Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL272C6.8ON51751726240.0
Smik_6.4806.8ON51651724450.0
Skud_16.56.8ON51551723880.0
Suva_16.336.8ON51851823230.0
KNAG0E027706.8ON50852012771e-172
NDAI0G00860singletonON52353112421e-166
TDEL0G046306.8ON50352512201e-163
CAGL0A01089g6.8ON53554012001e-160
Kpol_1045.796.8ON50852511471e-152
KAFR0B065106.8ON50852610931e-144
SAKL0E00792g6.8ON51152010751e-141
TPHA0J002606.8ON51552510711e-141
TPHA0M001806.8ON50351810321e-135
NCAS0D021806.8ON5155258431e-106
TBLA0A072206.8ON5095368221e-103
KLTH0C11572g6.8ON5185257203e-88
Kwal_56.223416.8ON5195236621e-79
Ecym_30116.8ON5095236305e-75
ACR018C6.8ON4784586093e-72
Kpol_1032.1singletonON2462422907e-29
Kpol_191.16.8ON1391451101e-05
CAGL0K00737g5.119ON4572911125e-05
KLTH0C02178g5.119ON4641351044e-04
Kwal_27.98985.119ON460124880.037
NDAI0D023605.119ON470297820.20
Kpol_1010.495.119ON481112760.97
TBLA0A039608.326ON85074751.7
Skud_7.458singletonON19363703.8
Kpol_1003.442.295ON47031714.3
NCAS0D021006.31ON72685714.5
KNAG0G007005.119ON456235704.7
ZYRO0F01540g5.119ON47090704.9
TBLA0B022305.475ON790115706.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL272C
         (517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...  1015   0.0  
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   946   0.0  
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   924   0.0  
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   899   0.0  
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   496   e-172
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              483   e-166
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   474   e-163
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   466   e-160
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   446   e-152
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   425   e-144
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   418   e-141
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   417   e-141
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   402   e-135
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      329   e-106
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   321   e-103
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   281   3e-88
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   259   1e-79
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   247   5e-75
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   239   3e-72
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   116   7e-29
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    47   1e-05
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    48   5e-05
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    45   4e-04
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    39   0.037
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    36   0.20 
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    34   0.97 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    33   1.7  
Skud_7.458 Chr7 complement(754493..755074) [582 bp, 193 aa] {ON}...    32   3.8  
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    32   4.3  
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      32   4.5  
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    32   4.7  
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    32   4.9  
TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...    32   6.6  

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/517 (95%), Positives = 496/517 (95%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240
           LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY
Sbjct: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240

Query: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNH         FFKELRVECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 361 LSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420
           LSLIDDELSANEFLTNS            RLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN
Sbjct: 361 LSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420

Query: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480
           DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL
Sbjct: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480

Query: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/517 (87%), Positives = 482/517 (93%), Gaps = 1/517 (0%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIFSSTYSKSL +ENDADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLPLIATTLKRLIKSQPALFAT+NEEWEFEPL+QLKTSDIVNVIEFET+KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240
           LN IS+VTH EDRILFD+N++++S+L FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI+
Sbjct: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS+SS  SATQLKKYNDILNAH+SLCGTTVFGIV+NQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVF+IPI+LR H         FFKELR+ CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 361 LSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420
           LSLIDDELS NEFL NS            +LMEYQFN VTKHVS FIMAKL+SWEKNGFN
Sbjct: 361 LSLIDDELSVNEFLANS-NDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFN 419

Query: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480
           DDDIRRMKYDNDD+FHIQNS+TKL+QINDVSDISLSMN DDKSFKIVS+GFTSSINRPTL
Sbjct: 420 DDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTL 479

Query: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           +SLSYTYC+EMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 480 LSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/517 (87%), Positives = 474/517 (91%), Gaps = 2/517 (0%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIFSSTYSKS +R NDADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLP IA TLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW
Sbjct: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240
           LN IS   HS+DR+LFD++D+N+S L FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI+
Sbjct: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTSL  S S TQLKKYNDILNAH+SLCGTTVFGIVNNQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVF+IPI+LR +         FFKELR+ECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420
           LSLIDDELSA+EFL N             +LMEYQFNKVTKHVS FIMAKL+SWEKNGFN
Sbjct: 361 LSLIDDELSADEFLANR-NDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNGFN 419

Query: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480
           DDDIRRMKYDN DD HIQNS+TKLIQINDVSDISLSMN D+K+FKI+S+GFTSSINRPTL
Sbjct: 420 DDDIRRMKYDN-DDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTL 478

Query: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 479 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/518 (84%), Positives = 473/518 (91%), Gaps = 1/518 (0%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIFSSTYSKS S+E DADWHSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLPLIATTLK+LIKSQPALFATVNE+WE+ PLKQLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240
           LN I++V+ S+DR+LFD+ND+N +EL FPKSIYDSAKL LPAMTPQI HKQTQSFFKSI+
Sbjct: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS SS    +QLK+YNDILN ++SLCGTTVFGIVNNQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
           NQEHICLRSFICGIAMICLKPLVKDFSGTIVF+IPI+LR H         FFKELR+ECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSANEFLT-NSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKNGF 419
           LSLIDDELS NEFL  ++            +LMEYQFNKVTKHVS +IM KL+SWE+NGF
Sbjct: 361 LSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420

Query: 420 NDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPT 479
           NDDDIRRMKYDNDDDFH+QNS+TKLIQINDVSDISLSM+ DDKSFKIVS+GFT+SINRPT
Sbjct: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480

Query: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           LMSLSYTYCE+MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  496 bits (1277), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/520 (49%), Positives = 349/520 (67%), Gaps = 18/520 (3%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           M++ R LSSFEKK+L QS++  +NGT F + YS          W  +E TL T     DS
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTF-----KEGWSDEEATLLT---VKDS 52

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RL L L+   L+ LIK    LF T+NE++EFE LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171

Query: 181 LNEISTVTHSEDRI--LFDVNDINLSELK-FPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237
           +N +S+      ++  +F     ++SE+K  PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231

Query: 238 SIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLK 297
           SIY NT+K+P  +LTN     S +S     KYNDIL+ ++ LCG TVFG V+N+RF YL 
Sbjct: 232 SIYVNTVKKPIEFLTNTDV--SFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLN 289

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRV 357
           +I+NQE +CL+SFI GIAM+CLKP+VK+ SGT+ F+IP++LR+          ++K++RV
Sbjct: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349

Query: 358 ECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKN 417
           ECPLSLIDD+ S +     S            +LMEYQF  +T  V   +  +L  + K 
Sbjct: 350 ECPLSLIDDDKSKDCMKGASVSEEDFDE----KLMEYQFKNITGFVRNHLEQRLTRFSKT 405

Query: 418 GFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINR 477
           GFNDDDIRRMK+D+ +     ++    IQI D S I+++  G+  SF I +   T S+N 
Sbjct: 406 GFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNS 465

Query: 478 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
             LMSLSYTYCEE GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 466 EELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  483 bits (1242), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 244/531 (45%), Positives = 353/531 (66%), Gaps = 26/531 (4%)

Query: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62
           + R LSSFEKK+L+Q+L+ +RNG  +++ Y   +   +D+        L T     D RL
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATK----DIRL 57

Query: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
            + ++   L+RLIK    L++T+NE +EF+ L ++K  D+++VI F+T KD+++NCH G 
Sbjct: 58  NIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGA 117

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FNK +F    NKPLW LY+IDE +++FHG D+LFDIFSAANFHKLF  ELN
Sbjct: 118 PP-YLLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELN 174

Query: 183 E---ISTVTHSEDRILFDVNDINLSEL-------KFPKSIYDSAKLHLPAMTPQIFHKQT 232
           +    +T + S  + L  V  IN+S+        +FP+SI+D+ KLHLPAMTP +F+ QT
Sbjct: 175 DYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQT 234

Query: 233 QSFFKSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYN-----DILNAHTSLCGTTVFGI 287
           +SFFK+IY NT+K+P        S + +   +QLK+Y      D+L   +SLCGTTVFG 
Sbjct: 235 KSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGT 294

Query: 288 VNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXX 347
           V+  R+NYLK ++ Q+ ICLRSFICGI MICLKP +K++SG I+F+IPINLRN+      
Sbjct: 295 VSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKN 354

Query: 348 XXXFFKELRVECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFI 407
              F+K+++++CPLSLIDD         +S            +L+EYQF +VT+ +   I
Sbjct: 355 FGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 408 MAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMN-GDDKSFKI 466
           + +L+ WEK  FNDDDI+RMK+D+D+   +    +K+IQIND ++I L  N  ++K+F +
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDE---VLGQNSKIIQINDTTEIMLGENDNNNKAFTL 471

Query: 467 VSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            +  FT +++    MS+S+  CEE GLN+CIHYPD Y++E+FVECF++FIE
Sbjct: 472 TNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  474 bits (1220), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 251/525 (47%), Positives = 341/525 (64%), Gaps = 35/525 (6%)

Query: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62
           +FR L  FEKKIL+QSL   RNG +F + YS +       +W SD+ TL T     DSRL
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT-----PEEW-SDDATLLTYK---DSRL 52

Query: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
            L L++ TL ++I     LF T+NE+ EF P+K++K  +++N + F + KD+ VNC +G 
Sbjct: 53  NLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FN+T F PGS   LW +YV+DE L+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171

Query: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242
            IS  + S+   +F +    L    FPKSIYD+AKL LPA    +F+ QTQSFFKS+Y+N
Sbjct: 172 SISK-SGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228

Query: 243 TLKRPFGYLTNQTSLSSSVSATQLK----KYNDILNAHTSLCGTTVFGIVNNQRFNYLKS 298
            +K+P  Y+       +S    QLK    +Y DIL    +LCGTT+FG +  +R   L  
Sbjct: 229 AVKKPLDYI-------NSNPPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDC 281

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVE 358
           I  Q++ICL+SF+CGI M+CLKP+VK+++G+I F +P++LR+          F+K++RVE
Sbjct: 282 IFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVE 341

Query: 359 CPLSLIDDE-----LSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRS 413
           CPLSLIDD+        N + +++            +L+EYQF +VT HV   +  ++++
Sbjct: 342 CPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKA 401

Query: 414 WEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGD-DKSFKIVSTGFT 472
           WEK GFNDDDI+RMK+ +DD      + TKLIQINDVSDI +  + D    F +     T
Sbjct: 402 WEKFGFNDDDIKRMKFGSDD----TATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMT 457

Query: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            S+    LMSLSYT+ E+ GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 458 QSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  466 bits (1200), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 247/540 (45%), Positives = 346/540 (64%), Gaps = 36/540 (6%)

Query: 5   RPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDAD-WHSDEVTLGT------NSSK 57
           R LSS+E+K+L++ L + +NGT+F ++Y    S   D   W  D  TL        ++ K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 58  DDSRLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVN 117
               LTLPL+   LK LI+  P ++ TVN+  EF PLK+++T D+++V+ F+  KD++VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLF 177
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 178 LKELNEISTVTHSEDR---ILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQS 234
           LKEL  +     S ++    LF +     +    PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 235 FFKSIYYNTLKRPFGYLTNQTSLSS-------------SVSATQLK----KYNDILNAHT 277
           FFKSI+ N +K+P  ++    +  +             S    QLK    +Y +IL + T
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 278 SLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPIN 337
           S CG T+FG V+N+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F+GT++F++P+N
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 338 LRNHXXXXXXXXXFFKELRVECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFN 397
           LR+           +K++RVECPLS+IDD+  +   L  S            +L+E QF 
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNES------DPEYNEKLLEIQFQ 416

Query: 398 KVTKHVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSM 457
           ++  +V+  I  ++ +W+K G+ND+D++RMK+   D+    N+R  LI+INDVS++S   
Sbjct: 417 QIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTR--LIKINDVSEVSFDD 474

Query: 458 NGDDKSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           N D +   I S GFT+S+++ TLMSLSYT+CEE GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 475 N-DIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  446 bits (1147), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 238/525 (45%), Positives = 335/525 (63%), Gaps = 30/525 (5%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKD-- 58
           MT+FR L ++EKK++ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYIS-----NAQDGLTDDATLLTNSEPLLL 55

Query: 59  DSRLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNC 118
           DSRL        L++++   P L  TVNE+ EFE +K++KTSDI+  ++F+++KD+ VNC
Sbjct: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFL 178
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169

Query: 179 KELNEIST--VTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236
           + LN +    +T  E    +D    N S + FP++IY++ KL +P  T  + + QTQSFF
Sbjct: 170 ETLNSMDDEHITDLEYIYRYDATKSNRS-ISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228

Query: 237 KSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYL 296
           KS Y N +K+P   +T  +     +   ++    D +N  ++LCGTTVFG +   RF YL
Sbjct: 229 KSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFEYL 284

Query: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELR 356
            SI   E++C+RSFICGIA++CLK ++KDF+G+I F+IP+NLR           F+K + 
Sbjct: 285 NSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTIL 344

Query: 357 VECPLSLIDDELSANEFLTNSXXXXXXXXXXX-----XRLMEYQFNKVTKHVSGFIMAKL 411
           VECPLSLIDD++  N  + N                  + +EYQF +++  VS  +  ++
Sbjct: 345 VECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERM 404

Query: 412 RSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGF 471
           R+W +NGFNDDDI++MK+ +DD    + S TK+IQINDVS+  ++ +   K   I    F
Sbjct: 405 RAWRRNGFNDDDIKKMKFTSDD----KASNTKIIQINDVSEFKINSSKSSKV-SIKELNF 459

Query: 472 TSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFI 516
           T SI+    MSLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 460 THSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  425 bits (1093), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 224/526 (42%), Positives = 337/526 (64%), Gaps = 30/526 (5%)

Query: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62
           T R LSS+E+KIL +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSAS-----SEEWGDDTTLL----TLKDSRP 52

Query: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
           T+ ++   ++RLI     LF T+NE +EFE LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171

Query: 183 EIST--VTHSEDRILFDV-NDI-NLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
            ++   +  SE  I+F + N I  ++ LK  KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231

Query: 239 IYYNTLKRPFGYL-----TNQTSLSSSVS-ATQLKKYNDILNAHTSLCGTTVFGIVNNQR 292
           ++++T+K+P  YL     T + +  +++S  T ++KY DI + +T+L  TTVFG +  QR
Sbjct: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291

Query: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXX-XXF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ F+I INLR            F
Sbjct: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351

Query: 352 FKELRVECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKL 411
           +K++ ++ PLSLIDD       L+              +++E+QF +VT  V   I  ++
Sbjct: 352 YKDVLIDVPLSLIDDNAV---MLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRI 408

Query: 412 RSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGF 471
             +   GFNDDDIR+MKY    +       TK+I++ D S++SL     D  + + +T F
Sbjct: 409 SKFSTMGFNDDDIRQMKYGKPAE------DTKIIRLFDTSEVSLGSGKRDGKYILHNTNF 462

Query: 472 TSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           T S+ +    S+SYT C+  GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 463 TKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  418 bits (1075), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/520 (43%), Positives = 328/520 (63%), Gaps = 24/520 (4%)

Query: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62
           +FR LSS EKK+ +Q+LN++RNG +F++ YS    +E    W SD  TL T     D RL
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKE--ETW-SDNATLLT---VKDQRL 59

Query: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
           +  L++  LK++I +   L+ T+N+  EF+P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K +F    +KPLW + ++DE +++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178

Query: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242
           ++     + +  LF  ND   S   FPKSIY++ KL LPA+   +F  QTQSFFKS+Y  
Sbjct: 179 QLPKDGPTLE-CLFK-NDSKASF--FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 243 TLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQ 302
           T+K+P  ++   T+ +S +   Q   Y DIL    +LCGTTVFG ++ +R   LK I+ Q
Sbjct: 235 TIKKPLDFIN--TNPNSGLKYYQ-SCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQ 291

Query: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECPLS 362
           E+ICL SF+C IA++CLKPLV +F  ++ F+IP++LR+           +K + VECPL+
Sbjct: 292 ENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLT 351

Query: 363 LIDDEL-----SANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKN 417
           LIDD++       N +   +             L+EYQF +   HV   +  + R+WE++
Sbjct: 352 LIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERS 411

Query: 418 GFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINR 477
           GFNDDDI+RMK+   +    Q    ++I++N+V++    ++ D+ +F I    FT S N 
Sbjct: 412 GFNDDDIKRMKFGKTE----QGKSKRIIEVNNVTEFQFHVD-DNATFNIKDVCFTKSQNL 466

Query: 478 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 467 ETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  417 bits (1071), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 219/525 (41%), Positives = 330/525 (62%), Gaps = 27/525 (5%)

Query: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+     + ++  + D  TL T + +++    
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56

Query: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
                  L  +I   P L+ T+N + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE 183
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L E
Sbjct: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAAL-E 174

Query: 184 ISTVTHSEDRILFDVNDINLSEL--KFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241
            +T T  +   +F ++D++ S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 175 GATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234

Query: 242 NTLKRPFGYLT-NQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
            T+ +P   +  N   + S  ++  +    DIL   +SLCGTTVFG ++N+RF+YL+SI 
Sbjct: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
            +E++C +S +CGI M+CLKPL+KDFS  I F+I +NLR+          F+K +R+E P
Sbjct: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350

Query: 361 LSLIDDEL-----SANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWE 415
           LS IDD +     S N +  ++            +L+ YQFN++   +S  +  ++R+W 
Sbjct: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410

Query: 416 KNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDIS---LSMNGDDKSFKIVSTGFT 472
           +NGFNDDDI+ MK+ + D    +N+  K+IQIND+SD+S   ++ NG+  S  +    FT
Sbjct: 411 RNGFNDDDIKMMKFGSKD----KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFT 466

Query: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 467 HSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  402 bits (1032), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 218/518 (42%), Positives = 323/518 (62%), Gaps = 22/518 (4%)

Query: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63
           FR L  +EKK+L Q++  +RNG +FSS  +   ++++D ++  D  TL T  S ++  L 
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQIT--FNKKSD-EFADDNATLYTGRSVNEVSLK 59

Query: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
             L A  L+ +I +   L+ T+N+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 60  SVLCAA-LQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE 183
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176

Query: 184 I--STVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241
           +  S       + LF   D   S   +P+SIY++ KLHLPA+T  + + QTQSFFK+IY 
Sbjct: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235

Query: 242 NTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVN 301
           NTLK+P   +T+  S +++  +    +  DIL+   SLCG TV G ++ +R+ +LK +V 
Sbjct: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295

Query: 302 QEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECPL 361
           QE+I LRSFI  I M+CLKP+VK+F G+I+F+IP+NLR+          F+K ++VECPL
Sbjct: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355

Query: 362 SLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSWEKNGFND 421
            LI+DE    ++ TN              L+E QF ++++HVS  I  ++++WEK GFND
Sbjct: 356 ELINDE----KYYTNPEVLHSMQNNS---LLEIQFERISRHVSDVISQRMKAWEKFGFND 408

Query: 422 DDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDD--KSFKIVSTGFTSSINRPT 479
           DDI+RMK+ ND+   I      +IQINDV++IS     D+   SF + +  FT S++   
Sbjct: 409 DDIKRMKFSNDEKTGI----APIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNE 464

Query: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            MSL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 465 FMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  329 bits (843), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/525 (35%), Positives = 298/525 (56%), Gaps = 26/525 (4%)

Query: 5   RPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLTL 64
           R LS +E K+L Q+L  +RNG  F++ Y +     N  D         T  S  D RLTL
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYDDSSLSSSDESTLVSLKDRRLTL 58

Query: 65  PLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPP 124
            +I   L+ LI     L+  ++E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117

Query: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE- 183
           PYLLRH FNK+ F  G  KPLW LY+IDE  ++FHG D+LFD FSAA FHK FL E+N  
Sbjct: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177

Query: 184 ISTVTHSEDRILFDV-----NDINLSEL--KFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236
           +S++  S+ +   D      +  +L ++  + P+SIYD        +T  +F+ QT+SFF
Sbjct: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFF 237

Query: 237 KSIYYNTLKRPFGYLTN---QTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRF 293
           KS+Y N +K+P  ++TN   Q      +   + + Y + +  H SLCG T+FG +++ RF
Sbjct: 238 KSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRF 297

Query: 294 NYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFK 353
           N L     +E I L+S ICG+ M+ LKP + DFS  +VF+I +NLR+          +++
Sbjct: 298 NELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYR 357

Query: 354 ELRVECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRS 413
           ++ +ECPLSLIDD         +             ++ E QF  VT ++   +  K+  
Sbjct: 358 DIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGY 417

Query: 414 WEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMN-GDDKSFKIVSTGFT 472
           W+     D+DI+ MK  +     +  S+ ++IQIND+++I ++ N   +  + + S+   
Sbjct: 418 WK----TDNDIKMMKMMD----DMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMV 469

Query: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           +S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 470 TSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/536 (37%), Positives = 304/536 (56%), Gaps = 59/536 (11%)

Query: 3   TFRPLSSFEKKILTQSLNDQ-RNGTIFSSTY-SKSLSRENDADWHSDEVTLGTNSSKDDS 60
             RPLSS EK+ L  SL  + R+G++ S  + S SL   +DA          T  S  D 
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDA----------TLLSSKDK 60

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
            LT+ L++  LK LI +   +F T+N+  EF+ L ++ TSD+++ I FE  KD+ VNCH 
Sbjct: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  + 
Sbjct: 121 GAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEI 179

Query: 181 LNEISTVTHS-EDRILFDVNDI-NLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
           +N +       +D I+F + +I N+S++ FPKSIYD+  LHLPA  P++F+ QTQSFFKS
Sbjct: 180 INSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKS 239

Query: 239 IYYNTLKRPFGYL--TNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYL 296
           IY NT K+ F YL  T QT +  + +    K YN+IL+ ++ +    V G V+ +R+  L
Sbjct: 240 IYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQL 299

Query: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLR---------NHXX---- 343
             +++ E I L+SF C I ++CLK ++  F G+I+F IP NLR         NH      
Sbjct: 300 LKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGP 359

Query: 344 --XXXXXXXFFKELRVECPLSLIDDELSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTK 401
                     +K++ VE PL LI  E   NE                  ++E QF  V  
Sbjct: 360 EDSANELGIIYKDIYVEVPLKLI--EKIGNE-----------------DVVEEQFKIVCN 400

Query: 402 HVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDD 461
           +++  I  ++++WEKNGFNDDDI+RMK+  +   +I       I++ND++ + LS    D
Sbjct: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQVGNI-------IEVNDLTSLDLSC-SKD 452

Query: 462 KSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
             F I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 453 SLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  281 bits (720), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 177/525 (33%), Positives = 275/525 (52%), Gaps = 26/525 (4%)

Query: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60
           +  +R L+  EK IL ++    +NG +FS+TY K+   ++     SD  TL ++ ++   
Sbjct: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD----LSDNETLRSDMNQ--- 57

Query: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RL+  +I   L ++IK    L   V+   EFEP+ ++   D+V  IEF+   D++VNC+ 
Sbjct: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPP YLLRH F+K  F  G  +PLW L+VID  ++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176

Query: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240
           LN +S    S  R +F    I L  L  P++++   +    +     F+ Q+Q+  +S+Y
Sbjct: 177 LNSLSESCTSP-RPVFKGGKI-LPTL--PRALFQKQEPQAASSITDAFYSQSQAILRSLY 232

Query: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300
              +K+P  ++    S     S  Q     + LN    LCGT VFG ++  RF  LK I+
Sbjct: 233 NLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECP 360
           N   I +++FI    + CL+P++      I F++PINLR+          + + + +ECP
Sbjct: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349

Query: 361 LSLI--DDELSANEFLTNSXXXXXXXXXXXXRLMEYQ------FNKVTKHVSGFIMAKLR 412
           L     +   SA  +++N             +    Q      F +   HVS  +   L+
Sbjct: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409

Query: 413 SWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFT 472
             E   F D D+  MK + +  F+   S +K+I+IND+S+I LS N +   + +     T
Sbjct: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466

Query: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  259 bits (662), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 270/523 (51%), Gaps = 25/523 (4%)

Query: 3   TFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRL 62
            +R L++ EK I+ ++    +NG +FSSTY        +   + D  +   +  K    L
Sbjct: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYF-------EGPDNVDNTSPSVSCMKMGKGL 59

Query: 63  TLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
              ++   L ++IK    L +++N+  +FE +  +   D+V  IEF+ + D++V+C+ GV
Sbjct: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178

Query: 183 EISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYN 242
               V   +  ++F   +     +   +S+     + L +         +Q+  K++Y  
Sbjct: 179 SFRNVKGQKSDLIFKTRE---DLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSL 235

Query: 243 TLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIVNQ 302
            +K+P  ++ +     S + A+    Y D+ +    LCGT VFG VN +R   L++++N+
Sbjct: 236 AIKKPLRFIESGRLEHSGIPASN--PY-DLASYAGDLCGTVVFGNVNPERVRGLRALMNE 292

Query: 303 EHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECPLS 362
             I  RSFI  + M CL P+++     I+F++PINLR           F   +  ECPL 
Sbjct: 293 SKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLD 352

Query: 363 LIDDELSA--------NEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSW 414
           LI  ++           EFL  S               +  F ++  HV+  +       
Sbjct: 353 LIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRL 412

Query: 415 EKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSS 474
           EK+  + +D+  +K + +  +   +SR+K+++IND+ ++ LS     + +KI     TSS
Sbjct: 413 EKSHSSGEDL--IKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR-YKIGDVCSTSS 469

Query: 475 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
               T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 470 RKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  247 bits (630), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 278/523 (53%), Gaps = 31/523 (5%)

Query: 2   TTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSR 61
           ++ R LSS EK    +    +RNG +F+  YS   S + +++  SD++TL   S+  DSR
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYS---SNKCESERWSDDITL---SNLRDSR 59

Query: 62  LTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121
           L    I+  L+ +IK    L  T+ ++ +F P + ++  D+V  IEF+T KD+ + C  G
Sbjct: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119

Query: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181
           +PP Y+LR+     +F  G  +PLW L ++D  +++ H H+V+FD+F+AANFH  F K L
Sbjct: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176

Query: 182 NEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYY 241
           ++    TH+ D ILF V + N  EL+  K+ +D     +     Q    Q  S  K  Y 
Sbjct: 177 SQFPKDTHALD-ILF-VYEGN--ELQLSKTNFDGMS-QISVSPVQSLPLQCISVLKGAYR 231

Query: 242 NTLKRPFGYLTNQTSLSSSVSATQLKK---YNDILNAHTSLCGTTVFGIVNNQRFNYLKS 298
            T+K+    +      ++ ++  +  K   +  + N +T LCGTTV G +N +R   L  
Sbjct: 232 TTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNT-LCGTTVSGSLNAERLASLLE 290

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVE 358
           + + E++C+ S +C I ++ LKPL++ F+G+I F +PI++R            +  L VE
Sbjct: 291 LTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFDLGVS-YTNLMVE 349

Query: 359 CPLSLIDDE----LSANEFLTNSXXXXXXXXXXXXRLMEYQFNKVTKHVSGFIMAKLRSW 414
           CPLS I+D+      ++  + +              L+EYQF ++T HV   +  K ++W
Sbjct: 350 CPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQAW 409

Query: 415 EKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSS 474
           +K  F+   ++  K    +       R K I+IN V D+  + +G    F   +  FTSS
Sbjct: 410 QKRRFDMSSLKGKKLRRSNKI----IRGKFIEINLV-DMGEAQDG---QFHTKNVNFTSS 461

Query: 475 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  239 bits (609), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 147/458 (32%), Positives = 246/458 (53%), Gaps = 36/458 (7%)

Query: 67  IATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPY 126
           I++ L+ +I+    +  TV +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105

Query: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNEIS- 185
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163

Query: 186 TVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAM-TPQIFHKQTQSFFKSIYYNTL 244
              H+E   +++   + L          D     LP +  P        SF K++    L
Sbjct: 164 NEPHNETLFVYEGGPLQLP--------IDPDACSLPGVDVPYPASSPFVSFVKNVCRYAL 215

Query: 245 KRPFGYLTNQTSLSSSVSATQLKKYNDILNA-HTSLCGTTVFGIVNNQRFNYLKSIVNQE 303
           K PFG L +  + S  ++ + L +   +L     SL GTTV G +N+++ + L  ++++E
Sbjct: 216 K-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNSKKLDSLLKLISKE 274

Query: 304 HICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHXXXXXXXXXFFKELRVECPLSL 363
            +C+RSF+C I ++ LKPL+++F G+I F+IP++LR             K + V+CPL+L
Sbjct: 275 EVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLAL 334

Query: 364 IDDELSANEFLTNSXXXXXXXXXXXXR----LMEYQFNKVTKHVSGFIMAKLRSWEKNGF 419
           IDD +  + F   S            +    L+EYQF +VT HV   + A+         
Sbjct: 335 IDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT-------- 386

Query: 420 NDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPT 479
           + D   + KY        Q  + K+I+IN V D+  S +     F+I +  FT S+   T
Sbjct: 387 SGDWTGKRKYSK-----CQLRKKKIIEIN-VVDMGTSPSA---RFQIKNMNFTDSLGSET 437

Query: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517
            MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 438 FMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  116 bits (290), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 127/242 (52%), Gaps = 27/242 (11%)

Query: 283 TVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHX 342
            +FG +  +RFN LK+++ +  ICLRS ICGI M+C KP +++F G I F+I ++++   
Sbjct: 24  VLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIV 83

Query: 343 XXXXXXXXFFKELRVECPLSLIDDEL---SANEFLTNSXXXXXXXXXXXXRLMEYQFNKV 399
                     K + V+CPL LIDD+    + +E + N              ++E QF KV
Sbjct: 84  DDSSQFGILKKNIIVDCPLKLIDDKHYKDTDSESIKNGD------------ILEIQFRKV 131

Query: 400 TKHVSGFIMAKLRSWEKNGFNDDDIRRMKYD-NDDDFHIQNSRTKLIQINDVSDISLS-- 456
           T  V+  +  KL+S  K+       +R     N    + Q S +K+IQIND++DI  +  
Sbjct: 132 TDFVTEELSNKLQSMAKH------FKRNNCPFNFSSINSQISDSKVIQINDLTDIPFTTT 185

Query: 457 -MNGDDKSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESF 515
             N +  SF  +    T  ++    MSLSY       ++I IHY ++  ++SFVECF +F
Sbjct: 186 EQNPNGYSFHDLKV--TEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTF 243

Query: 516 IE 517
           IE
Sbjct: 244 IE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 65/145 (44%), Gaps = 9/145 (6%)

Query: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNL 53

Query: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
             L+  +LK LI     L  TV+E   F  L ++KT+D+V +I +   K  ++N     P
Sbjct: 54  QLLLLKSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148
              L+   +  + F PGS KP   L
Sbjct: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 121/291 (41%), Gaps = 49/291 (16%)

Query: 70  TLKRLIKSQPALFATV---NEEWEFEPLKQ-LKTSDIVNVIEFETIKDKEVNCHWGVPPP 125
            L+R++ S   L+      N E    P+ + +K  D+V+ ++++T  ++E+N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVIDEA-LLVFHGHDVLFDIFSAANFHKLFLKELNEI 184
                 F K  F  G +KPLW + V+ +A  ++F    + FD  +   F    LK L E+
Sbjct: 95  -----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEEL 149

Query: 185 STVTHSEDRILFDVNDINLSELKF-PKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIYYNT 243
                 +D      ND+++ E+ + P    DS     P      + K    F   +    
Sbjct: 150 -----KQD------NDLDVDEIIYRPGGSTDSIDQCHP------YEKLPIPFSWKVKRPI 192

Query: 244 LKRPFGYLTNQTSLSSSVSATQLKKYN---DILNAHTSLCGTTVFGIVNNQ-----RFNY 295
           +K  F  +     +S   S  Q  +Y    D L  +++  G       N Q       N 
Sbjct: 193 VKALFT-IAPGAVVSQDASIIQFDEYKIPEDYLKKNSNDDGCYQIKNTNRQISLKMSSNK 251

Query: 296 LKSIV---NQEHICLRSFICGIAMICLKPLVKD-FSG-TIVFTIPINLRNH 341
           LK I+    Q H+   +++  +  + L  + K+ +SG TI + +P+N RN 
Sbjct: 252 LKVIMKDCKQHHVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNR 302

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 17/135 (12%)

Query: 67  IATTLKRLIKSQPALFATV---NEEWEFEPLKQ-LKTSDIVNVIEFETIKDKEVNCHWGV 122
           I   ++ ++   P L++ V   N     EPL+  L  SD+V   E E++ ++  N     
Sbjct: 38  IVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN----- 92

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVI-DEALLVFHGHDVLFDIFSAANFHKLFLKEL 181
                    F +  FV G+ KPLW + ++ D+   V     ++ D  SA  F   F++ L
Sbjct: 93  -------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSL 145

Query: 182 NEISTVTHSEDRILF 196
           N     +   D ++F
Sbjct: 146 NASHADSTFPDEVVF 160

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 11/124 (8%)

Query: 67  IATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIV-NVIEFETIKDKEVNCHWGVPPP 125
           I   +K  ++  P L++ V  + E   L+ +    ++  V+E+           +G+   
Sbjct: 38  ICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYT---------DYGLLDE 88

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVI-DEALLVFHGHDVLFDIFSAANFHKLFLKELNEI 184
            +    F +  F  GS KPLW + V+ D   LV     V+ D  S   F K FL  LN  
Sbjct: 89  DICNKIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNAT 148

Query: 185 STVT 188
           ++ +
Sbjct: 149 ASTS 152

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 119/297 (40%), Gaps = 57/297 (19%)

Query: 70  TLKRLIKSQPALFATV--NEEWEFEPLKQLKTS-----DIVNVIEFETIKDKEVNCHWGV 122
            L+  I + P L   +  N+E E+  ++ +K +     D+V  + +E  ++KE+N     
Sbjct: 44  ALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS---- 99

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE----ALLVFHGHDVLFDIFSAANFHKLFL 178
                    F    F   +++PLW + V+       LL+ H    LFD  SA    + F+
Sbjct: 100 --------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDHA---LFDGISAVKIWETFM 148

Query: 179 KELNEISTVTHSEDRILFDVNDIN----LSELKFPKSIYDSA---------KLHLPAMTP 225
           ++LN+ S + + +  +   + + N    L   + P  I+               L    P
Sbjct: 149 EKLNKSSEIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKSFIATKLFNWYP 208

Query: 226 QIFHKQTQSFFKSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVF 285
           Q       + F+   +   K P G+L    S       T  K  ND       +    + 
Sbjct: 209 QAIISPNSNLFE---FKGYKFPEGFL----SQYPKDGVTSFKVRNDNTQKLIKMAPGKLE 261

Query: 286 GIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKD-FSGTIV-FTIPINLRN 340
            I+ N + N          + L S+I  I +I L+ + ++ ++G ++  +IPIN RN
Sbjct: 262 TILKNCKTN---------AVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIPINTRN 309

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 25/112 (22%)

Query: 100 SDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEA--LLV 157
           +DIV    ++++ +  +N              F +  F   ++KP+W + V++    LL+
Sbjct: 81  ADIVEYKNWDSVSESNINS------------IFQEYSFEYFTDKPVWKILVLENQNQLLM 128

Query: 158 FHGHDVLFDIFSAANFHKLFLKELNEISTVTHSEDRILFDVNDINLSELKFP 209
              H VLFD  S  NF   F+  L  I +++           D N +EL FP
Sbjct: 129 LLDH-VLFDGMSGINFWNSFISSLPSIDSISE----------DANANELIFP 169

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 10  FEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWH----SDEVTLGTNSSKDDSRLTLP 65
            E+++L   L  Q+  T+F ++Y KS+  EN  + H    S++ TL  NS ++DS    P
Sbjct: 251 LEQQLLENRLEQQKLETVFKTSYDKSV--ENTLNNHTTGISEQDTLKLNSRENDSTPLRP 308

Query: 66  LIATTLKRLIKSQP 79
              +  +R++ S P
Sbjct: 309 TSISPSRRIVTSNP 322

>Skud_7.458 Chr7 complement(754493..755074) [582 bp, 193 aa] {ON}
           YPL272C (REAL)
          Length = 193

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 235 FFKSIYYNT-LKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRF 293
           FF  +  NT L    GYL    S++ +VS  +L  YN+ L   T  C T  FG+    +F
Sbjct: 60  FFDCLRNNTNLTSIVGYLPGVVSINVNVSMGELGNYNESL--LTKCCSTNEFGLT---QF 114

Query: 294 NYL 296
           +YL
Sbjct: 115 DYL 117

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 420 NDDDIRRMKYDNDDDFHIQNSRTKLIQINDV 450
           NDDDIR M  DN DD  + N  T++ ++++V
Sbjct: 333 NDDDIRSMPDDNVDDVLLSNEVTEIEELDNV 363

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 426 RMKYDNDDDFHIQNSRTKLIQINDVSDISLSMN-GDDKSFKIVSTGFTSSINRPTLMSLS 484
           R +Y  DD F  + +R K   + ++SD +   N  D   F I   G   +   PT  SL+
Sbjct: 624 REEYHKDDVFLRRYTRYKQFVMFELSDGTFQFNFKDHHKFAISDGGRLVTYISPTHESLT 683

Query: 485 YTYCEEMGLNICIHYPDSYNLESFV 509
           Y   E +       YPDS  LE  +
Sbjct: 684 YPLVEVLKNGGIPDYPDSKFLEKLI 708

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 85/235 (36%), Gaps = 41/235 (17%)

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEA----LLVFHGHDVLFDIFSAANFH 174
            WG     L    F +  F     KPLW +  + ++    LLV H   VLFD  S  N  
Sbjct: 84  QWGQWDAQLANEIFKEYNFQYTVEKPLWRILAMPKSSTFVLLVDH---VLFDGMSTVNLW 140

Query: 175 KLFLKELNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLP-----AMTPQIFH 229
           +  L+ L   ST       +L++ ++    +L      YDS  +        A+ P IF+
Sbjct: 141 RCLLENLGPEST-----SDVLYEPSN-EADQLGQRPHPYDSWPVGWSWRLKRALVPWIFY 194

Query: 230 KQTQSFFKSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYND----ILNAHTSLCGTTVF 285
              ++       N     F   T Q +L       + K YND    +LN           
Sbjct: 195 YAPRTV---TGVNEQLVHFSQYTLQDNLLQRNKPEEYKIYNDNDRWVLN----------- 240

Query: 286 GIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRN 340
             +  +    L +   +  + L S++  +  + L        G I   IP+N RN
Sbjct: 241 --IKGEPMAKLITRCKEHQVSLTSYLVSVFALALS---YQAEGNIRVDIPMNTRN 290

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 13/90 (14%)

Query: 95  KQLKTSDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVI-DE 153
           + L+  D+V  +++    + ++N            + F    F   + KPLW + VI +E
Sbjct: 76  QSLELKDVVEFVDWAKFDEDKMN------------YVFQNYAFPYHTEKPLWKVLVIPNE 123

Query: 154 ALLVFHGHDVLFDIFSAANFHKLFLKELNE 183
             LV     VLFD  +     + FLK LN+
Sbjct: 124 RKLVLLMSHVLFDGMAGVIILQEFLKNLNQ 153

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 48/115 (41%), Gaps = 12/115 (10%)

Query: 226 QIFHKQTQSFFKSIYYNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTS---LCGT 282
           QIF  Q    F  + YN  K+ +    N  + ++     QL++   I+N+  S      T
Sbjct: 214 QIFETQQ---FNDLMYN--KKWYSISNNNENTTTDSLFLQLQRVTSIINSRMSERAFIST 268

Query: 283 TVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPIN 337
            +F    N+  NYL S  +  +     FI  +    L P+ KD    I+ T  IN
Sbjct: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPIFKD----ILVTTAIN 319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,862,542
Number of extensions: 2577325
Number of successful extensions: 8872
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9098
Number of HSP's successfully gapped: 51
Length of query: 517
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 403
Effective length of database: 40,409,475
Effective search space: 16285018425
Effective search space used: 16285018425
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)