI EI++AV K++
Sbjct: 300 RIIGGCCRTSAKDISEIASAVDKHS 324

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  454 bits (1168), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 204/325 (62%), Positives = 267/325 (82%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+P+++ L ++P+KVLVLDGGQGTELENRGI + +PVWS  PF+S+SFW ++SS  RK
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW-EKSSRERK 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           +V+EM+ DF+NAGA +LMT TYQ ++KS+S+NT I+TL  Y   L++IV FSR  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIG IGPW AH+  E+TG+YG  PE+ID+Y++F+PQL+ FN+N+ +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSW E I+SRPFY+GLSVH++G+LRDGTT+EEI+  IK LG KIN NF  LG+NC+
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQS  IL++LH+ LP+  LL YPNSGE+YD ++K W   +DKL+SWD  V+++I SGA
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTSPKDI EI+A+V  Y+
Sbjct: 300 RIIGGCCRTSPKDIAEIAASVDTYS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  445 bits (1144), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 204/325 (62%), Positives = 262/325 (80%), Gaps = 1/325 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+P+K+ + ++P KVL+LDGGQGTELENRGI + +PVWS  PF SESFW + SS  RK
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW-EPSSQERK 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           +V+EM+ DF+ AGA ILMT TYQ +++S+SENT I+TL+ Y   L++IV F+R  IGE++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIG IGPW AH+  E+TGDYG  PENID+Y +FKPQLENFN+N  +DLIGFETIPN HE
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSWDE I+S+PFYIGLSV ++ +LRDGTT+EEI+  IK LG+KIN N   +G+NCV
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFNQS  IL+ LH+ LP M LL YPNSGE+Y+ ++K W   ++KL+ W+T VK+++ +GA
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRTSPKDI EI++AV KY+
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  442 bits (1136), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 197/324 (60%), Positives = 260/324 (80%), Gaps = 1/324 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+ +++ + + P +VLVLDGGQGTELENRGI +  PVWS  PF S+SFW ++SS +R+
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW-EQSSHDRE 59

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           +V+EM+ DF+NAGA +LMT TYQ ++KS+SENT I+TLS YN  L+RIV F+R  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+G IGPW AH+  E+TG+YG  PE+ID+Y +FKPQL++FN+N  +DLIGFET+PN HE
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LKAILSW E I+S+PFY+GLSVH++G+LRDGTTMEE++  IK LG +IN +   +G+NC+
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           SFN+S  IL +LH++LP+  LL YPNSGEVYD ++K W   +DK  SWD  VK +I SGA
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGA 299

Query: 301 RIIGGCCRTSPKDIQEISAAVKKY 324
           RIIGGCCRTSPKDI EI+ AV++Y
Sbjct: 300 RIIGGCCRTSPKDIAEIATAVRRY 323

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  426 bits (1094), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 256/325 (78%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+PLK++L +NP+KVLV DGGQG ELE RG+ + + +WST PF+S+SFWSD SS + +
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IVK MF DF+NAGAEILMTTTYQTS+K+VSE+T +++L EYN LL++IV F+R CIG+++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YLIG IG +GA +  E++GDYG  PE +DFY YFKPQL+NF  ND++D++GFETI N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           LK++LSWDE  +S+PFYI LSVH++G LRDGT M  I   IK L   INPN +FLG+NCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           ++N++ +I++S+H  LP M L  +PNSGEV++ EK IW  N +   SW+ VVK++ISSG 
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RI+GGCCRT P DI++IS AVKK +
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKKLS 325

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 248/325 (76%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+P+K++L  N  K+LVLDGGQGTELE RGI +++PVWST+PFI+ESFWS+ SS +RK
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           I+K+M++DF++AGA++L TTTYQTS+ S+SENT I+TL +Y+ LLNRI  F+R CIG+ K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+G IG + A++  E+TGD+G   + ID++ YFKPQL+NFN++ ++D+IGFETIPNIHE
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           L+AILS ++  LS+PFYI LS +    LRDGT+++ +  VIK     +NPN   LGINC+
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
             N S   +E L+  LP   L+ YPNSGE YD  +KIWL + D   +W+ +V +Y+ +GA
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGA 300

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RI+GGCCRT+P DI+ IS A+K YT
Sbjct: 301 RIVGGCCRTTPSDIRSISEAIKCYT 325

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  399 bits (1026), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 184/325 (56%), Positives = 236/325 (72%), Gaps = 2/325 (0%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R+P++Q+L ++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S  R 
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
           IV  +  DF+ AGAE++MT TYQ S+ SV+ NT I TL +YN LL+RIV F R  +G+DK
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+G IG WGAH+C EFTGDYG  P++ID+  YFKPQL+NFN    LDLIGFETIPN HE
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           L+AILSWDES++++PFY+ LSVH+ G LRDGT M ++A ++      +NPNF  LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGINCS 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           S +++P IL  LH  LP + +  YPNSGE+YD  KK+W   S  +  W  VV  YI SGA
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW-NASPHVVDWGAVVASYIRSGA 298

Query: 301 RIIGGCCRTSPKDIQEISAAVKKYT 325
           RIIGGCCRT P DI++I+ AV+ + 
Sbjct: 299 RIIGGCCRTIPNDIRQIADAVRTHA 323

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  392 bits (1007), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 183/200 (91%), Positives = 196/200 (98%)

Query: 78  MTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGCIGPWGAHICREF 137
           MTTTYQTSYKSVSENTPI+TLSEYNNLL RIVDFSR+CIGE+KYLIGCIGPWGAHICREF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELKAILSWDESILSRPFY 197
           TGDYG +PE+IDFY+YFKPQL+NFNKNDKLDLIGFETIPN+HEL+AILSWDESILS+PFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSFNQSPDILESLHQALP 257
           IGLSVHEHGVLRDGTTMEE+A+VIK LGDKINPNFS LGINCVSFNQSPDILESLHQALP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 NMALLAYPNSGEVYDTEKKI 277
           +MALLAYPNSGEVYDTEKKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  386 bits (991), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 181/200 (90%), Positives = 193/200 (96%)

Query: 78  MTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGCIGPWGAHICREF 137
           MTTTYQTSYKSVSENTPI+TLSEYNNLL RIVDFSR CIGEDKYLIGCIGPWGAHIC EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHELKAILSWDESILSRPFY 197
           TGDYG +P++IDFY+YFKPQL+NFNK+DKLDLIGFETIPN+HEL+AILSWDESILS+PFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVSFNQSPDILESLHQALP 257
           IGLSVHEHGVLRDGTTMEE+A+VIK LGDKINPNFS LGINCVSFNQSPDILESLHQ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 NMALLAYPNSGEVYDTEKKI 277
           NMALLAYPNSGEVYDTEKKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  352 bits (903), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 169/321 (52%), Positives = 234/321 (72%), Gaps = 3/321 (0%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61
           R   K++   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LLN+IV F R CIG  KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181
           LIG IGP+ +H+  E+TGDYG  PEN+D+  YFKPQL+NFN ND +DLI  ET+PN +EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241
           KA+LSWD + + +PFYI LSV + G LRDGT+M+ I+ + ++   K NPN   +G+NCVS
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240

Query: 242 FNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYISSGA 300
           ++++  I++ L  A+P++ L+ YPNSGEVYD   + W  N+D KL+SW+T+VK  +++G 
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 301 RIIGGCCRTSPKDIQEISAAV 321
           R++GGCCRT+P DI +I+ AV
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAV 321

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 229/321 (71%), Gaps = 4/321 (1%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSAN--RK 60
           R+P ++F+ ++P ++LVLDGGQGTELENRG+ + +P+WSTI F+++ FW DE+  N  RK
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFW-DENIENTERK 60

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120
            ++EMFNDF +AGA +  T TYQTS+ SVSENT I++L EY+ LL +I  F R CI +D 
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180
           YL+GCIG + A I  E+ G+YG     ID+ +YFKPQL+ FN +  +D+IGFETIPN HE
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240
           L+AILSWDE I++RPF+I LS+ +   LRDGT+ EE+ ++      + N N  ++G NC+
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239

Query: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA 300
           S+  S D +  LH  +P++ L+AYPNSGE+YD + K W   S    SW+ VV +Y  +G 
Sbjct: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299

Query: 301 RIIGGCCRTSPKDIQEISAAV 321
           +IIGGCCRT+P DI++I  AV
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAV 320

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  345 bits (885), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 231/328 (70%), Gaps = 12/328 (3%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61
           R  L + L D   +VLV+DGGQGTELENRG+ ++ P+WST+PF  E FW+ D+   +R +
Sbjct: 2   RQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121
           V  MF  +++AGA++L T TYQTSYK++  +T I T ++Y+ LL+RIV F R CIG+D Y
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181
           L+G IGP+ AH+  E+TGDYG +PE ID++QYF+PQ+ NFN+N+ +D+IG ET+PN+HEL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241
           K+ILSWDE+ +S+PFY+ L V + G LRDGT +E   Q++    ++ N N   +GINC S
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLE---QLVPLFANRSNKNLLLVGINCCS 237

Query: 242 FNQSPDILESLHQALPN--MALLAYPNSGEVYDTEKKIWLP----NSDKLNSWDTVVKQY 295
            + S   L  L++ L +  M LL YPNSGE+YD + + W      +S +L SW ++V++Y
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRL-SWPSLVQEY 296

Query: 296 ISSGARIIGGCCRTSPKDIQEISAAVKK 323
              GAR IGGCCRT+P DIQEI   V +
Sbjct: 297 RKFGARAIGGCCRTTPLDIQEICKVVDR 324

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 227/322 (70%), Gaps = 3/322 (0%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDES-SANRKI 61
           R+P+++ + + P +VLV DGG GT LE+RGI V++P+WST+PF+ + FW  E+ +++R I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121
           ++ ++ D++ +G+ IL T TYQTS+  +S +T ++T+  Y  L+  I  F R+ IGED Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181
           LIG IGP+GA +  E+TG+YG  P NI++ +YFKPQLE FN ND +D+IGFET+PN +EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241
           +AILSWD+S++S+P+Y+ LS+ ++G LRDGT+ EEIA + K   +  N N    G NC+S
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239

Query: 242 FNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGAR 301
           F  + + +  LHQA+P + L+ YPNSGE+YD   K W  +     +W+ ++K+  +S  R
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299

Query: 302 IIGGCCRTSPKDIQEISAAVKK 323
           I+GGCCRT+P DI +I   + K
Sbjct: 300 IVGGCCRTTPDDINKIKDMITK 321

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  282 bits (722), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 218/336 (64%), Gaps = 24/336 (7%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           M R P+ ++L  +   +LVLDGGQGTE+E RGI V +P+WST+PFI ++        +  
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKN------PTHLN 51

Query: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSE--YNNLLNRIVDFSRN-CIG 117
            +K M++DF  +GA  L T TYQ S+ ++ + +  + ++E  Y   LN I+ F+R+ CI 
Sbjct: 52  HIKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 EDKYLIGCIGPWGAHICR--EFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETI 175
           + +YLIGC+GP+ A++C   E++GDYG+E   IDF QYFKPQL+ F+++D++D++GFETI
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGSE--KIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNIHELKAILSWDESIL--SRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFS 233
           PNI ELK +LS D + +  ++PFYI +S   +G LRDGT + +I + IKD      PN  
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 FLGINCVSFNQSPDILESLHQALPNMALL----AYPNSGEVYDTEKKIWLPNSDKLN--S 287
           FLGINCV ++ S +IL  L+  L +   L     YPNSGE+YD     W  NS+     +
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELT 289

Query: 288 WDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKK 323
           W+ +V ++     ++IGGCCRT+P DI++I+ AV K
Sbjct: 290 WNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  254 bits (650), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 208/335 (62%), Gaps = 27/335 (8%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62
           RL L+++L     ++L+LDGGQGTELE RGI +A+P+WST+P++++         + KI+
Sbjct: 2   RLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYVTKD------KKHLKII 52

Query: 63  KEMFNDFLNAGAEILMTTTYQTSYKSVSENTP--IRTLSEYNNLLNRIVDFSRN-CIGED 119
           KEM++ F +AG   LMT TYQ S+ S+  ++   I    EY   L+ ++D++ N CI  +
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 120 KYLIGCIGPWGAHICR--EFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPN 177
            YL+G +GP+ A++    E++G Y    +NIDF ++F+PQ+++F  + ++DLIG ETIPN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 178 IHELKAILSWDESILS--RPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFL 235
             E KA+L  + S L   +P+YI ++    G LRDGT  ++I + IK     + PN  F 
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 236 GINCVSFNQSPDILESLHQALPNMAL-------LAYPNSGEVYDTEKKIWLPNSD--KLN 286
           GINCVSF    DIL+ L+ +L ++ +         YPNSGEVY  +   W PN +    +
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGPAD 290

Query: 287 SWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAV 321
           +W+ +  + +  G  +IGGCCRTSP D+++I++ V
Sbjct: 291 TWENLASKVVQQGCLMIGGCCRTSPADLRQIASVV 325

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  236 bits (602), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 129/337 (38%), Positives = 201/337 (59%), Gaps = 27/337 (8%)

Query: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKIV 62
           R PLK+F  +N   +L+LDGGQGTELE +G+ +++P+WST+PFI ++        + + +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFIIKN------KTHLEAI 52

Query: 63  KEMFNDFLNAGAEILMTTTYQTSYKSVSENTP--IRTLSEYNNLLNRIVDFS-RNCIGED 119
           KEM+ DF  AG+  LMT TYQ S+ S+ + +   + +  +Y   L+ ++ F+ R CI  D
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLIGCIGPWGAHICR--EFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPN 177
           KYL+G +GP+   +    E++G YG     IDF  Y+ PQ+++F  + ++DLIG ETIPN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 IHELKAILSWDESILS--RPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFL 235
           I E KA+LS + S LS  +P+YI ++   +G LRDGT++ EI + IK     +  NF F 
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 236 GINCVSFNQSPDILESLHQALPNMAL-------LAYPNSGEVYDTEKKIWL--PNSDKLN 286
            INCV F    +IL+SL+  L    +        AYPNSGE+Y      W   P +   +
Sbjct: 231 AINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGPED 290

Query: 287 SWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKK 323
           +W+ +    +S    ++GGCCRT  ++I++++   KK
Sbjct: 291 TWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  226 bits (576), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 196/331 (59%), Gaps = 22/331 (6%)

Query: 2   ARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRKI 61
           A+  + +FL  N   VLV+DGG G ELE RG+ V +P+WST PF+      D ++ +   
Sbjct: 47  AKCAITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLR----GDRAALD--T 97

Query: 62  VKEMFNDFLNAGAEILMTTTYQTSYKS-VSENTPIRTLSEYNNLLNRIVDFS-RNCIGED 119
           ++ ++ +F  AG+  + T TYQ S+ S V  +  + + ++Y   L ++VDF+ R C+   
Sbjct: 98  IRGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPA 157

Query: 120 K-YLIGCIGPWGAHICR--EFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIP 176
           + Y+IG +GP+ A +C   E+TGDYG E   I+F+ YF+PQ+  F  + ++D I FET+P
Sbjct: 158 RDYIIGSVGPYAAFLCNGAEYTGDYGFE--TINFFNYFEPQVSKFATDPRIDAIAFETVP 215

Query: 177 NIHELKAILSWDESIL--SRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSF 234
           N+ EL A+L  +   L  ++PFYI +S  +  VLRDGT +  + Q+I++  D + PN   
Sbjct: 216 NVVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLC 275

Query: 235 LGINCVSFNQSPDILESLHQALPNMAL---LAYPNSGEVYDTEKKIWLPNSDKLN-SWDT 290
            G+NCV   +S  +L  L+  L +  +     YPN   V+D     W P+ D  + +W  
Sbjct: 276 FGLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAE 335

Query: 291 VVKQYISSGARIIGGCCRTSPKDIQEISAAV 321
            VK Y++   R+IGGCC T+P+D+++I+ A+
Sbjct: 336 AVKLYLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  214 bits (544), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 102/105 (97%), Positives = 103/105 (98%)

Query: 221 IKDLGDKINPNFSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP 280
           + DLGDKINPN SFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP
Sbjct: 1   MMDLGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP 60

Query: 281 NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 325
           NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT
Sbjct: 61  NSDKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 105

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  186 bits (473), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 90/96 (93%), Positives = 92/96 (95%)

Query: 1  MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
          M RLPLKQ L DNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFWSDESSANRK
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIR 96
          IVK MFNDFLNAGAEILMTTTYQTSYKSVSENTPI+
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 22/50 (44%)

Query: 259 MALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGARIIGGCCR 308
           + LL  PN+  + D  KKIW  + D LN W  +  +       + G   R
Sbjct: 186 ITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANLR 235

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 26/50 (52%)

Query: 110 DFSRNCIGEDKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLE 159
           D +R C+   K ++   G      C+ FTGD+ ++P ++ +    +P+ +
Sbjct: 241 DRTRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPYLVLTQPRAQ 290

>CAGL0D00264g Chr4 complement(31657..32868) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|P36047 Saccharomyces
           cerevisiae YKL193c SDS22
          Length = 403

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 15/116 (12%)

Query: 68  DFLNAGAEILMTTTYQTSYKSVS--ENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGC 125
           +FLN G  +          +S++  ENTP+R L    NL+   +DF R  +   +  +G 
Sbjct: 140 EFLNDGYHLTQINMSHNQVRSLTTLENTPLRHLDLSYNLIEGCIDF-RELMHGSRDKLG- 197

Query: 126 IGPWGA--HICREFTGDYGAEPENIDFYQYFKPQL---ENFNKNDKLDLIGF-ETI 175
              W +  ++C   TG+   E +NI      +  L    N  K D L L+ + ET+
Sbjct: 198 ---WASLEYLC--LTGNKIKELKNIHLLTNLRVLLVDNNNLEKVDNLHLLRYLETV 248

>Smik_8.294 Chr8 (481015..483405) [2391 bp, 796 aa] {ON} YHR204W
           (REAL)
          Length = 796

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 99  SEYNNLLNRIVDFSRNCIGED---KYLIGCIGPWGAHICREFTGDYGAEPEN-IDFYQYF 154
           +E N L  RIV F+++   +D   K + G I  +   I  E  G    +P + ID   ++
Sbjct: 537 AEVNTLSQRIVGFAKSIFQQDQPDKEVAGVIPEY--QINAEIPGTCSMKPRHVIDNEYWY 594

Query: 155 KPQLENFNKNDKLD 168
            P L NFN+  ++D
Sbjct: 595 SPMLSNFNRLFEID 608

>KLTH0F11704g Chr6 complement(988725..989963) [1239 bp, 412 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 412

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 54/144 (37%), Gaps = 30/144 (20%)

Query: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60
           + ++ LKQ   DN + V+   G  GT L+    K              SF +D    N +
Sbjct: 56  LPQIDLKQLPKDNRRLVIDKFGSSGTHLDLEAAK-------------RSFLNDSIFTNAE 102

Query: 61  IVKEMFNDFLNA-------GAEILMTTTYQTSYKSVSENTP---IRTLSEYNNLLNRIVD 110
             K + +DFL A           L    ++ +YK   +  P    + L+    + ++   
Sbjct: 103 ATKSLLSDFLTALQSEYEQSLHKLTIGQFRKAYKKFQQGLPDSERKKLNSLEGIRSKTRS 162

Query: 111 FSRN-CIGEDKYL------IGCIG 127
             R+ C G   YL      +G IG
Sbjct: 163 LERDICTGSKAYLSPLDPSLGIIG 186

>Skud_15.486 Chr15 (849169..851271) [2103 bp, 700 aa] {ON} YOR317W
           (REAL)
          Length = 700

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 56/133 (42%), Gaps = 8/133 (6%)

Query: 143 AEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE-----LKAILSWDESILSRPFY 197
             P ++     ++  LE+F K+  L+ +G+  +  IHE     +K +   + ++  +  Y
Sbjct: 32  VRPRHMKCSTVYEFALESFQKHKNLNAMGWRDVKEIHEESKSVMKKVDGKETAVEKKWMY 91

Query: 198 IGLSVHEHGVLRDGT-TMEEIAQVIKDLGDKINPNFSFLGINCVSFNQSPDILESLHQAL 256
             LS +++    + T  M +I + +  +G K N +         S       L +  Q +
Sbjct: 92  YELSHYQYNTFNELTDIMHDIGRGLVKMGLKPNDDDKLHIYAATSHKWMKMFLGAQSQGI 151

Query: 257 PNMALLAYPNSGE 269
           P   + AY   GE
Sbjct: 152 P--VVTAYDTLGE 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,270,295
Number of extensions: 1777129
Number of successful extensions: 5275
Number of sequences better than 10.0: 52
Number of HSP's gapped: 5385
Number of HSP's successfully gapped: 52
Length of query: 325
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 215
Effective length of database: 40,868,139
Effective search space: 8786649885
Effective search space used: 8786649885
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)