Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL270W (MDL2)6.5ON77377337800.0
Smik_6.4786.5ON77377334430.0
Skud_16.76.5ON77377334200.0
Suva_16.356.5ON76777433310.0
CAGL0A01133g6.5ON80161023790.0
Kpol_1045.836.5ON74862823270.0
NDAI0I027306.5ON83275123150.0
TDEL0G046606.5ON73975523140.0
ZYRO0F00396g6.5ON73269223070.0
NCAS0D022106.5ON77363023040.0
TPHA0J002206.5ON74060322460.0
TBLA0A071906.5ON79461522070.0
KNAG0E028006.5ON74170821620.0
SAKL0E00748g6.5ON77462521580.0
Kwal_56.223296.5ON77666821450.0
KLTH0C11616g6.5ON74062821010.0
KLLA0D00748g6.5ON78962520780.0
ACR022W6.5ON75462120650.0
Ecym_30076.5ON76961220030.0
KAFR0B064806.5ON75178419910.0
TPHA0B046201.67ON72065313741e-180
NDAI0A005601.67ON71462113651e-178
NCAS0B087001.67ON71562613531e-177
KLLA0C01991g1.67ON70665713471e-176
YLR188W (MDL1)1.67ON69560113421e-175
Skud_12.2531.67ON69265113411e-175
Kpol_2000.791.67ON70760913371e-174
SAKL0C02244g1.67ON71266513331e-174
Smik_12.2481.67ON69662013271e-173
TDEL0C063501.67ON69362313221e-172
Suva_10.2841.67ON69362613191e-172
Ecym_10721.67ON68360813141e-171
ZYRO0F17050g1.67ON71468713151e-171
KLTH0F02024g1.67ON73471312931e-167
AFR683C1.67ON67759012791e-166
Kwal_33.133081.67ON70666212771e-165
TBLA0A053001.67ON70761612301e-158
CAGL0E00385g1.67ON60859212131e-157
YKL209C (STE6)1.527ON12905255497e-58
SAKL0H00968g5.20ON7005445244e-56
KLTH0B09482g5.20ON6945995182e-55
Kwal_26.94805.20ON7195705132e-54
KLLA0A10131g5.20ON7205605105e-54
TDEL0F003401.527ON12575205161e-53
KAFR0I025805.20ON7094564911e-51
Suva_11.111.527ON12905264991e-51
Skud_13.4755.20ON6917164821e-50
Smik_13.5185.20ON6875274785e-50
Kpol_1018.1851.527ON12765084851e-49
TPHA0L022705.20ON7115244761e-49
Suva_13.4915.20ON6935274732e-49
Skud_11.111.527ON12955224787e-49
KNAG0E013205.20ON6953264698e-49
YMR301C (ATM1)5.20ON6905274698e-49
NCAS0D024305.20ON7025334699e-49
TBLA0B100701.527ON12965194771e-48
TDEL0G004305.20ON6965624663e-48
Ecym_56495.20ON6963304573e-47
TBLA0C070005.20ON7253314567e-47
KAFR0E002301.527ON12705014628e-47
ZYRO0G02244g1.527ON12734914582e-46
NDAI0I024405.20ON7305504523e-46
AGL335W5.20ON6914354469e-46
Smik_11.141.527ON13165384531e-45
KNAG0G001901.527ON12755394521e-45
Kpol_513.235.20ON7083284442e-45
ZYRO0D07106g5.20ON7095334406e-45
CAGL0K00363g1.527ON12275424466e-45
NDAI0D015401.527ON12935144422e-44
AFR432W1.527ON12845124413e-44
SAKL0A10208g1.527ON13105044413e-44
NCAS0G035101.527ON12885104361e-43
CAGL0M13739g5.20ON7275294302e-43
KLLA0B14256g1.527ON12712414324e-43
Ecym_36121.527ON13155104253e-42
TPHA0O001601.527ON12535114211e-41
NCAS0E041605.10ON15065724022e-39
KLTH0B01100g1.527ON12985204012e-39
NCAS0J00160singletonON16545494004e-39
Kwal_33.155611.527ON12975123951e-38
NDAI0B006405.10ON14915543933e-38
NCAS0C059304.6ON16575443916e-38
TPHA0C009608.303ON15235713872e-37
ZYRO0G07612g4.6ON16955363862e-37
CAGL0E03355g4.52ON15355453862e-37
CAGL0E03982g4.6ON16595003844e-37
Smik_12.484.52ON15575343801e-36
YGR281W (YOR1)5.10ON14775583791e-36
KNAG0J027304.52ON15375513791e-36
SAKL0H26026g4.6ON16535113792e-36
KAFR0C065105.10ON14575293782e-36
YHL035C (VMR1)4.6ON15925513782e-36
Ecym_84184.6ON16785693773e-36
Suva_10.234.6ON16615453738e-36
KNAG0E011204.6ON17175573738e-36
Smik_16.275.10ON14775623721e-35
NDAI0J011508.303ON15175143721e-35
KLLA0E00529g4.6ON16505193702e-35
Kwal_34.157704.6ON14365053692e-35
TBLA0G007104.6ON16915123693e-35
CAGL0G00242g5.10ON14775653693e-35
Skud_7.6145.10ON14775633683e-35
YLL048C (YBT1)4.6ON16615913684e-35
Smik_8.64.6ON15855213674e-35
TDEL0E056104.52ON15355403666e-35
Kpol_311.34.6ON16575083658e-35
TDEL0G018504.6ON16424823631e-34
TPHA0F001804.6ON16465763631e-34
Suva_7.5775.10ON14785603622e-34
Skud_12.524.52ON15615393622e-34
Ecym_42658.303ON15054933612e-34
KNAG0K001705.10ON14425613594e-34
KLTH0H16038g4.6ON16495053594e-34
Smik_12.114.6ON16615503585e-34
NDAI0H001904.6ON16825173542e-33
NCAS0B034708.303ON15124853523e-33
Skud_12.224.6ON16615513514e-33
Zrou_YGOB_Anc_5.105.10ON9925623486e-33
KAFR0B056308.303ON15155373481e-32
KLTH0C09240gna 1ON15465503471e-32
TPHA0A056205.10ON14775633461e-32
SAKL0H00704g5.10ON14395723452e-32
TBLA0A06840singletonON10585493442e-32
Skud_4.3958.303ON15165153443e-32
Kwal_56.22747na 1ON15383173424e-32
Kpol_1060.75.10ON14605623424e-32
Suva_8.164.6ON15995203425e-32
KLTH0B09724g5.10ON14865563425e-32
TPHA0K023104.6ON16494903408e-32
ACL072C4.6ON16275043409e-32
Kpol_1033.288.303ON15315473391e-31
CAGL0C03289g4.6ON16485163381e-31
YLL015W (BPT1)4.52ON15595453353e-31
ZYRO0G22176g4.52ON15705223354e-31
YDR135C (YCF1)8.303ON15155303345e-31
KAFR0L001904.6ON16535543345e-31
Suva_10.60singletonON9905473325e-31
Suva_10.594.52ON15615463327e-31
Kwal_26.95325.10ON14715403328e-31
TBLA0C071005.10ON14855693311e-30
KLLA0C14234g5.10ON14545403302e-30
YKR104WsingletonON3062903102e-30
Smik_4.3808.303ON15165373292e-30
Suva_2.2978.303ON15165293292e-30
KAFR0I013004.52ON15365413292e-30
Kwal_56.238448.303ON14944863292e-30
KLTH0G12716g8.303ON15002493282e-30
KNAG0I009908.303ON15354893283e-30
Skud_8.94.6ON15875533273e-30
SAKL0H16016g8.303ON14995283273e-30
TPHA0F004104.52ON15705593264e-30
KLTH0B00396gsingletonON15072453247e-30
ZYRO0D06160g8.303ON15255393167e-29
KLLA0F20075g8.303ON15164753158e-29
TDEL0G003305.10ON14655813112e-28
TBLA0C06400singletonON13775573103e-28
AGR047W8.303ON14925203078e-28
TDEL0F043008.303ON15145293052e-27
KLLA0D04059g4.52ON15685403023e-27
Kpol_YGOB_1041.454.52ON15685503024e-27
Kpol_1041.45singletonOFF15965503015e-27
Skud_18.2singletonON15802573006e-27
TBLA0A038008.303ON15465493006e-27
CAGL0L06402g8.303ON15354912998e-27
SAKL0H23958g4.52ON15582872971e-26
Smik_11.367na 2ON15955402917e-26
AGL346W5.10ON14005052613e-22
Ecym_56605.10ON15362662103e-16
YKR103W (NFT1)na 2ON12182271987e-15
ACR128C8.661ON8271961871e-13
YPL147W (PXA1)8.661ON8702581825e-13
SAKL0D10208g1.366ON7522371791e-12
Suva_16.1638.661ON8702061781e-12
Smik_6.3448.661ON8702321772e-12
Kpol_175.1singletonON13774121772e-12
Kwal_26.87308.661ON8312101736e-12
Skud_16.1358.661ON8702321728e-12
Ecym_24108.661ON8282001701e-11
TBLA0D043501.427ON11192491701e-11
KLTH0D10890g8.661ON8302091692e-11
NDAI0H035701.366ON7552071682e-11
CAGL0K10472g1.366ON7522121682e-11
AEL032W1.366ON7532411673e-11
TDEL0B057601.427ON10362711673e-11
KNAG0C019601.366ON7522391664e-11
NCAS0F00410singletonON15312701674e-11
KNAG0I005301.427ON10472421657e-11
ZYRO0E08800g3.534ON6102421638e-11
SAKL0H21010gsingletonON14472861649e-11
ZYRO0D11880g5.500ON14982351649e-11
Ecym_11943.534ON6093281621e-10
TPHA0D011708.661ON9152091631e-10
KAFR0C045401.366ON7522391621e-10
ZYRO0E04092g1.427ON10622551631e-10
CAGL0F02717g5.500ON15423171621e-10
NDAI0E012408.661ON8972111621e-10
TBLA0D01820singletonON15512321621e-10
Suva_5.1343.534ON6101881611e-10
KAFR0C052205.500ON14992481622e-10
SAKL0D09394g1.427ON10272801612e-10
TBLA0D017805.500ON15952321612e-10
ZYRO0B05588g3.133ON12702341612e-10
ZYRO0B14762gsingletonON15152441602e-10
KLTH0H12760g1.427ON10202651602e-10
KLTH0H13442g1.366ON7522411592e-10
NCAS0A120605.500ON15432361602e-10
KNAG0B038705.500ON15132371603e-10
Kwal_23.51613.220ON14892351603e-10
KLLA0F11484g8.661ON8452081593e-10
YER036C (ARB1)3.534ON6102421583e-10
KAFR0C05210na 3ON14932321593e-10
AER190W1.427ON10112711593e-10
SAKL0F01606g3.534ON6082251583e-10
Smik_5.1593.534ON6101881574e-10
Skud_5.1453.534ON6101881574e-10
Skud_4.2623.220ON15012361575e-10
ZYRO0D11858gna 3ON15032321575e-10
TBLA0I033303.534ON6103311556e-10
KNAG0A029808.661ON8712051567e-10
ZYRO0G01144g1.366ON7522351557e-10
Kpol_1043.431.366ON7522331557e-10
KLLA0D04554g1.427ON10222421567e-10
SAKL0C11616g3.220ON14842371567e-10
KLTH0A01914g3.220ON14992321568e-10
KLLA0A10857g1.366ON7522261558e-10
TBLA0C012201.366ON7512371559e-10
TDEL0A060708.661ON8721961541e-09
AGL142CsingletonON14972371551e-09
KLTH0G19448gsingletonON14862471551e-09
TDEL0A036405.500ON15092751551e-09
YOR328W (PDR10)na 4ON15642371551e-09
Kwal_27.9666singletonON14743131541e-09
ZYRO0F07018g8.661ON8612171541e-09
TPHA0O010001.427ON10112511541e-09
TPHA0A008403.133ON13122341541e-09
KAFR0C00820na 5ON15173511541e-09
YOL075C3.133ON12942491531e-09
Kwal_34.162401.366ON7522411522e-09
CAGL0C02343g3.534ON7202771522e-09
NDAI0C012205.500ON15092281532e-09
NCAS0A085701.427ON10602471522e-09
Smik_7.3131.366ON7522121522e-09
Skud_4.6805.500ON14452401522e-09
Skud_4.681na 3ON14452401522e-09
NDAI0G050201.427ON10972281522e-09
TDEL0D040403.220ON15002331522e-09
Smik_15.508na 4ON15662631522e-09
YOR153W (PDR5)5.500ON15112201522e-09
TPHA0A023101.366ON7522121512e-09
YFR009W (GCN20)1.366ON7522121512e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL270W
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...  1460   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...  1330   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)  1321   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...  1287   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   920   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   900   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   896   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   895   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   893   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      892   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   869   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   854   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   837   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   835   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   830   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   813   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   805   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   800   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   776   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   771   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   533   e-180
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   530   e-178
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   525   e-177
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   523   e-176
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   521   e-175
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   521   e-175
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   519   e-174
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   518   e-174
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   515   e-173
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   513   e-172
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   512   e-172
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   510   e-171
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   511   e-171
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   502   e-167
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   497   e-166
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   496   e-165
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   478   e-158
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   471   e-157
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   216   7e-58
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   206   4e-56
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   204   2e-55
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   202   2e-54
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   201   5e-54
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   203   1e-53
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   193   1e-51
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   196   1e-51
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   190   1e-50
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   188   5e-50
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   191   1e-49
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   187   1e-49
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   186   2e-49
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   188   7e-49
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   185   8e-49
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   185   8e-49
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     185   9e-49
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   188   1e-48
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   184   3e-48
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   180   3e-47
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   180   7e-47
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   182   8e-47
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   181   2e-46
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   178   3e-46
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   176   9e-46
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   179   1e-45
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   178   1e-45
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   175   2e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   174   6e-45
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   176   6e-45
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   174   2e-44
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   174   3e-44
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   174   3e-44
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   172   1e-43
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   170   2e-43
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   171   4e-43
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   168   3e-42
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   166   1e-41
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    159   2e-39
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   159   2e-39
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   158   4e-39
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   156   1e-38
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    155   3e-38
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   155   6e-38
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   153   2e-37
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   153   2e-37
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   153   2e-37
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   152   4e-37
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   150   1e-36
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   150   1e-36
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   150   1e-36
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   150   2e-36
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   150   2e-36
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   150   2e-36
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   149   3e-36
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   148   8e-36
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   148   8e-36
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   147   1e-35
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   147   1e-35
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   147   2e-35
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   146   2e-35
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   146   3e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   146   3e-35
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   146   3e-35
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   146   4e-35
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   145   4e-35
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   145   6e-35
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   145   8e-35
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   144   1e-34
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   144   1e-34
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   144   2e-34
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   144   2e-34
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   143   2e-34
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   142   4e-34
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   142   4e-34
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   142   5e-34
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   140   2e-33
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   140   3e-33
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   139   4e-33
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   138   6e-33
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   138   1e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   138   1e-32
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   137   1e-32
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   137   2e-32
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   137   2e-32
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   137   3e-32
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   136   4e-32
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   136   4e-32
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   136   5e-32
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   136   5e-32
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   135   8e-32
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   135   9e-32
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   135   1e-31
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   134   1e-31
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   133   3e-31
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   133   4e-31
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   133   5e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   133   5e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   132   5e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   132   7e-31
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   132   8e-31
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           132   1e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   131   2e-30
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   124   2e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   131   2e-30
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   131   2e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   131   2e-30
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   131   2e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   130   2e-30
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   130   3e-30
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   130   3e-30
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   130   3e-30
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   130   4e-30
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   129   7e-30
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   126   7e-29
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   125   8e-29
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   124   2e-28
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   124   3e-28
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   122   8e-28
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   122   2e-27
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   120   3e-27
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   120   4e-27
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   120   5e-27
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   120   6e-27
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   120   6e-27
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   119   8e-27
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   119   1e-26
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   116   7e-26
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   105   3e-22
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    86   3e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    81   7e-15
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    77   1e-13
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    75   5e-13
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    74   1e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    73   1e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    73   2e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    73   2e-12
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    71   6e-12
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    71   8e-12
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    70   1e-11
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    70   1e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    70   2e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    69   2e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    69   2e-11
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    69   3e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    69   3e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    69   4e-11
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                69   4e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    68   7e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    67   8e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    68   9e-11
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    68   9e-11
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    67   1e-10
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    67   1e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    67   1e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    67   1e-10
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             67   1e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     67   1e-10
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              67   1e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    67   1e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    67   2e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    67   2e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    67   2e-10
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    67   2e-10
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    66   2e-10
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    66   2e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    66   2e-10
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    66   2e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    66   3e-10
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    66   3e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    66   3e-10
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    65   3e-10
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            66   3e-10
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    66   3e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   3e-10
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    65   4e-10
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    65   4e-10
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    65   5e-10
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    65   5e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    64   6e-10
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    65   7e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   7e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    64   7e-10
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    65   7e-10
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    65   7e-10
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    65   8e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    64   8e-10
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    64   9e-10
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    64   1e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    64   1e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    64   1e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    64   1e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    64   1e-09
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    64   1e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    64   1e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              64   1e-09
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    64   1e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    63   2e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    63   2e-09
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    64   2e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    63   2e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    63   2e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   2e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   2e-09
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    63   2e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    63   2e-09
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    63   2e-09
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    63   2e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    63   2e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    63   2e-09
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    63   3e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    63   3e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    63   3e-09
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    63   3e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    63   3e-09
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    63   3e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    63   3e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    63   3e-09
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    62   3e-09
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    62   4e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    62   4e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    62   4e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    62   4e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    62   4e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    62   5e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    62   5e-09
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    62   5e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    62   5e-09
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    61   6e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    62   6e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    62   6e-09
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    62   7e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    61   7e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    61   8e-09
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       61   8e-09
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    61   8e-09
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    61   9e-09
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    61   9e-09
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    61   9e-09
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    61   9e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    61   9e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    61   1e-08
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    60   1e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    60   1e-08
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    60   1e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    61   1e-08
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 60   1e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    60   1e-08
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    60   2e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    60   2e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    60   2e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    60   2e-08
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    60   2e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    60   2e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   2e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    60   2e-08
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    60   2e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    60   2e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    60   2e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    59   2e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    59   2e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            60   2e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    60   3e-08
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    60   3e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    59   3e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    59   3e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    59   4e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    59   4e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    59   4e-08
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    59   5e-08
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    59   5e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    59   5e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    59   6e-08
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    58   7e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    58   7e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    58   7e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    58   8e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    58   1e-07
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    57   1e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    57   1e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    57   1e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    57   1e-07
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    52   1e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    57   2e-07
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    57   2e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    57   2e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    57   2e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    57   2e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    57   2e-07
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    57   2e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    56   2e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    57   3e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    56   3e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    56   4e-07
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    55   4e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    56   4e-07
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    56   4e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    56   4e-07
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    56   4e-07
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    55   5e-07
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    55   5e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   5e-07
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    55   5e-07
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    55   6e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    55   7e-07
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    55   7e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    55   7e-07
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    54   7e-07
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   1e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    54   1e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    54   1e-06
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    54   1e-06
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    54   1e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    54   1e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    54   1e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    54   2e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    54   2e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    54   2e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    54   2e-06
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    54   2e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    54   2e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    54   2e-06
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    53   2e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    53   3e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    53   3e-06
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    53   3e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    53   3e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    53   3e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    52   4e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    52   5e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    52   6e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    52   7e-06
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    51   7e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    52   8e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    52   8e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   8e-06
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    52   8e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    51   1e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    51   1e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    51   1e-05
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    51   1e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    51   1e-05
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    49   2e-05
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    50   2e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    50   2e-05
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    50   2e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    50   2e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    49   3e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    49   3e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    49   4e-05
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    49   4e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    49   5e-05
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    49   5e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              49   6e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    49   6e-05
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    48   7e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    49   7e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     48   8e-05
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    47   1e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    47   1e-04
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    47   2e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    47   2e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    47   2e-04
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    47   2e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   3e-04
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    45   3e-04
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    46   3e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   5e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   7e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    45   7e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    45   8e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   8e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    44   8e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   8e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   8e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.001
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    44   0.001
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.001
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    44   0.001
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.001
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.001
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    44   0.001
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    43   0.001
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    44   0.002
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    44   0.002
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.002
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    44   0.002
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.002
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    42   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.003
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    43   0.003
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.003
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    43   0.003
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    43   0.003
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.004
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    42   0.004
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    43   0.004
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.004
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    43   0.004
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    42   0.004
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    42   0.004
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    42   0.005
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    42   0.005
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    42   0.005
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    41   0.006
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    42   0.006
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    42   0.006
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    42   0.006
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.007
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.007
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.007
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    41   0.007
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    42   0.008
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.008
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    42   0.010
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    40   0.010
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    41   0.010
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    40   0.011
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    41   0.012
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    41   0.013
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    41   0.015
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    41   0.016
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    41   0.016
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    40   0.016
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    40   0.017
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    40   0.017
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    40   0.018
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    40   0.018
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    40   0.022
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    39   0.024
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    39   0.025
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    40   0.026
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    40   0.027
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.027
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    40   0.032
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.033
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.035
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    40   0.037
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    38   0.059
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    39   0.070
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    39   0.076
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    38   0.078
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    38   0.086
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.10 
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    37   0.12 
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    37   0.14 
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.14 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    37   0.15 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    37   0.23 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.26 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    36   0.43 
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    36   0.44 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    35   0.60 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    35   0.70 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.71 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   0.73 
Suva_43.1 Chr43 (2..1099) [1098 bp, 366 aa] {ON} YDR011W (REAL)        35   0.79 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   1.2  
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    34   1.3  
KLTH0G05500g Chr7 (440283..442022) [1740 bp, 579 aa] {ON} weakly...    34   1.5  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.7  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    34   1.9  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    33   2.3  
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    33   2.6  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    33   3.5  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    32   4.9  

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score = 1460 bits (3780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/773 (93%), Positives = 724/773 (93%)

Query: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60
           MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI
Sbjct: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60

Query: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXX 120
           LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEXXXXXX 720
           DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKE      
Sbjct: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEHDDQKK 720

Query: 721 XXXXXXXXXXXXXXXXXXPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773
                             PETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP
Sbjct: 721 DDNDDNDNNHDNDSNNQSPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score = 1330 bits (3443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/773 (86%), Positives = 694/773 (89%)

Query: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60
           MLN RLPLLRLG+ RNMLSRPR+ KLP +RFRSLVT SSSQLI ++ L  RSP +GK+LI
Sbjct: 1   MLNSRLPLLRLGLYRNMLSRPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLI 60

Query: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXX 120
           L SFR  SSKT  +  LPS S  SKGS++SAH+ EQSKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LSSFRYISSKTKLQAPLPSVSSTSKGSSKSAHSTEQSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICG+VGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPTVGHKY+P+RGVIEFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNPTTGTI IDNQDI+KLNCKSLRR IGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEXXXXXX 720
           DGSVVEMGKFKELYAN TSALSQLLNE+AAPGPSDQQLQIEKV EKED NE ++      
Sbjct: 661 DGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNK 720

Query: 721 XXXXXXXXXXXXXXXXXXPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773
                              E KD NS++IE+SVEHLLKDAAKEANPIK+TPQP
Sbjct: 721 QDDDNSHNNHDNDSNNQSLEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score = 1321 bits (3420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/773 (85%), Positives = 686/773 (88%)

Query: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60
           MLNGRLPLLRLG+CRN++SRPRLAKLPSI+FRSLVTPSSS LIP++RLC+RSP VGKSL+
Sbjct: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60

Query: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXX 120
           LQ  R NSSKT P   L S+S  SK S + A   ++SKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LQFSRYNSSKTEPVALLSSSSSASKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPT GHKYKP RGV+EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNP+TGTI ID+QDI+K+NCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEXXXXXX 720
           DGSVVEMGKFK+LYANPTSALSQLLNE+AAPGPSDQQ QIEK  E E+  E K       
Sbjct: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIEKDNENEESTEEKAPDHSNK 720

Query: 721 XXXXXXXXXXXXXXXXXXPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773
                              E    NSDDIE+SVEHLL+DAAKEA PIK+TPQP
Sbjct: 721 NDNDDNDNNHDNDSNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/774 (83%), Positives = 678/774 (87%), Gaps = 8/774 (1%)

Query: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60
           MLNGRLPL RLG+ RN+LSR RL KLP IRFRSL T SSS LIP+  LC R   + KSL+
Sbjct: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60

Query: 61  LQSFRCNSSKTVPETS-LPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXX 119
            Q  R NS+KT  +   LPS S  SK  A+ A+   QSK+DDYKDIIRLFMLAKRDWK  
Sbjct: 61  SQFVRFNSTKTQQDIPPLPSTSA-SKQPAKPAY---QSKSDDYKDIIRLFMLAKRDWKLL 116

Query: 120 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 179
                    SCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL
Sbjct: 117 LTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALL 176

Query: 180 IGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239
           IGC ANFGRFILLRILSERVVARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS
Sbjct: 177 IGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 236

Query: 240 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
           RSMTQKVSDGVKALICGVVGVGMMCSLSPQLS+LLLFFTPPVLFSASVFGKQIRNTSKDL
Sbjct: 237 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDL 296

Query: 300 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
           QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              S
Sbjct: 297 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTS 356

Query: 360 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
           LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS
Sbjct: 357 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 416

Query: 420 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
           RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCI
Sbjct: 417 RLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCI 476

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539
           VGPSGRGKSTIALLLLRYYNPTTGTI IDNQDI+K+NCKSLRRHIGIVQQEPVLMSGTIR
Sbjct: 477 VGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 536

Query: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARA 599
           DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP+GTLLSGGQKQRIAIARA
Sbjct: 537 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARA 596

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659
           LIKKPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG
Sbjct: 597 LIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 656

Query: 660 HDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEXXXXX 719
           HDGSVVEMGKFKELY+NPTSALSQLLNE+ AP PS+QQ Q+EK  EKE+ NE +      
Sbjct: 657 HDGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRN 716

Query: 720 XXXXXXXXXXXXXXXXXXXPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773
                               E+KD  SDDIE+SVEH+LKDAAKEANPIK++P P
Sbjct: 717 EGDDGSNHDNDSNNKPL---ESKDKKSDDIEESVEHVLKDAAKEANPIKLSPPP 767

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/610 (74%), Positives = 508/610 (83%), Gaps = 12/610 (1%)

Query: 94  KEQSKT----DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT 149
           +EQS+T     +++DI+RL +L +RDWK           SCSIGM+IPKVIG++LD LK 
Sbjct: 105 EEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKN 164

Query: 150 SSGSDFFDL------KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVA 201
           +  ++  D       K+P  +F L  YEFL  F +ALL+G AAN+GR ILLR+LSER+VA
Sbjct: 165 ALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVA 224

Query: 202 RLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
           RLRA VIKKT+HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+G
Sbjct: 225 RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284

Query: 262 MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           MM +LSPQLS LLL FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQ
Sbjct: 285 MMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQ 344

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
           SFVAE  E++RYN AIRDIF +G              S +GDLSFLTVL +GSYLVLQ+ 
Sbjct: 345 SFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNS 404

Query: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP 441
           L+IGDLTAFM+YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KYKP
Sbjct: 405 LTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKP 464

Query: 442 DRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
             G IEFK+VSF+YPTRPS  IFKNLNFKI  GS+VCIVGPSGRGKST+ALLL +YY P+
Sbjct: 465 GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS 524

Query: 502 TGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           +G I ID Q+I+ LN KSLRRHIG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQ
Sbjct: 525 SGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQ 584

Query: 562 CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           CFCHNFIT+F ++YDTVIGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESE
Sbjct: 585 CFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESE 644

Query: 622 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
           GAINYTFGQLMK K MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL+ +PTS L
Sbjct: 645 GAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704

Query: 682 SQLLNEKAAP 691
           SQLLNEK+ P
Sbjct: 705 SQLLNEKSTP 714

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/628 (71%), Positives = 509/628 (81%), Gaps = 3/628 (0%)

Query: 84  SKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIV 143
           +K    S H    +   +  D+ RL  LAKRDWK           SC IGMS+PK+IGIV
Sbjct: 81  TKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIV 140

Query: 144 LDTLKT-SSGSDFFDLKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200
           LD LK   S  DF    +P   F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVV
Sbjct: 141 LDELKQIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVV 200

Query: 201 ARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260
           ARLRANVIKKT+HQDAEFFDN+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+
Sbjct: 201 ARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGI 260

Query: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
           GMM S+SPQLS  LLF TPPV+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTV
Sbjct: 261 GMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTV 320

Query: 321 QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
           QSFVAE  E+ RYN AIR IF VG              ++LGD+SFL VLAYGSYLVL  
Sbjct: 321 QSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHG 380

Query: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440
            LSIGDLTA+M+YTEYTG+++FGLSTFYSEIMQGAGAASRLFELTDR PSISPT+G K+ 
Sbjct: 381 SLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFV 440

Query: 441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P++G IEFK+VSFSYPTR S QIFKNL+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNP
Sbjct: 441 PNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNP 500

Query: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
           TTG I +D QDISK++ KSLRRH+ IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K
Sbjct: 501 TTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITK 560

Query: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +CFCHNFITKFPN+YDT++GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES
Sbjct: 561 KCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620

Query: 621 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680
           EGAINYTFG+LMKSKS+TI+SIAHRLSTIRRSENVIVLG+DGSV E+GKFKELYA+P S 
Sbjct: 621 EGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSE 680

Query: 681 LSQLLNEKAAPGPSDQQLQIEKVIEKED 708
           LS+LL+EKA      Q    ++ I+ E+
Sbjct: 681 LSKLLHEKATRSERQQNTAEDQEIDPEE 708

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/751 (61%), Positives = 550/751 (73%), Gaps = 34/751 (4%)

Query: 45  LSRLCLRSPAVGKSLIL----QSFRCN-----------SSKTVPETSLPSASPISKGSAR 89
           LSRL + S    +  IL    + F CN           ++ T+P  +  + S  +K S  
Sbjct: 90  LSRLSILSLTAKQDSILLLKTKPFNCNKVALRFNSTTNTTDTIPPHTESTES--TKASTE 147

Query: 90  SAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT 149
               +      ++KD+ RLF+L K+D+K           SC+IGM IPK+IG++LD LK+
Sbjct: 148 PNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKS 207

Query: 150 SSGSDFFDLKIP---IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAN 206
            + +       P   +F L LYEFL  F+VAL IGCAAN+GR ILLRILSER+VARLR+ 
Sbjct: 208 VATTPDGGSSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSV 267

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
           V+K TLHQD+EFFD HKVGDLISRLG+D+Y+VSRS+TQK+SDGVK+LICG VG+GMM  L
Sbjct: 268 VMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLEL 327

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           S  LS +L+ F  PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G++TVQSFVAE
Sbjct: 328 SMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAE 387

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ R+N +IR+IF VG              SL+GDLSFLTVL YGSYLVL   L+IGD
Sbjct: 388 QREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 447

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVI 446
           LTAFMLYTEYTGNA+FGLSTFYSEIMQGAGAASRLFELTDR P+I PT+G  Y P +G I
Sbjct: 448 LTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEI 507

Query: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
           EFK+VSF+YPTRPS QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I 
Sbjct: 508 EFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 567

Query: 507 IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
           ID QDI+KLN KSLRR I +VQQEPVLMSGTIRDNITYGLT  PTKEEIR+VAKQCFCHN
Sbjct: 568 IDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHN 627

Query: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           FI KFP TYDT IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINY
Sbjct: 628 FIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 687

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           TFGQLMKSKSMTIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+A+PTS LS+LLN
Sbjct: 688 TFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLN 747

Query: 687 EKAAPGPSDQQLQIEKVIEKEDLNESKEXXXXXXXXXXXXXXXXXXXXXXXXPETKDN-- 744
           EK++          +KV+ K     S                              +   
Sbjct: 748 EKSSR---------KKVVTKTVPPVSSTSVSSANGSSIHHEGTILEEDHAQEDHESEAPP 798

Query: 745 ---NSDDIEKSVEHLLKDAAKEANPIKITPQ 772
               +  +E S+E +L D + E+ PIK++P+
Sbjct: 799 TIITTQQLEDSIESVLNDVSAESKPIKLSPK 829

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/755 (62%), Positives = 548/755 (72%), Gaps = 67/755 (8%)

Query: 52  SPAVGKSLILQSF--------------------RCNSSKTVPETSLPSASPISKG---SA 88
           SP++ +S+IL+ F                    RC  S  + +    +  P+++    S 
Sbjct: 16  SPSIARSVILRRFTPLVRRLPIVQPSVRSVISKRCQLSP-LSQIQFQTTRPLTRSFTSSV 74

Query: 89  RSAHAK---EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD 145
           R   AK   E  +    KD++RL MLAK DWK           SC IGM+IPKVIG++LD
Sbjct: 75  RLLQAKSPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILD 134

Query: 146 TLKT----SSGSD----FFDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196
            LKT    + G D      D+  PIF    +YEFL  F   ++ G  AN+GR +LLRILS
Sbjct: 135 VLKTGLETNEGKDGPISMADVP-PIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILS 193

Query: 197 ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
           ERVVARLRANVIKKT+HQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG
Sbjct: 194 ERVVARLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICG 253

Query: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            VGVGMM S+SPQLS LLL FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG
Sbjct: 254 GVGVGMMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSG 313

Query: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
           ++TVQSFVAE  E+ RY+ AIRDIF VG              S LGD+SFL VLAYGSYL
Sbjct: 314 VRTVQSFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYL 373

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
           VLQ  L+IGDLTAFMLYTEYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G
Sbjct: 374 VLQGGLTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTG 433

Query: 437 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K+ P +G I FKDV+FSYPTRP   IF++++ KI  GS+VC+VGPSGRGKSTIALLLLR
Sbjct: 434 KKFVPGKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLR 493

Query: 497 YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
           +YNP++G I ID QDISKLN KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR
Sbjct: 494 FYNPSSGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIR 553

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            VAKQCFCHNFI KFP+ YDTVIGP G LLSGGQKQRIAIARALIKKPTIL+LDEATSAL
Sbjct: 554 MVAKQCFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSAL 613

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           DVESEGAINYTFGQLMKSKS+TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+A+
Sbjct: 614 DVESEGAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFAD 673

Query: 677 PTSALSQLLNEKAAPGPSDQQLQIEKVIEK-EDLNESKEXXXXXXXXXXXXXXXXXXXXX 735
           P+S LS+LLNEK++   +          E+ ED    K                      
Sbjct: 674 PSSELSKLLNEKSSRSENSSSSYSPNASEQPEDEANQKN--------------------- 712

Query: 736 XXXPETKDNNSDDIEKSVEHLLKDAAKEANPIKIT 770
              PE   ++      SVE +LKD   E  PIKI+
Sbjct: 713 --APEEAHDD------SVEEILKDVTAEGKPIKIS 739

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/692 (66%), Positives = 524/692 (75%), Gaps = 46/692 (6%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS-SGSD 154
           Q K   YKD +RLF LAKRDW+           SC IGMSIPKVIG+VLD L+    G D
Sbjct: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130

Query: 155 FFDLKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIK 209
             ++ +    PI F L +Y+FL  F   LL+G AANF R ++LRILSERVVARLR+ V+ 
Sbjct: 131 LQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMN 190

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM S+SP+
Sbjct: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQSFVAE  E
Sbjct: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           L RYN AIR I+ VG              ++LGD+SF+ VL YGSYLVLQ  L+IGDLTA
Sbjct: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFK 449
           FMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P +G IEFK
Sbjct: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           +VSFSYPTRP  QIFK++N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT G I +D 
Sbjct: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
           QDISK+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT
Sbjct: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550

Query: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           KFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG
Sbjct: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKA 689
           QLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+ANP S L +LL EK+
Sbjct: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670

Query: 690 A--------PGPSDQQLQIEKVIEK--EDLNESKEXXXXXXXXXXXXXXXXXXXXXXXXP 739
           +        P P     Q +KV+E+  E + E                           P
Sbjct: 671 SRSDGNDSLPPPPPNATQ-DKVVEQIAEKILER-------------------------FP 704

Query: 740 ETKDNNSDDIEKSVEHLLKDAAKEANPIKITP 771
           E   +     + +V+ + KD + E  PIKITP
Sbjct: 705 EAGQSP----DATVKEIFKDVSSEGKPIKITP 732

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/630 (71%), Positives = 514/630 (81%), Gaps = 9/630 (1%)

Query: 65  RCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXX 124
           R NS  TV   S  +  P  +G+  S   + +S   ++ D+IRLF+L K DWK       
Sbjct: 92  RLNS--TVSTQSKDNKQPSLQGNPLSTSEEPKS---NFSDVIRLFLLVKTDWKLLLVALT 146

Query: 125 XXXXSCSIGMSIPKVIGIVLDTLK--TSSGSDFFDLKIPI--FSLPLYEFLSFFTVALLI 180
               SC IGM IPKVIGI+LD+LK  T++ S+  +   PI  F L +YEFL  F++ALL 
Sbjct: 147 LLTISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLA 206

Query: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GC ANFGR ILLRILSER+VARLR+ VIK+T+HQDA+F+D HK GDLISRLG+DAY+VSR
Sbjct: 207 GCMANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSR 266

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           S+TQK+SDG K+LICG VGVGMMCSLS  LS +L     PV+ SAS+FGKQIR  S++LQ
Sbjct: 267 SITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ 326

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           +ATGQLTRV+EEQL+G+KTVQSFVAE  E+ R+N AIR+IF VG              SL
Sbjct: 327 DATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL 386

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           +GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYTGN++FGLSTFYSEIMQGAGAASR
Sbjct: 387 VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446

Query: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTD  P I PT+G  Y P +G IEFK+VSFSYPTRP  QIFKNLNFKI PGS+VCIV
Sbjct: 447 LFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSG+GKSTIALLLL YYNPT+G I ID QDI+K+N KSLRR +GIVQQEPVLMSG+IRD
Sbjct: 507 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIR VAKQCFCHNFITKFP+TYDT IGP GTLLSGGQKQRIAIARAL
Sbjct: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           IKKP ILILDEATSALDVESEGAINYTFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLG+
Sbjct: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686

Query: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAA 690
           DGSV+EMGKFKEL+++P+S LS+LLNEK++
Sbjct: 687 DGSVIEMGKFKELFSDPSSELSKLLNEKSS 716

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/603 (71%), Positives = 486/603 (80%), Gaps = 13/603 (2%)

Query: 100 DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT--SSGSDF-- 155
           +D  DI RL  LAK+DWK           SC+IGMS+PKVIG+VLD LK   S   D   
Sbjct: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131

Query: 156 --FDLKI------PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAN 206
              DL I      PI F L LYEFL     ALLIG AANFGR +LLR+LSERVVARLR+ 
Sbjct: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQ 191

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+CG VGVGMM S+
Sbjct: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSI 251

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ RYN  I+D++ VG              S LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVI 446
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G I
Sbjct: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431

Query: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
           EFK+VSF+YPTRP  QIFK+LNFKI PGS+VCIVGPSGRGKSTIA LLL+YY PT GTIT
Sbjct: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491

Query: 507 IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
           +D QDISKLN KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551

Query: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           FITKFP+ Y T++GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           TFG+LMK K +TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLN
Sbjct: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671

Query: 687 EKA 689
           EK+
Sbjct: 672 EKS 674

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/615 (68%), Positives = 493/615 (80%), Gaps = 7/615 (1%)

Query: 81  SPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVI 140
           SP    +  S  A+++ K     ++ RL ++  RDWK           SCSIGM+IPKVI
Sbjct: 126 SPPPNKTNYSPRAEDEKK--GRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVI 183

Query: 141 GIVLDTLK-----TSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRIL 195
           G+VLD LK     + S  +  DL    F L LY FL  F  AL+IG   N+GR+ILLR+L
Sbjct: 184 GLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLL 243

Query: 196 SERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALIC 255
           SERVVARLR++VIKKTLHQDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++C
Sbjct: 244 SERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILC 303

Query: 256 GVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLS 315
           G  G+GMM S+SPQLS  L+ F P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+
Sbjct: 304 GGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLN 363

Query: 316 GIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
           G+KTVQSFVAE  E+ RYN AIRDI+ +G              S++GD+SFL VLAYGSY
Sbjct: 364 GVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSY 423

Query: 376 LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV 435
           LVL   L+IGDLTAFMLYT+YT N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT+
Sbjct: 424 LVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTI 483

Query: 436 GHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
           G K+ P  G IEF+++ F+YPTRP  Q+FKNLNFKI PG+SVCIVGPSGRGKSTIALLLL
Sbjct: 484 GEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL 543

Query: 496 RYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
           RYYNP++G I IDNQDI KLN KSLR+++GIVQQEPVLMSG+IRDNITYGL    T +EI
Sbjct: 544 RYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI 603

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           R V+KQCFCHNFITKFP+ Y+T+IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSA
Sbjct: 604 REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663

Query: 616 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
           LDVESEGAINYTFG+LMKSKS+TIVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA
Sbjct: 664 LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723

Query: 676 NPTSALSQLLNEKAA 690
           +PTS LS+LLNEK +
Sbjct: 724 DPTSELSKLLNEKQS 738

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/708 (62%), Positives = 527/708 (74%), Gaps = 27/708 (3%)

Query: 9   LRLGICRNMLSRPRLAKL----PSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLILQSF 64
           LRLG+ ++  + P L K     P  RFR+    + +++        RSP + + ++    
Sbjct: 7   LRLGLLKH--TGPSLYKRTFVSPIWRFRAGSHLNVNRVRTPLHFVKRSPLIPRRVLY--- 61

Query: 65  RCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXX 124
              S+   P+   P   P     A   H K + +   YKDI RLF+L K DWK       
Sbjct: 62  ---STDVTPKE--PEKQP-----AVVVHPKPEDE-GTYKDIWRLFLLVKSDWKLLMSALT 110

Query: 125 XXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAA 184
               SC IGM IPKVIG VLD+LK   G +F +L I  + + L  F    +  LL+GC A
Sbjct: 111 LLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI--WDMSLKHFFYGLSGLLLLGCGA 168

Query: 185 NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ 244
           N+ R ILLRILSE +VA+LRANVIK  +HQDA+FFD +KVGDLISR+G+DA++VSRS+TQ
Sbjct: 169 NYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQ 228

Query: 245 KVSDGVKALICGVVGVGMMCSLSPQLSI-LLLFFTPPVLFSASVFGKQIRNTSKDLQEAT 303
           K+SDGVKA+  G  GVGMM S+S  LS  +L+    P+L SA VFGKQIR+ SK LQE T
Sbjct: 229 KISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVT 288

Query: 304 GQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGD 363
             LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR IF VG              S++GD
Sbjct: 289 ANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGD 348

Query: 364 LSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           LSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAASR+FE
Sbjct: 349 LSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFE 408

Query: 424 LTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
           LTD KP I+PT G K+ P +G  IEFK+VSF+YPTRP+V IF+NLNFKI  GS+VCIVGP
Sbjct: 409 LTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGP 468

Query: 483 SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
           SG+GKSTIA LLL YYNP+ G I ID QDIS L+ KSLRRHIGIVQQEP+LMSGTIRDNI
Sbjct: 469 SGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNI 528

Query: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
           TYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT IGPHGTLLSGGQKQRIAIARALIK
Sbjct: 529 TYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIK 588

Query: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
           KPT+LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG+DG
Sbjct: 589 KPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDG 648

Query: 663 SVVEMGKFKELYANPTSALSQLLNEKAA---PGPSDQQLQIEKVIEKE 707
           SVVE GKFKEL+ANP S LS+LL EK++     P  Q  +I + IE++
Sbjct: 649 SVVEQGKFKELFANPASELSKLLREKSSGNNAAPEIQPQEISQTIEED 696

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/625 (66%), Positives = 488/625 (78%), Gaps = 13/625 (2%)

Query: 94  KEQSKTDD-----YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK 148
           KEQ  T       YK+I RLF LA+ DWK           SCSIGM++PKVIG+VLD  K
Sbjct: 111 KEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAK 170

Query: 149 TSSGSD-----FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARL 203
            +  SD       DL   ++ L LY+FL+ F  AL++   ANFGR +LLRIL E++VARL
Sbjct: 171 NAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARL 230

Query: 204 RANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM 263
           R+NVIKKT+HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ +SDG KA+ICG VG+GMM
Sbjct: 231 RSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMM 290

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
             +S  L+  L  F PP+L  A+++G++IR+ S+DLQ++TG LT+VAEEQLSG+KTVQSF
Sbjct: 291 FHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSF 350

Query: 324 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS 383
           VAE  E+ RYN AIR +F VG              S+LGD SFL VLAYGS+LVLQ  LS
Sbjct: 351 VAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLS 410

Query: 384 IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR 443
           IGDLTAFMLYTEY+G+AVFGLS FYSE+M+GAGAASRLFELTD +PSI  T G  Y P +
Sbjct: 411 IGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGK 470

Query: 444 GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G I+F++VSFSYPTR + QIF NLNF I  GS+VC+VGPSGRGKSTIA LLL+YYNPT+G
Sbjct: 471 GEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSG 530

Query: 504 TITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
            ITID QDISK++ KSLRRH+G+VQQEP+LMSG+IRDNITYG+ YTPT +EIRSV+K+CF
Sbjct: 531 RITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCF 590

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
           CHNFITKF + Y+TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGA
Sbjct: 591 CHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 650

Query: 624 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQ 683
           INYT GQLMKS+ +TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKELYA+  S L +
Sbjct: 651 INYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYK 710

Query: 684 LLNEKAAPGPSDQQLQIEKVIEKED 708
           LLNEKA    S    +    +EK D
Sbjct: 711 LLNEKAKDTTSKMNAE---TVEKND 732

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/668 (62%), Positives = 500/668 (74%), Gaps = 20/668 (2%)

Query: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAK-EQSKTDDYKDIIRLFMLAKRDWKXX 119
           LQ  R  S KTV   +    +P  K S +S   + E+S    YK++IRLF LA  DWK  
Sbjct: 100 LQLTRLYSQKTVESQA---KTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWKLL 156

Query: 120 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFF 174
                    S  IGMSIPKVIG+VLD +K +  S        DL   +  L +YEFL  F
Sbjct: 157 TFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVNDLSMYEFLGIF 216

Query: 175 TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
             AL+IG  ANFGR +LLR+L E++VARLR+NVI+K +HQDAEFFD +KVGDLISRL SD
Sbjct: 217 AGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRLSSD 276

Query: 235 AYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRN 294
           AYVVSRSMTQ VSDG KA+ICG VG+GMM ++S  L+  LL F PP+L  A ++GK+IR 
Sbjct: 277 AYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKRIRM 336

Query: 295 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN AIR +F  G          
Sbjct: 337 ISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTNATF 396

Query: 355 XXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG 414
               ++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEYTG+AVFGLS FYSE+M+G
Sbjct: 397 FSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSELMKG 456

Query: 415 AGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPG 474
           AGAASRLFE+TD  PSI PT G  Y P  G I FKDVSFSYPTRP  QIF  LNF I PG
Sbjct: 457 AGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTIEPG 516

Query: 475 SSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM 534
           S+VCIVGPSGRGKSTI  LLLRYYNP++G ITID+QDIS+L+CKSLRRH+G+VQQEP+LM
Sbjct: 517 SNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEPMLM 576

Query: 535 SGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRI 594
           SG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFPN YDT+IGP G  LSGGQKQRI
Sbjct: 577 SGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQKQRI 636

Query: 595 AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654
           AIARAL+KKP ILILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSEN
Sbjct: 637 AIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRRSEN 696

Query: 655 VIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPS-----------DQQLQIEKV 703
           VIVLG+DGSVVE+GKFK+LYA+  S L +LLN+K    P+           +Q+ QI+  
Sbjct: 697 VIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSDPEKDREQEHQIDNQ 756

Query: 704 IEKEDLNE 711
           + ++  N+
Sbjct: 757 VREQVAND 764

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/628 (64%), Positives = 483/628 (76%), Gaps = 9/628 (1%)

Query: 86  GSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD 145
           G A +   +E+SKT+ Y++I+RL  LA+ DWK           S ++GM+IPKVIGIVLD
Sbjct: 91  GKANNESTEEKSKTN-YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLD 149

Query: 146 TLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200
            +K +SG         DL   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++V
Sbjct: 150 AVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLV 209

Query: 201 ARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260
           ARLR+NVIKK +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA+ICG VG+
Sbjct: 210 ARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGI 269

Query: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
           GMM ++S  L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+
Sbjct: 270 GMMINISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTI 329

Query: 321 QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
           Q+FVAEG EL RYN AIR +F  G               +LGDLSFL VLAYGS+LVLQ 
Sbjct: 330 QAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQG 389

Query: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440
            LS+GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P+ G  Y 
Sbjct: 390 GLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYV 449

Query: 441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P  G I+F+DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P
Sbjct: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509

Query: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            +G I ID Q+ISKL+CKSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK
Sbjct: 510 NSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569

Query: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +CFCH FITKFP  Y+TVIGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVES
Sbjct: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629

Query: 621 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680
           EGAINYT G+LM+S+ +TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYAN  S 
Sbjct: 630 EGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSE 689

Query: 681 LSQLLNEKAAPGPSDQQLQIEKVIEKED 708
           L +LLN+K    P+  Q Q    +E ++
Sbjct: 690 LFKLLNDKK---PTQLQSQSRNSVETKE 714

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/625 (63%), Positives = 474/625 (75%), Gaps = 29/625 (4%)

Query: 92  HAKEQSKTDDYK-------------DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPK 138
           H + + KT D K             D+ RLF LA+ DWK           SC+IGM++PK
Sbjct: 89  HQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPK 148

Query: 139 VIGIVLDT----------------LKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGC 182
           VIG+VLD                 L+ S      DL   +  + LY+F   F  ALLIG 
Sbjct: 149 VIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGT 208

Query: 183 AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242
            ANFGR +LL+IL ER+VARLR+NVIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSM
Sbjct: 209 MANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSM 268

Query: 243 TQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA 302
           TQ +SDG KALICG VG+GMM  +S  L+ +L  F PP+L  A+++G +IR  S++LQ+A
Sbjct: 269 TQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQA 328

Query: 303 TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 362
           +G LT+VAEEQLSGIKTVQSFVAEG E+ RYN A+R +F VG              ++LG
Sbjct: 329 SGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLG 388

Query: 363 DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF 422
           D SFL VLAYGS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLF
Sbjct: 389 DFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLF 448

Query: 423 ELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
           EL D KP+I  T G  +KP  G +EF+ VSFSYPTR + QIFK+LNF I PGS+VCIVGP
Sbjct: 449 ELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGP 508

Query: 483 SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
           SGRGKSTIA LLLRYYNPT+G I +D QDI+KL+ KSLRR +G+VQQEP+LMSGTIR+NI
Sbjct: 509 SGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENI 568

Query: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
           TYG++  P+ EEIRSVAK+CFCH FI+KFPN Y+T+IGP G LLSGGQKQRIAIARAL+ 
Sbjct: 569 TYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLN 628

Query: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
           KP ILILDEATSALDVESEGAINYT G+LMKSK +TI+SIAHRLSTIRRSENVIVLG DG
Sbjct: 629 KPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDG 688

Query: 663 SVVEMGKFKELYANPTSALSQLLNE 687
           SVVEMGKFK+LYAN  SAL +LL E
Sbjct: 689 SVVEMGKFKDLYANHDSALHKLLTE 713

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/621 (62%), Positives = 477/621 (76%), Gaps = 18/621 (2%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK------ 148
           + +K   + ++ RL  L K DWK           SCSIGM++PKVIG+VLD  K      
Sbjct: 96  QPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQA 155

Query: 149 ----TSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLR 204
               T +     D+   I +  L + L+ F  ALL+G AANFGR  LL++L ER+VARLR
Sbjct: 156 EKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLR 215

Query: 205 ANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMC 264
           A VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG VGVGMM 
Sbjct: 216 AQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMF 275

Query: 265 SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 324
            +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +GIKT++SFV
Sbjct: 276 HISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFV 335

Query: 325 AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSI 384
           AEG E+ RYN A+R +F V               ++LGD+SFL VLAYGS+LVLQ +LS+
Sbjct: 336 AEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSL 395

Query: 385 GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG 444
           G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  TVG  + P  G
Sbjct: 396 GSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG 455

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            IEFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR+Y+  +GT
Sbjct: 456 RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           I ID QDISK++ KSLR+H+G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR+VAK+CFC
Sbjct: 516 ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFC 575

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
           HNFITKFP+ YDTVIGP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAI
Sbjct: 576 HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
           NYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY +  S L +L
Sbjct: 636 NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695

Query: 685 LNE--------KAAPGPSDQQ 697
           LNE        +A+P P+ ++
Sbjct: 696 LNEHASEPAKPEASPAPAQEE 716

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/612 (61%), Positives = 462/612 (75%), Gaps = 25/612 (4%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF------ 155
           +++++RL  LAK DWK           SC+IGM++PKVIG+VLD  K +  S +      
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 156 ------------------FDLKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196
                              D   PI  +L + +F+  F  AL++G  ANFGR +LL+I+ 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 197 ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
           ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG KA+ICG
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRVAEEQL+G
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
           I+T++SFVAE  E+ RYN AIR +F VG              ++LGD+SF+ VL YG+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
           VLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K S+   + 
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 437 HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
           H   P +G IEF+DVSFSYPTRPS QIFK+++F I PGS+VCIVGPSG+GKSTI  LLLR
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 497 YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
           +Y+P  G+I IDN DISK   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YTPT +EIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            V+KQCFCH FITKFP+ YDTVIGP G  LSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +LY N
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696

Query: 677 PTSALSQLLNEK 688
             S L +LLNEK
Sbjct: 697 EESELFKLLNEK 708

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/784 (55%), Positives = 526/784 (67%), Gaps = 51/784 (6%)

Query: 5   RLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLILQSF 64
           +L L R  + R+ L+   L  +PSIR  S   PS     P       SP   + L + S 
Sbjct: 3   KLCLPRTTLLRSQLAGSNLRIIPSIRLLSYSRPS-----PFPS---NSPRPTRCLTVPSR 54

Query: 65  RCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXX 124
                +T+P+  +P          R+           ++D+ RL +L K+D K       
Sbjct: 55  TNFIPRTLPQFLVPH---------RTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIV 105

Query: 125 XXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAA 184
               SCSIGM+IPK+IG +LDTL+ +  +     +I I ++PL  FL    + L+ GC A
Sbjct: 106 LLTISCSIGMAIPKIIGTILDTLRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFA 165

Query: 185 NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ 244
           NFGR ++LRI+SER+V+RLR+ V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T 
Sbjct: 166 NFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITH 225

Query: 245 KVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
           KV+DGV++   G+ G+G+M +LS +L+  L    PP+++  SVFGKQIR  SK LQ+ TG
Sbjct: 226 KVADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTG 285

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
            LTRV EEQ +GI+TVQ FVAE NE+ R+N  +R+IFQVG              SL+GDL
Sbjct: 286 DLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDL 345

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            FL VL YGSYLV+   +SIGDLTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+
Sbjct: 346 GFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEI 405

Query: 425 TDRKPSISPTVGH-KYKPDRGV----IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
            D++P I  T G  K+KP   V    IEFK+VSF YPTRP+ QIFKNLNFK+  GS+VCI
Sbjct: 406 NDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCI 465

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539
           VGPSGRGKSTIA LLL +YN  +G I ID QDI+ LN KSLRR IGIVQQEP+LMSGTIR
Sbjct: 466 VGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIR 525

Query: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD--TVIGPHGTLLSGGQKQRIAIA 597
           DNITYGLT  P+KEEIR VAKQCFCHNFITKFP+TYD     G  GT LSGGQKQRIAIA
Sbjct: 526 DNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIA 585

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 657
           RALIKKP ILILDEATSALDVESEGAINYTFGQ+MKSKSMTIVSIAHRLSTIRR E+VIV
Sbjct: 586 RALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIV 645

Query: 658 LGHDGSVVEMGKFKELYANPTSALSQLLNEK-----AAPGPSDQ----QLQIEKVIEKED 708
           LG+DGSVVEMGKFKELY NPTS LS+LLNEK     A P P +      LQ     +KE 
Sbjct: 646 LGNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEA 705

Query: 709 LNESKEXXXXXXXXXXXXXXXXXXXXXXXXPETKDNNSDDIEKSVEHLLKDAAKEANPIK 768
            N S+E                           +D +  D   S +  LK+A  E  PIK
Sbjct: 706 DNASEENGAKLDD------------------SKEDVSVPDNMTSSDDSLKEAVNEGGPIK 747

Query: 769 ITPQ 772
           ITP+
Sbjct: 748 ITPR 751

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  533 bits (1374), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 283/653 (43%), Positives = 410/653 (62%), Gaps = 21/653 (3%)

Query: 54  AVGKSLILQSFRCNSSKTVPETSLPSASPISKGSAR-SAHAKEQSKTDDYKDIIRLFMLA 112
           +V KS+ILQ  R NS+    E+S    + +++   +    + E+S    +KD+ RLF LA
Sbjct: 47  SVSKSMILQQTRFNSTN---ESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLA 103

Query: 113 KRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIP----------- 161
           K +             S ++ M +P VIG +LD    +S  D  D K             
Sbjct: 104 KPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDN 163

Query: 162 --IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFF 219
             I+     +F +   +  +IG  AN GR ++L++  E++VARLR   +K  L QDA F 
Sbjct: 164 NTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFL 223

Query: 220 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTP 279
           D+++VGDLISRL SDA +V++S+T  VSDG +A++ G VG  MM  +S +L+ +++   P
Sbjct: 224 DSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIP 283

Query: 280 PVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           P+   A V+GK+IRN S+ LQ A G LT+VAEEQL+  KT+Q++  E  E+ RY   +RD
Sbjct: 284 PLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRD 343

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
           +F VG               L+G+ + L++L  G+ ++    L++GDL++FM+Y  YTG+
Sbjct: 344 VFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGS 403

Query: 400 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTR 458
           ++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G      +G  I F+DVSF YPTR
Sbjct: 404 SLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTR 463

Query: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
           P+ ++F  ++FKI PG  +C VGPSG GKST++ LLLRYY+ T G I I   +I  L+ +
Sbjct: 464 PNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLR 523

Query: 519 SLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
             R+ +G+VQQEP+L +GTI DNI Y +       K ++    K+  C  F+  FP+  +
Sbjct: 524 KYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLN 583

Query: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS 636
           T++GP GT LSGGQKQRIAIAR+ +  P+IL+LDEATSALD +SE  I  T  +  +++ 
Sbjct: 584 TIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEG 642

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKA 689
           +T +SIAHRLSTI+ S  V+VL  +GSVVE GKF EL ANPTS L+ LL+++ 
Sbjct: 643 LTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEG 695

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  530 bits (1365), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 286/621 (46%), Positives = 395/621 (63%), Gaps = 15/621 (2%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT------S 150
           SK+  +KDI RLF LA+ + +           S S+ M++P +IG +LD  K        
Sbjct: 89  SKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEE 148

Query: 151 SGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKK 210
             S      I  F L   +F +   V  L+G  AN GR I+L++  ER+VARLR   +K 
Sbjct: 149 EDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKA 208

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQL 270
            L QDA F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I G VG GMM  LS +L
Sbjct: 209 ALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKL 268

Query: 271 SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 330
           + +++   PP+   A V+G++IRN SK LQE+ G L++VAEEQL+  KT+Q++V E  E+
Sbjct: 269 TGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEI 328

Query: 331 SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAF 390
            RY   +R++F++G               L+G+++ +++L  G+ ++    L++G+L++F
Sbjct: 329 HRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSF 388

Query: 391 MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFK 449
           M+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DRKP I  TVG   K   G  I+F+
Sbjct: 389 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFE 448

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           +VSF+YP+RP+ +IF NLN +I PG  VCIVG SG GKSTIA LLLRYY+   G+I I +
Sbjct: 449 NVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGD 508

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG----LTYTPTKEEIRSVAKQCFCH 565
            DI   + +  RR IG VQQEP L +G+I DNI Y     LT     E ++   KQ  C+
Sbjct: 509 NDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCN 568

Query: 566 NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
            F+ KFP+   T++GP G  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  + 
Sbjct: 569 IFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVA 628

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            T  Q   ++ +T +SIAHRLSTI+ S  VIV+G  GSVVE G F  L  NP S L+ LL
Sbjct: 629 KTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLL 687

Query: 686 ---NEKAAPGPSDQQLQIEKV 703
              NE     PS ++ + E+V
Sbjct: 688 SQQNEHIDEDPSQEKQEPEEV 708

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  525 bits (1353), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 279/626 (44%), Positives = 398/626 (63%), Gaps = 11/626 (1%)

Query: 93  AKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSG 152
           + E SK++  KDI RLF LAK + K           S S+ M+IP +IG +LD  K  + 
Sbjct: 84  SNEVSKSNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADND 143

Query: 153 SDFFDL-----KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANV 207
            +  D      K+ IF L   +F +      L G  AN  R ++L++  ER+VARLR   
Sbjct: 144 DEDGDNNAKKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRT 203

Query: 208 IKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS 267
           +K  L+QDA F D ++VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM  +S
Sbjct: 204 MKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFIS 263

Query: 268 PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG 327
            +L+ +++   PP+   A V+G++IR  S+ LQ + G LT+VAEEQL+  +T+Q++  E 
Sbjct: 264 WKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEA 323

Query: 328 NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
            E+ RY   +R +F VG               L+G+++ +++L  G+ ++    L++GDL
Sbjct: 324 LEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDL 383

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VI 446
           ++FM+Y  YTG+++FGLS FYSE+M+GAGAA+R+FEL DRKP I PT+G+  K   G  I
Sbjct: 384 SSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSI 443

Query: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
           EF++VSF+YPTRP+  I  NL+  I PG  VCIVGPSG GKST++ LLLRYY+ +TG+I 
Sbjct: 444 EFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIK 503

Query: 507 IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL----TYTPTKEEIRSVAKQC 562
           ID Q+I + N +  RR +G+VQQEP+L +GTI DNI Y +    T T    +++   +Q 
Sbjct: 504 IDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQA 563

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
            C  F+  FP   +T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 564 NCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEE 623

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
            +     + ++   +T +SIAHRLSTI+ S  VIVL   GSVVE G F+EL     S L+
Sbjct: 624 IVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELN 682

Query: 683 QLLNEKAAPGPSDQQLQIEKVIEKED 708
            LL+++   G  + ++  E V E  D
Sbjct: 683 MLLSQQHKKGEEEMEIISESVTESND 708

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  523 bits (1347), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 286/657 (43%), Positives = 408/657 (62%), Gaps = 12/657 (1%)

Query: 36  TPSSSQLIPLSRLCLRSPAVGKSLILQSF-RCNSS-KTVPETSLPSASPISKGSARSAHA 93
           +PS+    P++ L  RSP +  S   +SF RC+ + +   +   PS +   KG   S H 
Sbjct: 21  SPSTILRYPIN-LGKRSPLI--SFQSRSFARCSIALQAAKKQGKPSLTATVKGLRLSPH- 76

Query: 94  KEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
              SK   ++DI RLF+LAK + +           S ++ M++P VIG +LD  +     
Sbjct: 77  --DSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQ 134

Query: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
              + +  IF L   +F +      ++G  AN GR ++L++  ER+VARLR   +K  L 
Sbjct: 135 PETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALE 194

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
           QDA F D+++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  +S +L+ +
Sbjct: 195 QDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCV 254

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           ++   PP+   A V+GK+IRN S+ LQ + G+LT+V+EEQLS  KT+Q++  E  E+ RY
Sbjct: 255 MMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRY 314

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              +R +F VG                +G+++ L +L  G+ ++    +++GDL++FM+Y
Sbjct: 315 ADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMY 374

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YKPDRGVIEFKDVS 452
             YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G      +   I F  V 
Sbjct: 375 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVK 434

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDI 512
           FSYPTRP   IF++LNF + PG  VCIVGPSG GKST+A LLLRYY+  +G I + N +I
Sbjct: 435 FSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNI 494

Query: 513 SKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITK 570
              N +  RR +G+VQQEP+L SGTI DNITY +      +E R      Q  C  F+  
Sbjct: 495 RDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLAN 554

Query: 571 FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQ 630
           FP+   T +GP GT LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  +  +  Q
Sbjct: 555 FPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ 614

Query: 631 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
              ++  T +SIAHR+STI+ S  VIVL   G+V E G F +L A P S+L++LL++
Sbjct: 615 -RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  521 bits (1342), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/601 (45%), Positives = 379/601 (63%), Gaps = 13/601 (2%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
            SK+  +KDI RLF+L+K + K           S S+ M++P VIG +LD    S G D 
Sbjct: 80  NSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASESDGEDE 139

Query: 156 FDLKI-PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQ 214
              K   ++     +F +      +IG  AN  R I+L++  ER+VARLR   +K  L Q
Sbjct: 140 EGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQ 199

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ ++
Sbjct: 200 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 259

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY 
Sbjct: 260 MILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 319

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R++F +G               L+G+ + L++L  G+ ++    +++G+L++FM+Y 
Sbjct: 320 KEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYA 379

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFK 449
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G        KP    I FK
Sbjct: 380 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----IVFK 435

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           +VSF+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I   +
Sbjct: 436 NVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGD 495

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNF 567
           +DI   N +  RR IG VQQEP+L +GTI DNI Y +        + IR    +  C  F
Sbjct: 496 EDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKF 555

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   
Sbjct: 556 LANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKN 615

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
             Q    +  T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L A P S L+ LL E
Sbjct: 616 L-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAE 674

Query: 688 K 688
           +
Sbjct: 675 Q 675

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  521 bits (1341), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 287/651 (44%), Positives = 404/651 (62%), Gaps = 26/651 (3%)

Query: 57  KSLILQSFRCNS----SKTVPETSLPSASPISKGSARSAH----AKEQSKTDDYKDIIRL 108
           K+++    R NS     K +   S+   S I++G A +      +   SK+  +KDI RL
Sbjct: 33  KTIVCPKVRLNSIISHKKALLSQSIRLQSSIAEGKASTKPTLKLSDANSKSSGFKDIKRL 92

Query: 109 FMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF----DLKIPIFS 164
           F+L++ + K           S S+ M++P VIG +LD    S   +      D K+  + 
Sbjct: 93  FVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEEDEEKARDSKL--YG 150

Query: 165 LPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
           L   +F +   +  +IG  AN  R I+L+I  ER+VARLR   +K  L QDA F D ++V
Sbjct: 151 LTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDTNRV 210

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
           GDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ +++   PP+   
Sbjct: 211 GDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAM 270

Query: 285 ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
           A V+GK+IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY   +R++F +G
Sbjct: 271 ALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIG 330

Query: 345 XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                          L+G+ + L++L  G+ ++    ++IG+L++FM+Y  YTG+++FGL
Sbjct: 331 LKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGL 390

Query: 405 STFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDVSFSYPTRP 459
           S+FYSE+M+GAGAA+R+FEL DRKP I PT+G       +KP    + FK+VSF+YPTRP
Sbjct: 391 SSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKP----VVFKNVSFTYPTRP 446

Query: 460 SVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKS 519
             QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I  D++D+   N + 
Sbjct: 447 KHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRK 506

Query: 520 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDT 577
            RR IG VQQEP+L +GTI DNI Y +     + E R     +Q  C  F+  FP+   T
Sbjct: 507 YRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQT 566

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
           ++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q    + +
Sbjct: 567 MVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKNL-QKRVERGL 625

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEK 688
           T +SIAHRLSTI+ S  +IVLG  GSVVE G F++L A P S L+ LL E+
Sbjct: 626 TTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALLAEQ 676

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  519 bits (1337), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 267/609 (43%), Positives = 383/609 (62%), Gaps = 16/609 (2%)

Query: 95  EQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD 154
           ++S    +KD+ RLF LA+ +             S ++ M +P VIG +LD  K  S  +
Sbjct: 90  DESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADE 149

Query: 155 FF------------DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVAR 202
                         D    I+ L   +F +   V   +G  AN GR I+L++  ER+VAR
Sbjct: 150 ENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVAR 209

Query: 203 LRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 262
           LR   +K  L Q+A F D++KVGDLISRL +DA +V++S+TQ VSDG +A++ G VG GM
Sbjct: 210 LRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGM 269

Query: 263 MCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           M  +S QL+ ++L   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q+
Sbjct: 270 MSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQA 329

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           +  E  E+ RY   +R++F +G               L+G+ + L++L  G+ ++    L
Sbjct: 330 YGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGAL 389

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD 442
           ++G+L++FM+Y  YTG+++FGLSTFYSE+M+GAGAA+R+FEL+DRKP+I PT+G      
Sbjct: 390 TVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITL 449

Query: 443 RG-VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
            G  +EFK+VSF YPTRP  QIF++ + KI PG  VC VGPSG GKST++ LLLRYY+  
Sbjct: 450 FGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVA 509

Query: 502 TGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE--EIRSVA 559
            G+I +  +DI   + +  RR +G+VQQEP+L +GTI +NI Y +      E   I    
Sbjct: 510 KGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAI 569

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           +   C  F+  FP+  +T++GP GT LSGGQKQRIA+AR  +  P+ILILDEATSALD +
Sbjct: 570 ESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQ 629

Query: 620 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
           SE  I     Q    K  T +SIAHRLSTI+ S  V+VLG +G VVE G F+EL +NP+S
Sbjct: 630 SEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSS 688

Query: 680 ALSQLLNEK 688
            L+ LL ++
Sbjct: 689 GLNILLTQE 697

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  518 bits (1333), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 292/665 (43%), Positives = 407/665 (61%), Gaps = 35/665 (5%)

Query: 44  PLSRLCLRSPAVGKSLILQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYK 103
           P+ R+  R PA+   L LQ+ R N+S    + +L +   +      S H    SK   +K
Sbjct: 52  PIPRIQTRPPALSHQL-LQARRLNTSTEQDQKTLQTLKTLKL----SPH---DSKASGFK 103

Query: 104 DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK-------TSSG---- 152
           DI RLF+LAK +             S ++ M+IP VIG +LD  K       ++SG    
Sbjct: 104 DIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVG 163

Query: 153 -SDFFDLKIP-----IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAN 206
            SD  D +       I+ L   +F +      ++G  AN GR +LL++  E++VARLR  
Sbjct: 164 SSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTR 223

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            +K  L QDA F DN++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  +
Sbjct: 224 TMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFI 283

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           S +L+ ++    PP+   A V+GK+IRN S+ LQ + G LT+VAEEQLS  +TVQ++  E
Sbjct: 284 SWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGE 343

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ RY   +R++F +G                +G+++ L +L  G+ ++    +++GD
Sbjct: 344 KQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGAITVGD 403

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-V 445
           L++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G      +G  
Sbjct: 404 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKT 463

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           IEF++V+F+YPTR   +IF  L+  I PG  VCIVGPSG GKSTIA LLLRYY+   G I
Sbjct: 464 IEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRI 523

Query: 506 TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCF 563
            I  QDI + N +  RR +G+VQQEP+L +GTI DNITY +      ++ R      Q  
Sbjct: 524 AIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVSRAIGQAN 583

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
           C  F+  FP+  +T++GP G  +SGGQKQRIA+ARA +  P +LILDEATSALD +SE  
Sbjct: 584 CTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEV 643

Query: 624 INYTFGQLMKSKSM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680
           +     Q ++S+S    T VSIAHRLSTI+ S  VIVL   G V E G F+EL ++P S 
Sbjct: 644 V----AQSLRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISDPDSH 699

Query: 681 LSQLL 685
           L+QLL
Sbjct: 700 LTQLL 704

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  515 bits (1327), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 274/620 (44%), Positives = 387/620 (62%), Gaps = 14/620 (2%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGSD 154
           SK+  +KDI RLF+L+K + K           S S+ M++P VIG +LD  +       +
Sbjct: 81  SKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKE 140

Query: 155 FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQ 214
                  ++ L   +F +   +  +IG  AN  R I+L++  ER+VARLR   +K  L Q
Sbjct: 141 EKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQ 200

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ ++
Sbjct: 201 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 260

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY 
Sbjct: 261 MVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 320

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R++F +G               L+G+ + L++L  G+ ++    +++G+L++FM+Y 
Sbjct: 321 KEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYA 380

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFK 449
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G        KP    I FK
Sbjct: 381 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----IVFK 436

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           +VSF+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+  +G+I   +
Sbjct: 437 NVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGD 496

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNF 567
           +DI   N +  RR IG VQQEP+L +GTI DNI Y +     ++E R      Q  C  F
Sbjct: 497 EDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKF 556

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +  FP+   T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   
Sbjct: 557 LANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKN 616

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
             Q    + +T +SIAHRLSTI+ S  V+VLG  GSVVE G F++L A P S L+ LL E
Sbjct: 617 L-QRRVERGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLAE 675

Query: 688 KAAPGPSDQQLQIEKVIEKE 707
           +      +    +++ I +E
Sbjct: 676 QQDEEQKEGTADLDRGITQE 695

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  513 bits (1322), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 274/623 (43%), Positives = 388/623 (62%), Gaps = 18/623 (2%)

Query: 81  SPISKGSARSAHAKEQSKTD-------DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIG 133
           +P++  S  S  A +++K          +KDI RLF LAK +             S ++ 
Sbjct: 62  APVNVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVS 121

Query: 134 MSIPKVIGIVLDTLKTSSGSDFFDLKI---PIFSLPLYEFLSFFTVALLIGCAANFGRFI 190
           M+IP ++G +LD  K    +D          IF +   +F +      L+G AAN GR +
Sbjct: 122 MTIPTIVGKLLDIAKDRKDADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIV 181

Query: 191 LLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGV 250
           +L+I  ER+VARLR   +K  L QDA F D ++VGDLIS L SDA +V++S+TQ VSDG 
Sbjct: 182 ILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGT 241

Query: 251 KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           +A+I G VG GMM  +S QL+ +++   PP+   A V+G++IRN S+ LQ + G LT+V+
Sbjct: 242 RAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVS 301

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
           EEQL  +KT+QS+V E  E+ RY   +R++F +G               L+G++S L +L
Sbjct: 302 EEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALL 361

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS 430
             G+ ++    +++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP 
Sbjct: 362 MVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPL 421

Query: 431 ISPTVGHK-YKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
           I PT+G          I F++VSF+YPTR + +IF  L+  + PG  VCIVGPSG GKST
Sbjct: 422 IPPTIGQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKST 481

Query: 490 IALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
           +A LLLRYY+   G I I + +I+  N +  RR +GIVQQEP L +GTI DNI Y  T  
Sbjct: 482 VASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILY--TVP 539

Query: 550 PTKEE----IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPT 605
           P + +    I +   Q  C  F+  FP+   T++GP G  LSGGQKQRIA+ARA +  P+
Sbjct: 540 PERADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPS 599

Query: 606 ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +LILDEATSALD +SE  +  T  ++   + +T +SIAHRLSTI+    V+VLG  G VV
Sbjct: 600 LLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVV 658

Query: 666 EMGKFKELYANPTSALSQLLNEK 688
           E G F+EL  NP S LS LL+++
Sbjct: 659 ESGPFEELLRNPLSELSILLSQQ 681

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  512 bits (1319), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 282/626 (45%), Positives = 394/626 (62%), Gaps = 25/626 (3%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 156
           SK+  +KDI RLF+L++ +             S S+ M++P VIG +LD        +  
Sbjct: 80  SKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA 139

Query: 157 ----DLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTL 212
               D K+  + L   +F +      LIG  AN  R I+L++  ER+VARLR   +K  L
Sbjct: 140 KETKDNKL--YGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAAL 197

Query: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI 272
            QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ 
Sbjct: 198 DQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTC 257

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           +++   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ R
Sbjct: 258 VMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRR 317

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           Y   +R++F VG               L+G+ + L++L  G+ ++    +++G+LT+FM+
Sbjct: 318 YAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMM 377

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIE 447
           Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT+G       +KP    I 
Sbjct: 378 YAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP----IV 433

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI 507
           FKDVSF+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+ + G+I  
Sbjct: 434 FKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDF 493

Query: 508 DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFC 564
            ++DI   N +  RR +G VQQEP+L +GTI DNI Y +     ++E R VA+   Q  C
Sbjct: 494 GDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANC 552

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             F+  FP+   T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 553 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV 612

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
                + +K + +T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L + P S L+ L
Sbjct: 613 AKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNAL 671

Query: 685 LNEKAAPGPSDQQLQIEKVIEKEDLN 710
           L E+      D + + E V  K + N
Sbjct: 672 LAEQ-----QDDEGKDETVTSKNNNN 692

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  510 bits (1314), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 273/608 (44%), Positives = 382/608 (62%), Gaps = 6/608 (0%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGSD 154
           SK   +K++ RLF LA+ + K           S ++ M+IP VIG +LD    K + G  
Sbjct: 75  SKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDG 134

Query: 155 FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQ 214
             + +  I+ L   +F +      +IG  AN GR ++L++  E++VARLR   +K  L Q
Sbjct: 135 DEEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQQ 194

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G+VG GMM  +S QL+ ++
Sbjct: 195 DAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGVM 254

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           L   PP++  A V+G++IRN +++LQ   G LT+VAEEQL+  +T+QS+  E  E+ RY 
Sbjct: 255 LLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRYA 314

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R +F+VG               L+G+++ L +L  G+ ++    +++G+L++FM+Y 
Sbjct: 315 EEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMYA 374

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YKPDRGVIEFKDVSF 453
            YTG+++FGLS+FYSE+M+GAGAASR+FEL DR P I PT G          IEFK+V F
Sbjct: 375 VYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVKF 434

Query: 454 SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
           SYP+R +  +F  LN KI PG  VC+VGPSG GKSTI+ LLLR+Y+  +G ITI  Q+I 
Sbjct: 435 SYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNIK 494

Query: 514 KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKF 571
             N +  RR +GIVQQEP+L +G+I+DNI Y L       K  +    +   C  FI+ F
Sbjct: 495 DFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISNF 554

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P+  DT++GP GT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I       
Sbjct: 555 PDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRAR 614

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAP 691
            +S  +TI SIAHR+STI  S  VIVL  +G V E G F +L   P S L++LL+++   
Sbjct: 615 SESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSKEHEL 673

Query: 692 GPSDQQLQ 699
                QL+
Sbjct: 674 QDVHDQLE 681

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  511 bits (1315), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 285/687 (41%), Positives = 410/687 (59%), Gaps = 32/687 (4%)

Query: 45  LSRLCLRSPAVGKSL-ILQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYK 103
           L +L +R+P   K L  L   R NSS        P+ +   K    +  +  +  +  ++
Sbjct: 36  LRKLAIRTPMPSKPLGSLMQARWNSSNA----KQPNTTNTDKTGQIAELSSNEKNSSGFR 91

Query: 104 DIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD--------- 154
           DI RL  LA+ +             S ++ M +P VIG +LD  K+SS S+         
Sbjct: 92  DITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDG 151

Query: 155 ----FFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKK 210
                   +  I+     +F        + G  AN GR I+L++  ER+VARLR   +K 
Sbjct: 152 DDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKA 211

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQL 270
            L QD+ F D ++VGDLISRL SD+ +V++S+TQ VSDG +A+I G VG GMM  +S QL
Sbjct: 212 ALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQL 271

Query: 271 SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 330
           + ++    PP+   A ++GK+IRN SK LQ + G LT+VAEEQL   KT+QS+V E  E+
Sbjct: 272 TCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEI 331

Query: 331 SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAF 390
            RY   +R +F +G                +G++S L +L  G+ ++    +++GDL++F
Sbjct: 332 RRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSF 391

Query: 391 MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGV-IEFK 449
           M+Y  YTG ++FGLS FYSE+M+GAGAA+R+FEL DRKP+I+PT+G      R + I FK
Sbjct: 392 MMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISFK 451

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           DVSF+YPTR + +IF +LN  I PG  +CI GPSG GKSTIA LL+RYY+   G I+I +
Sbjct: 452 DVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGD 511

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK--QCFCHNF 567
            D+   N +  RR IG+V QEPVL +GTI +NI Y +  +  ++E R  A   +  C  F
Sbjct: 512 TDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKF 571

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           ++ FP+  +T++GP G  LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  T
Sbjct: 572 LSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVART 631

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
             + ++ + +T +SIAHR+STI  S  V+VLG DG VVE G F+EL   P S L+ LL  
Sbjct: 632 LQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLL-- 688

Query: 688 KAAPGPSDQQLQIEKVIEKEDLNESKE 714
                 S QQ + E++  KE+ +E +E
Sbjct: 689 ------SLQQDEREEI--KENPSEPRE 707

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  502 bits (1293), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/713 (41%), Positives = 419/713 (58%), Gaps = 54/713 (7%)

Query: 3   NGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLILQ 62
           N RLP+LR GI      RP L     ++ RSL    +S    L+ +        ++++ Q
Sbjct: 14  NARLPILRAGI-----GRPSLL----LQVRSLHNGKTSFERQLAAMLQN-----RTIMRQ 59

Query: 63  SFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXX 122
               +S+ + P T+L S               E+  +  +KDI RLF LA+ + K     
Sbjct: 60  VRWQHSNASKPSTTLTS---------------EEQNSSSWKDIKRLFQLARPESKSMFFA 104

Query: 123 XXXXXXSCSIGMSIPKVIGIVLDTLK----TSSGSDF----------------FDLKIPI 162
                 S S+ M +P VIG ++D  K    +SS +D                  D +  I
Sbjct: 105 LVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLI 164

Query: 163 FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
             L L +F        ++G AAN GR ++L++  E++VARLR   +K  L QDA F DN+
Sbjct: 165 LGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNN 224

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVL 282
           KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM  +S +L+ +++   PP+ 
Sbjct: 225 KVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLA 284

Query: 283 FSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 342
             A V+G++IRN S+ LQ + G LT+ AEEQLS  +T+Q++  E   +  Y   +R ++Q
Sbjct: 285 VMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQ 344

Query: 343 VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 402
           VG               L+G+ + L +L  G+ ++    +++GDL++FM+Y  YTG+++F
Sbjct: 345 VGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLF 404

Query: 403 GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-YKPDRGVIEFKDVSFSYPTRPSV 461
           G+S+FYSE+M+GAGAA+R+FEL DRKP+I PT G       R  +EFK V F+YPTR   
Sbjct: 405 GMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQH 464

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLR 521
            IF++L+ +I PG  VCIVGPSG GKST+A LLLR+Y+   G I I  Q+I+  N +  R
Sbjct: 465 VIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYR 524

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCHNFITKFPNTYDTV 578
           R +GIVQQEP+L +GTI +NI Y +      EE   VA+   Q  C  F++ FP+   T+
Sbjct: 525 RLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTM 584

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           +GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  I  T      ++  T
Sbjct: 585 VGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKT 643

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAP 691
            +SIAHR+STI+ S  VIVLG +G VVE G F EL +N  S L++LL ++  P
Sbjct: 644 TISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLLRKEEEP 696

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  497 bits (1279), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 261/590 (44%), Positives = 370/590 (62%), Gaps = 5/590 (0%)

Query: 103 KDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPI 162
           KD+ RLF LA+ + K           S ++ M+IP VIG +LD  +     +  D +  +
Sbjct: 83  KDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESGDEEEAV 142

Query: 163 -FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDN 221
            + LP  +F    +    +G  AN GR ++L+   ER+VARLR   +K  L Q+  F D+
Sbjct: 143 LYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDS 202

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPV 281
           ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM  +S QL+ ++    PP+
Sbjct: 203 NRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPL 262

Query: 282 LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           +  A+ +G+++RN S++LQ   G LT+VAEEQL+  +TVQ++  E  E+ RY   +R++F
Sbjct: 263 VLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVF 322

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
            VG                +G+ + L +L  G+ ++    +S+G+L++FM+Y  YTG+++
Sbjct: 323 DVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSL 382

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-VIEFKDVSFSYPTRPS 460
           F LS+FYSE+M+GAGAA R+FEL DRKP I PT+G       G  I F  V+F+YPTRP 
Sbjct: 383 FNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRPH 442

Query: 461 VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSL 520
            Q+F  ++  I PG  VCIVGPSG GKST+A LLLR+Y+P +G+ITI  +DI   N    
Sbjct: 443 HQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKY 502

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTV 578
           RR +GIVQQEPVL + +I +NITY L    TK+  R     +   C  F+  FP    T 
Sbjct: 503 RRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTA 562

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           +GP GT LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +  T  Q  +   +T
Sbjct: 563 VGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKIT 622

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEK 688
           I SIAHR STI+ S  VIVL   G V+E G +++L  +P S+LS LL+++
Sbjct: 623 I-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSKE 671

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  496 bits (1277), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 280/662 (42%), Positives = 401/662 (60%), Gaps = 44/662 (6%)

Query: 57  KSLILQSFRCNSSKTVPETSLPSASPISKGSARSAH-----AKEQSKTDDYKDIIRLFML 111
           + L L +  C S+   P + +  +  I    A S         E+  +  +KDI RLF L
Sbjct: 34  RPLTLTTVPCKSAWVKPISLIHVSRQIRWNHAESRQPSSTLTPEEHNSSSWKDIKRLFQL 93

Query: 112 AKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK------------------TSSGS 153
           A+ + +           S S+ M +P VIG ++D  K                   + G 
Sbjct: 94  ARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGR 153

Query: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
             F L +P F    Y  L  F+V  ++G AAN GR ++L++  E++VARLR   +K +L 
Sbjct: 154 QIFGLTMPQF----YGVL--FSV-FVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQ 206

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
           QDA F DN+KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM  +S +L+ +
Sbjct: 207 QDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCV 266

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           ++   PP+   A ++GK+IRN S+ LQ + G LT+ AEEQLS  +T+Q++  E + + +Y
Sbjct: 267 MMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQY 326

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              +R ++QVG               L+G+++ L +L  G+ ++    +++GDL++FM+Y
Sbjct: 327 AKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIY 386

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG-----HKYKPDRGVIEF 448
             YTG+++FG+S+FYSE+M+GAGAA+R+FEL DR+P+I PT G        KP    +EF
Sbjct: 387 AVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGKP----VEF 442

Query: 449 KDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           ++V F+YPTR    IF+NL F+I  G  VCIVGPSG GKST+A LLLR+Y+  TG ITI 
Sbjct: 443 QNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAITIG 502

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCH 565
            Q I+  N +  RR +G+VQQEP+L +GTI DNI Y +  +   +E R VA+   Q  C 
Sbjct: 503 GQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAIGQANCS 561

Query: 566 NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
            F++ FP+   T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  + 
Sbjct: 562 AFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVA 621

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
                   ++  T +SIAHR+STI+ S  VIVLG  G VVE G F EL ++P S L+ LL
Sbjct: 622 RALYS-RSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPDSQLNLLL 680

Query: 686 NE 687
            +
Sbjct: 681 RK 682

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  478 bits (1230), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 263/616 (42%), Positives = 377/616 (61%), Gaps = 31/616 (5%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT---LKTSSG 152
            +K    +DI  LF LAK +             + ++ M +P VIG +LD    ++ +S 
Sbjct: 90  NTKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASN 149

Query: 153 SDFFD----------------LKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196
            D  D                 +  I+      F S   V  ++G  AN GR I+L++  
Sbjct: 150 KDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTG 209

Query: 197 ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
           ER+VARLR   +K  L QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I G
Sbjct: 210 ERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQG 269

Query: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            VGVGMM  +S +LS ++LF  PP+   A ++G++IRN SK LQE+ G LT+++EEQL+G
Sbjct: 270 CVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNG 329

Query: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
            +T+QS+V E  E+ +Y   +R ++ VG               L+G+ + L++L  G  +
Sbjct: 330 TRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNM 389

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
           +    LSIG L++FM+Y  YTG+++FGLS+FYSEIM+G+GAASR+FE+    P I+ T G
Sbjct: 390 ISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKG 449

Query: 437 -----HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIA 491
                 + KP    IEF+ + F+YPTR    IF++LN KI PG  VCI+GPSG GKSTI+
Sbjct: 450 IDPISFQDKP----IEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTIS 505

Query: 492 LLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYT 549
            LLLRYY+P  GTI+I  +DI + + +  R+ +G+V QEPVL +GTI +NI Y +     
Sbjct: 506 SLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIA 565

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             KE + +  +   C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +PT+L+L
Sbjct: 566 NDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVL 625

Query: 610 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
           DEATSALD  SE  +  T  Q   +K  T +SIAHR+STI+ S  V+VL   G VVE G 
Sbjct: 626 DEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGP 684

Query: 670 FKELYANPTSALSQLL 685
           ++EL     SAL++LL
Sbjct: 685 YEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  471 bits (1213), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 259/592 (43%), Positives = 362/592 (61%), Gaps = 18/592 (3%)

Query: 98  KTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFD 157
           KT  +  + +L  LAK + K           S ++ MS+P VIG ++D   T        
Sbjct: 27  KTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDA----- 81

Query: 158 LKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAE 217
              PI+ L   +FL       ++G  AN GR I+L+I  E++VARLR   +K  L QDA 
Sbjct: 82  ---PIYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDAT 138

Query: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277
           F D H+VGDLISRL SDA +VS+S+T  +SDG +A + GVVG+GMM  +S +L+ ++   
Sbjct: 139 FLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMM 198

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
            PP+   A ++G +I+  S+ LQ+  GQL++ +EEQL+ +KTVQ++  E  EL RY+  +
Sbjct: 199 VPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEV 258

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397
           R +F +G               L+G+++ + +L  G+     S +++G+L++FM+Y  YT
Sbjct: 259 RSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYT 315

Query: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG-HKYKPDRGV-IEFKDVSFSY 455
           G++VFGL+ FYSE+M+G GAA R+ EL + K  ISPT G    K  +G+ I F +VSF+Y
Sbjct: 316 GSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFAY 375

Query: 456 PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKL 515
               SV     +NF+I PG  VC VG SG GKSTI+ LLLRYY   +G I+I N DIS  
Sbjct: 376 SNGKSV--LSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAF 433

Query: 516 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
           N +  RR +G+VQQEP+L +GTI DNITYGL +  +  ++    K   C  FI +     
Sbjct: 434 NLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMGL 492

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
           DT++GP G  LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN    Q  +  
Sbjct: 493 DTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQEA 551

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            MT +SIAHRLSTIR S  VIV+  DG VVE G F +L +   S L++LL E
Sbjct: 552 GMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  216 bits (549), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 159/525 (30%), Positives = 274/525 (52%), Gaps = 38/525 (7%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISR 230
            L++G AA     NF +  LL   SE  V  LR  V++K   ++ ++F  +N+K  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  ++
Sbjct: 825  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSA 880

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN-ELSRYNVAIRDIFQVGX 345
            ++G  ++    D + +  QL     + ++ IKT++   AE + +L+ +++ I+ + Q+  
Sbjct: 881  IYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIK-MQQIAS 939

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                         +++       +  YG  LV+  + +  ++        +T  +   L 
Sbjct: 940  KRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLV 999

Query: 406  TFYSEIMQGAGAASRLFELTDRKPSI-------SPTVG---HKY--KPDRGVIEFKDVSF 453
            +   +I +G  AAS ++ + D K +        + TVG   H Y  K  + ++  ++++F
Sbjct: 1000 SQIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTF 1059

Query: 454  SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
            +YP+ P+  ++KN+NF +  G ++ I+G SG GKST+ LLL + YN   G I ID  D++
Sbjct: 1060 AYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVN 1119

Query: 514  KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
              N  SLR+ I +V+Q+P+L +GTIRDN+TYGL     + E+    K    H+F+   P 
Sbjct: 1120 DWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQ 1179

Query: 574  TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
              DT I    TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN    +++K
Sbjct: 1180 GLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVK 1233

Query: 634  SK--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
                ++  + I H    +R   ++ VL  DG VVE G F  LY N
Sbjct: 1234 KGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  183 bits (465), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 142/513 (27%), Positives = 242/513 (47%), Gaps = 37/513 (7%)

Query: 195 LSERVVARLRANVIKKTLHQD-AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA- 252
           + ER   R+R+ +++  L +   E++DN++      +L  D   ++R + +  S   +A 
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEAS 152

Query: 253 --------LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
                    IC ++G     S S  L++++L  +P + F A VF + I   S+     T 
Sbjct: 153 AITFQNLVAICALLGTSFYYSWS--LTLIILCSSPIITFFAVVFSRMIHVYSEKENSETS 210

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++    ++  + V+ +  +  E  ++   I +                     L   
Sbjct: 211 KAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLT 270

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +GS ++ + +L+I D+          G+ +         + +G  A  ++  L
Sbjct: 271 MFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTL 330

Query: 425 ----TDRKPSISPTVGHKYKPDRGV--IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
               + R P ++ TV H++  D     + F +VSFSYP+RPS  + KN++   + G    
Sbjct: 331 LKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTF 389

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTI 538
           IVG SG GKST++ LLLR+Y+   G+I+I+  +I  ++ K L  +I +V+Q   L + T+
Sbjct: 390 IVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTL 449

Query: 539 RDNITYGLT---------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
           R NI  G T             +  I+   +      FI   P+  +T+IG  G  LSGG
Sbjct: 450 RKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           Q+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQI 567

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
             S++ + L  +G VVE G   EL A+PT+  S
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADPTTTFS 599

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  206 bits (524), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 164/544 (30%), Positives = 262/544 (48%), Gaps = 26/544 (4%)

Query: 175 TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
           T+ +L   AA FG  +L   +   V A +  N I+K   Q  +      +G  +SR    
Sbjct: 162 TLTVLSYGAARFGA-VLFGEIRNAVFASVAQNAIRKVSLQTFQHLMRLDLGWHLSRQTGG 220

Query: 235 AYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQL--SILLLFFTPPVLFS 284
              ++R+M   T+ +S  + A++  ++ +    S     L+ Q   S   + F   +L+S
Sbjct: 221 ---LTRAMDRGTKGISYVLSAMVFHIIPIAFEISVVCGILTYQFGTSFAAVTFATMLLYS 277

Query: 285 ASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 342
              F      T   +    A  +   VA + L   + V+ F  E     +Y+ ++ +   
Sbjct: 278 IFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTN 337

Query: 343 VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 402
                           +L+   +   ++  G   V+   LS+GDL             + 
Sbjct: 338 SQIKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLN 397

Query: 403 GLSTFYSEIMQGAGAASRLFELTDRKPSI----SPTVGHKYKPDRGVIEFKDVSFSYPTR 458
            L + Y E+ Q       LF+L   K +I    +P +  K KP    I+F++V+F Y   
Sbjct: 398 FLGSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCE--IKFENVTFGY--H 453

Query: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
           P  +I +N NF +  G    IVGPSG GKSTI  L+ R+Y+P  G I ID +DI +L+ K
Sbjct: 454 PDRKILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLK 513

Query: 519 SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578
           SLRR IG+V Q+  L + TI +N+ +G   T T ++IR    +      I   P   +T+
Sbjct: 514 SLRRAIGVVPQDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETI 572

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           +G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T  +     S T
Sbjct: 573 VGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRT 632

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQL 698
            + IAHRL TI  ++ ++VL  +G V E GK  EL + PTS  S+L N +      ++++
Sbjct: 633 SIYIAHRLRTIADADKIVVL-ENGRVKEEGKHAELLSKPTSLYSELWNIQENLDLLEEEI 691

Query: 699 QIEK 702
           +++K
Sbjct: 692 EMDK 695

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  204 bits (518), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 174/599 (29%), Positives = 279/599 (46%), Gaps = 38/599 (6%)

Query: 138 KVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSF------------FTVALLIGCAAN 185
           KV   VL  L    GS   ++++P F   + + ++              T  +L   AA 
Sbjct: 105 KVKARVLIALSLLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSYGAAR 164

Query: 186 FGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM--- 242
           FG  +L   L   + A +  + I +   Q  +      +G  +SR       ++R+M   
Sbjct: 165 FGS-VLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGG---LTRAMDRG 220

Query: 243 TQKVSDGVKALICGV----VGVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQIRNT 295
           T+ +S  + A++  +    V +G +C  L+ Q   S   + FT  +L+S   F      T
Sbjct: 221 TKGISYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTTAWRT 280

Query: 296 S--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
              K   +A  +   VA + L   + V+ F  E    ++Y+ ++                
Sbjct: 281 EFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAF 340

Query: 354 XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
                + +   +   ++  G   V+   LS+GDL             +  L + Y E+ Q
Sbjct: 341 LNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 400

Query: 414 GAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNF 469
                  LF+L   K  I     P +    +P +  I F++VSF Y   P   I KN +F
Sbjct: 401 SLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSF 456

Query: 470 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQ 529
            +  G    IVGPSG GKSTI  L+ R+Y+P  G I +D +D+ +L+ +SLRR IG+V Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 530 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
           +  L + +I +N+ +G   + + EEIR   ++    + + + P   DT++G  G ++SGG
Sbjct: 517 DTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKED 708
             ++ +IV+   G V E GK  EL A P S  ++L N +      +++LQ E+  EK D
Sbjct: 636 ADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQEKGD 693

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  202 bits (513), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 173/570 (30%), Positives = 266/570 (46%), Gaps = 34/570 (5%)

Query: 143 VLDTLKTSSGSDFFDLKIPIF--------SLPLYEFLSFFTVAL----LIGCAANFGRFI 190
           VL  L    GS   ++++P F        ++   +  S   +A+    L   AA FG  +
Sbjct: 138 VLIALGLLVGSKLLNVQVPFFFKQIVDSMNIEWTDATSVLPIAIGSMILSYGAARFGS-V 196

Query: 191 LLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM---TQKVS 247
           L   L   + A +  + I +   Q  +      +G  +SR       ++R+M   T+ +S
Sbjct: 197 LFGELRNAIFASVGQSAITRVSLQTFQHLMKLDLGWHLSRQTGG---LTRAMDRGTKGIS 253

Query: 248 DGVKALICGV----VGVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQIRNTS--KD 298
             + A++  +    V +G +C  L+ Q   S   + F+  +L+S   F      T   K 
Sbjct: 254 YVLSAMVFHIIPITVEIGAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKS 313

Query: 299 LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 358
             +A  +   VA + L   + V+ F  E    ++Y+ ++                     
Sbjct: 314 ANKADNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQ 373

Query: 359 SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           +L+   +   ++  G   V+  +LS+GDL             +  L + Y E+ Q     
Sbjct: 374 NLIFTSALTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDM 433

Query: 419 SRLFELTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS 476
             LF+L   K SI  +      P      I FK+VSF Y   P   I KN +F I  GS 
Sbjct: 434 ESLFQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSK 491

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSG 536
             IVGPSG GKSTI  L+ R+Y+P  G I +D +D+ +L+ +SLRR IG+V Q+  L + 
Sbjct: 492 TAIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNE 551

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
           +I DN+ +G     T +EI     +      I + P   DT++G  G ++SGG+KQR+AI
Sbjct: 552 SIWDNVKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAI 610

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
           AR L+K   I+  DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ +I
Sbjct: 611 ARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKII 670

Query: 657 VLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           VL H G V E GK  EL A P S  ++L N
Sbjct: 671 VLEH-GRVKEEGKHAELLATPKSLYAELWN 699

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  201 bits (510), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 160/560 (28%), Positives = 264/560 (47%), Gaps = 34/560 (6%)

Query: 175 TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
           T+ +L   AA FG  ++   L   V A++  N I+K   Q  +      +G  +SR    
Sbjct: 175 TMTILSYGAARFGA-VMFGELRNAVFAKVAQNAIRKVSLQTFQHLMKLDLGWHLSRQTGG 233

Query: 235 ------------AYVVSRSMTQKVSDGVK-ALICGVVGVGMMCSLSPQLSILLL---FFT 278
                       +YV+S  +   +    + +++CG++      S +    + +L   FFT
Sbjct: 234 LTRAMDRGTKGISYVLSAMVFHMIPITFEISVVCGILTYQFGSSFAAMTFVTMLLYSFFT 293

Query: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
               F  + +  + R ++     A  +   VA + L   + V+ F  E    ++Y+ ++ 
Sbjct: 294 ----FKTTAWRTEFRRSA---NRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLS 346

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                               + +   +   ++  G+  V++  L++GDL           
Sbjct: 347 KYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYMGASGVMEGALTVGDLVLINQLVFQLS 406

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDR----KPSISPTVGHKYKPDRGVIEFKDVSFS 454
             +  L + Y E+ Q       LF+L       K +  P +  ++ P    I+F++V+F 
Sbjct: 407 VPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCE--IKFENVTFG 464

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
           Y  +P   I KN  F IAPG    IVGPSG GKSTI  L+ R+Y+P  G I +D +DI +
Sbjct: 465 Y--QPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRE 522

Query: 515 LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
           L+   LRR +G+V Q+  L + TI +N+ +G     T  EI +  ++    + I K P  
Sbjct: 523 LDLDELRRIVGVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKG 581

Query: 575 YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
            +T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +    
Sbjct: 582 TETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSD 641

Query: 635 KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPS 694
            + T V IAHRL TI  ++ +IVL  +G+V E G    L ANP S  S+L N +      
Sbjct: 642 VAKTSVYIAHRLRTIADADKIIVL-ENGAVREEGTHNALLANPNSLYSELWNIQENLDML 700

Query: 695 DQQLQIEKVIEKEDLNESKE 714
           + +L+ E  +EKE     K+
Sbjct: 701 EDELEDELKLEKEPRTSKKD 720

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  203 bits (516), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 152/520 (29%), Positives = 250/520 (48%), Gaps = 58/520 (11%)

Query: 185  NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISR----------LG 232
            NF ++ L    SE  + +LR  V+++   ++ ++F  + HK  ++ +           L 
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 233  SDAYVVSRSMTQKVSDGV-KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQ 291
            SD  +   S     S G+  ALI G            +LS++ +   P ++  ++V+G  
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGW-----------KLSLVCISMFPLIVIFSAVYGMA 858

Query: 292  IRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN--------VAIRDIFQV 343
            ++      + A   L  +  E  +GIKT++    E N L +Y         +A R     
Sbjct: 859  LQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITT 918

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLYTEYTGNA 400
            G              ++L          Y   LV+  Q +   +      +L+T  T N 
Sbjct: 919  GLGVAVIEALAMSIQAIL--------FYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNI 970

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG-------VIEFKDVSF 453
               L +   +I +G  AA+R+ ++ D K         K +   G       VI  ++V+F
Sbjct: 971  ---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTF 1027

Query: 454  SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
            +YP+ PS+ IF +L  ++  G +  +VG SG GKST+  LL + Y PT+GT+ ++N+D++
Sbjct: 1028 AYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVN 1087

Query: 514  KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
            + N + LRR + +V+Q P + SGT+R+N+ YGL + P + E+  V +    H+FI+K P 
Sbjct: 1088 EWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPL 1147

Query: 574  TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
              DT I     LLSGGQ QR+ IARA++K+P ILILDE TSALD  S   IN    +   
Sbjct: 1148 GLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR--G 1203

Query: 634  SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
              +   +SI H +  ++  + +I L  +G V   G F  L
Sbjct: 1204 CPAPLTISITHNVDMMKACDEIIFL-KNGRVAGTGSFDAL 1242

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 125/512 (24%), Positives = 243/512 (47%), Gaps = 47/512 (9%)

Query: 194 ILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVV--SRSMTQKVSDGV- 250
           +L ER    +R  ++ K L    E++D  K  D+          V  +R+   + S  + 
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 251 KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           ++L+  +  +G     S  L+++ L   P ++     F ++++  +    E T + +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
           +  ++  + ++    E  E+  +   +++                     L    F+   
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAF 261

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD-RKP 429
            +GS ++ + +++IGD+                ++ F+S I+ G+  +  L +L   +K 
Sbjct: 262 WFGSTMIRKGKMNIGDV----------------ITCFHSCILLGSTISGTLQQLVIIQKG 305

Query: 430 SISPTVGHKYKPD-------------------RGVIEFKDVSFSYPTRPSVQIFKNLNFK 470
           S++  +  K+  D                   +G I F++V FSYP+RP   + ++++  
Sbjct: 306 SVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLN 365

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQE 530
              G +  ++G SG GKS+++ LLL++Y   TG I++D ++I  ++   L ++I +V+Q 
Sbjct: 366 FRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQR 425

Query: 531 PVLMSGTIRDNITYGLTYTPTKE---EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
             + +GT+++NI  G+     +E   +++ V +     NFI    +  +T+IG  G  LS
Sbjct: 426 CNVFNGTLKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLS 485

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 647
           GGQ+Q++AIARAL+K P ILILDE+ SALDV   G I        K K+  I++  H L+
Sbjct: 486 GGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELN 543

Query: 648 TIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            I  S +   L   G  +E G  + L  +P++
Sbjct: 544 QI-GSNDFCYLIESGQCIEHGLEETLVNDPST 574

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 223/456 (48%), Gaps = 11/456 (2%)

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           +++CG++      S + +++ + +          + +  Q R   +D  +A  +   +A 
Sbjct: 261 SVVCGILTHQFGASFA-EITFMTMLLYSIFTIKTTAWRTQFR---RDANKADNKGASIAL 316

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
           + L   + V+ F  E    S+YN A+ D                   +L+   +   ++ 
Sbjct: 317 DSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNSGQNLIFTTALTGMMY 376

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            G   V+   L++GDL             +  L + Y E+ Q       LF+L   +  I
Sbjct: 377 LGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEVKI 436

Query: 432 SPTVGHK--YKPDRGV-IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
                 K   K D    I F++V+F Y      +I KN +F I  G    IVGPSG GKS
Sbjct: 437 HNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVGPSGSGKS 494

Query: 489 TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           TI  L+ R+Y+P  G I I+  D+ ++   SLR+ IG+V Q+  L + +I +N+ +G   
Sbjct: 495 TILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWENVKFG-RI 553

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
                EI  V ++    + I K P +Y+T++G  G ++SGG+KQR+AIAR L+K  +++ 
Sbjct: 554 DALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLLKDASVMF 613

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            DEATSALD  +E A+  T     K+ S T + IAHRL TI  ++ +IVL  DG+V E G
Sbjct: 614 FDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-EDGTVREEG 672

Query: 669 KFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVI 704
              EL A  TS   +L N +      +++++IEK I
Sbjct: 673 THNELLAKSTSLYKELWNVQENLDLIEREIEIEKDI 708

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  196 bits (499), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 153/526 (29%), Positives = 260/526 (49%), Gaps = 44/526 (8%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  ++ K   ++  +F  +++K  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  ++
Sbjct: 826  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSA 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+   + + Q+   
Sbjct: 882  IYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFG 403
                        +++       +  YG  LVL  + +   + +    +L+T  +  ++ G
Sbjct: 942  RAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVG 1001

Query: 404  LSTFYSEIMQGAGAASRLFELTD-------------RKPSISPTVGHKYKPDRGV--IEF 448
                  +I +G  AAS ++ + D             R   IS   G +Y  DR +  I  
Sbjct: 1002 Q---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDIS---GAEYYGDRNIPIISI 1055

Query: 449  KDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
            +++SF+YP+ P+V IFK+++  +    ++ IVG SG GKST+ALLL R YN    +I ID
Sbjct: 1056 RNLSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIID 1115

Query: 509  NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
              D++  N  SLR+ I +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+
Sbjct: 1116 GTDVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFV 1175

Query: 569  TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
               P   DT +  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN   
Sbjct: 1176 ASLPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIV 1233

Query: 629  GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             +      +  + I H    +R   ++ VL H G VVE G F  LY
Sbjct: 1234 RK--GPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY 1276

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 122/460 (26%), Positives = 205/460 (44%), Gaps = 51/460 (11%)

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           IC ++G     S S  L++++L  +P +   A +F + I   ++     T    ++    
Sbjct: 163 ICALIGTSFYYSWS--LTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWS 220

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           ++  + V+ +  +  E  ++   I                       L    F+    +G
Sbjct: 221 MNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFG 280

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--------- 424
           S ++ + +L+I D+                ++ F+S IM G+   S L ++         
Sbjct: 281 STMIRKGKLNINDV----------------ITCFHSCIMLGSTLNSTLHQIVVLQKGEVA 324

Query: 425 ---------TDRKPSISPTVGHKYKP---DRGVIEFKDVSFSYPTRPSVQIFKNLNFKIA 472
                    +  K + S T  H   P       + F++VSF+YP+RPS  + +N+N K  
Sbjct: 325 LQKIMALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFP 384

Query: 473 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPV 532
            G    IVG SG GKSTI+ LLL +Y+   G+I I+ ++   +  K L  +I +V+Q   
Sbjct: 385 SGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCT 444

Query: 533 LMSGTIRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
           L + T++ NI  G T +    +         I+   +       I   P+  +T+IG  G
Sbjct: 445 LFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGG 504

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
             LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  
Sbjct: 505 VSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT-- 562

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQ 683
           H LS I   +++ V+  +G VVE G   EL A+  +  S+
Sbjct: 563 HELSQIESDDHLYVM-QEGRVVESGIQSELLADSATTFSK 601

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  190 bits (482), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 191/716 (26%), Positives = 326/716 (45%), Gaps = 55/716 (7%)

Query: 17  MLSRP-RLAKLPSIRFR-SLVTPSSSQLIPLSRLCLRSP----AVGKSLILQSFRCNSSK 70
           +LSRP  + ++   +FR SL    S  ++ +S+L  + P    ++G  L  ++ +  +SK
Sbjct: 3   LLSRPPMVGRILRSKFRPSLSRNCSPIILAVSKLSTQRPLLFNSIGSKLWNETQKDLASK 62

Query: 71  TVPETSLPSASPISKGSARS-AHAKEQSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXS 129
            + E  +PS +P +K   +    A   S+    KD+ R ++  K + K            
Sbjct: 63  KLIE--IPSTAPKAKAQVKKVGKAPTLSELRILKDLFR-YIWPKGNNKVRVRVLIALGLL 119

Query: 130 CS---IGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANF 186
            S   + + +P      +D++  +          P  +LP    L+  +  +     A F
Sbjct: 120 ISAKVLNVQVPFFFKQTIDSMNITWDD-------PTVALPAAIGLTIISYGV-----ARF 167

Query: 187 GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM---T 243
           G  +L   L   V A++  N I+    Q  +      +G  +SR       ++R+M   T
Sbjct: 168 GS-VLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGG---LTRAMDRGT 223

Query: 244 QKVSDGVKALICGVVGVGMMCS-----LSPQLSILLLFFTPPVLFSASVFGKQIRNTS-- 296
           + +S  + A++  ++ +    S     L+ Q        T   +   S+F   I+ T+  
Sbjct: 224 KGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIF--TIKTTAWR 281

Query: 297 ----KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
               +D   A  +   VA + L   + V+ F  E    S+YN ++ +             
Sbjct: 282 THFRRDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLA 341

Query: 353 XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                 +L+   +   ++  G   V+   L++GDL             +  L + Y ++ 
Sbjct: 342 FLNSGQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 401

Query: 413 QGAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLN 468
           Q       LF+L   +  I     P +  ++ P    I F++V+F Y   P  +I KN +
Sbjct: 402 QSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPYE--ITFENVTFGY--HPDRKILKNAS 457

Query: 469 FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQ 528
           F I  G    IVG SG GKSTI  L+ R+Y+P +G I I+ +DI + +  +LRR IG+V 
Sbjct: 458 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVP 517

Query: 529 QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSG 588
           Q+  L + TI +N+ +G     T EE+++  ++      I K P  ++T++G  G ++SG
Sbjct: 518 QDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISG 576

Query: 589 GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 648
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S T V IAHRL T
Sbjct: 577 GEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRT 636

Query: 649 IRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVI 704
           I  ++ +IVL  +G+V E GK  EL A P S   +L   +      + +L+ E+ +
Sbjct: 637 IADADKIIVL-DNGTVKEDGKHIELLATPGSLYRELWTIQEDLSHLENELKDEQAL 691

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  188 bits (478), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 158/527 (29%), Positives = 248/527 (47%), Gaps = 28/527 (5%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   V AR+  N I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++ +    S     L+ Q   S   + F+  +L+
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S          T   +D  +A  +   VA + L   + V+ F  E     +YN ++    
Sbjct: 270 SMFTIKTTAWRTKFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYR 329

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   V+   L++GDL             +
Sbjct: 330 DSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPL 389

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPT 457
             L + Y ++ Q       LF+L   +  I     P +  ++ P    I F++V+F Y  
Sbjct: 390 NFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYD--ITFENVTFGY-- 445

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
            P  +I KN +F I  G    IVG SG GKSTI  L+ R+Y+P +G I I+ +DI + + 
Sbjct: 446 HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDI 505

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +DT
Sbjct: 506 NALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDT 564

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
           ++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S 
Sbjct: 565 IVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSR 624

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
           T V IAHRL TI  ++ +IVL  +G V E GK  EL A P S   +L
Sbjct: 625 TSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLATPNSLYREL 670

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  191 bits (485), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 138/508 (27%), Positives = 249/508 (49%), Gaps = 24/508 (4%)

Query: 183  AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 240
             +NF +  +L   SE  +  LR   +++   +  E+F  + +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
             ++Q +S     L   +VG+    +   +LS++ +   P ++  + ++G  ++N     +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 301  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
                 L  +  E ++G+KT++    + +    Y+    ++ Q+               + 
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 361  LGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGA 417
            +       +  YG  LV+  + S   +      +L+T  T N+   L +   +I +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 418  ASRLFELTD-----RKPSISP------TVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKN 466
            AS ++ + +     ++ +I+         G K    + ++   ++ F+YPT   V I+ N
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGI 526
            L+  +  G +V IVG SG GKST+  LL + Y      I ID  D+++ + ++LRR I +
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            V+Q+PVL  GT+R+N+ YGL ++P + +I  + K    ++FI   P   +T +    +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLI 1177

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 646
            SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN    +     S+  +SI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 647  STIRRSENVIVLGHDGSVVEMGKFKELY 674
              +R    V VL  DG + E G F +L+
Sbjct: 1236 QMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 155/628 (24%), Positives = 272/628 (43%), Gaps = 76/628 (12%)

Query: 96  QSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
           + K   +K+ I +++  KRDW            +  +      + G V D LK     DF
Sbjct: 3   KKKVSVWKENIYMYVQFKRDWLLIATMVLTTIANGLVPAVTSILTGKVFDLLK-----DF 57

Query: 156 FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRANVIKK 210
            D  IP     LY  L   +++L+   A  F   I   I       E     +R  ++  
Sbjct: 58  ADPNIPK-DHNLYHQLVLRSMSLMALAACAFP-LIWTSISTWMSFGEGQGFTVRYRMLNS 115

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---- 266
            L +  E++D  +       L  D   ++R + +  +   +A    +  +  M SL    
Sbjct: 116 YLDKSMEWYDKKE------NLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSLIGVS 169

Query: 267 ---SPQLSILLLFFTPPVLFSASVFGKQIR------NTSKDLQE-------ATGQLTRVA 310
              S  L++++L  TP ++  A +F + I+      NT   L          + Q+ +++
Sbjct: 170 FYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLS 229

Query: 311 EEQLSGIKTVQSFVAEGNE----LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
             QL  I++ +    + N+    LS Y  A                        L    F
Sbjct: 230 CTQLKEIESFEELTLKCNDYFIKLSLYVAA-----------------NISTLRFLSLAMF 272

Query: 367 LTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           +    +G+  + +  L+I D +T F   L    T N   G   F    +Q    A R  +
Sbjct: 273 VQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKIQ 328

Query: 424 --LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
             L D K  I  +   +    +  I F+ VSFSYP+RP+  +  +++     G +  IVG
Sbjct: 329 SFLNDNKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVG 388

Query: 482 PSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN 541
            SG GKST++ LLL+ Y+   G I+I +  I +++ + L ++I +V+Q   L + T+ +N
Sbjct: 389 RSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNN 448

Query: 542 ITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
           I  G      +    +++++   K     + I    N  DT++G  G  LSGGQ+QR+A+
Sbjct: 449 ILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVAL 508

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
           ARA ++   +LILDEA SALD+     +     +  + ++  I++  H LS I   + + 
Sbjct: 509 ARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYLY 566

Query: 657 VLGHDGSVVEMGKFKELYANPTSALSQL 684
           V+  +G ++E G   +L  +P SA  ++
Sbjct: 567 VV-EEGRIIESGFQGQLMYDPDSAFCRM 593

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 153/524 (29%), Positives = 244/524 (46%), Gaps = 33/524 (6%)

Query: 183 AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242
           AA FG  +L   L   + A++  N IK    Q    FD+    DL   L      ++R+M
Sbjct: 180 AARFGA-VLFGELRNAIFAKVAQNTIKTISLQT---FDHLMKLDLGWHLSRQTGGLTRAM 235

Query: 243 ---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQI 292
              T+ +S  + A+I  ++     + ++C  L+ Q   S   + FT  +L+         
Sbjct: 236 DRGTKGISYVLTAMIFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYGIFTLRTTA 295

Query: 293 RNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXX 350
             T   +   +A  +   +A + L   + V+ F  E    S+YN +++   +        
Sbjct: 296 WRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQS 355

Query: 351 XXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSE 410
                   +L+   +   ++  G   +L   LS+GDL             +  L + Y +
Sbjct: 356 LAFLNSGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRD 415

Query: 411 IMQGAGAASRLFEL--------TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ 462
           + Q       LF+L         ++ P+I       +      IEFK+V+F Y   P+ +
Sbjct: 416 LKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFN-----IEFKNVTFGYD--PNRK 468

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
           I +N +F I  G    +VGPSG GKSTI  L+ R+Y+P  G + ++  D+   +  SLRR
Sbjct: 469 ILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRR 528

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
            IG+V Q+  L + TI +N+ +G   T T E+I +  ++      I K P  Y+T++G  
Sbjct: 529 AIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGER 587

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
           G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T        S T V I
Sbjct: 588 GLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYI 647

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           AHRL T+  S+ +IVL  +GS+ E G    L + P S    L N
Sbjct: 648 AHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 158/527 (29%), Positives = 248/527 (47%), Gaps = 28/527 (5%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   V AR+  N I+    Q         +G  +SR   
Sbjct: 157 IGLTILCYGTARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFRHLMKLDLGWHLSRQTG 215

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++ +    S     L+ Q   S   + F+  +L+
Sbjct: 216 G---LTRAMDRGTKGISYVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 272

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S          T+  +D   A  +   VA + L   + V+ F  E     +YN ++ +  
Sbjct: 273 SMFTIKTTAWRTNFRRDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYR 332

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   V+   L++GDL             +
Sbjct: 333 DSQIKVSQSLAFLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPL 392

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSIS----PTVGHKYKPDRGVIEFKDVSFSYPT 457
             L + Y E+ Q       LF+L   +  I     P +  ++ P    I F++V+F Y  
Sbjct: 393 NFLGSVYRELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYD--ITFQNVTFGY-- 448

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
            P  +I KN +F I  GS   IVG SG GKSTI  L+ R+Y+P +G I I+ +DI + + 
Sbjct: 449 HPDRKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDI 508

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  ++T
Sbjct: 509 DALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNT 567

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
           ++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S 
Sbjct: 568 IVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSR 627

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
           T V IAHRL TI  ++ +IV   +G V E GK  EL A P S   +L
Sbjct: 628 TSVYIAHRLRTIADADKIIVF-DNGKVREEGKHLELLATPGSLYREL 673

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  188 bits (478), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 145/522 (27%), Positives = 252/522 (48%), Gaps = 36/522 (6%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  +++K   ++  +F  +N+K  ++ + 
Sbjct: 766  VVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  + 
Sbjct: 826  VMNDL----RDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSV 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+     +  +   
Sbjct: 882  IYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLST 406
                        +++       +  YG  LV+  + +   + A      +T  +   L  
Sbjct: 942  RAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVG 1001

Query: 407  FYSEIMQGAGAASRLF----------ELTDRKPSISPTVGHKY--KPDRGVIEFKDVSFS 454
               +I +G  AAS ++          E+ D    +    G  Y    ++ ++  ++++F+
Sbjct: 1002 QIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFA 1061

Query: 455  YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
            YP+ P++ I+K ++  +  G +V IVG SG GKST+ LLL   Y    G I ID  D++ 
Sbjct: 1062 YPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVND 1121

Query: 515  LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
             N  SLRR I +V+Q+P L  G+IRDN+TYG        E+    K    ++F+   P +
Sbjct: 1122 WNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQS 1181

Query: 575  YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
             DT I  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN     ++K 
Sbjct: 1182 LDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKK 1235

Query: 635  K--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
               ++  + I H    +R   +V+V   DG +VE G F  LY
Sbjct: 1236 GPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLY 1276

 Score =  160 bits (405), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 210/445 (47%), Gaps = 21/445 (4%)

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           IC ++G     S S  L++++L  +P +   A  F + I   +K     TG+  ++    
Sbjct: 163 ICALIGTSFFYSWS--LTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLTWS 220

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           ++  + V+ +  +  E  ++   + +                     L    F+    +G
Sbjct: 221 MNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVLRFLTLTMFVQGFWFG 280

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP--SI 431
           S ++ + +L+I D+          G  +         + +G  A  ++  L +  P  + 
Sbjct: 281 STMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGPKRNT 340

Query: 432 SPTVGHKYKP----DRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
           S T+   Y+P      G + F++VSF+YP+RP+  I +N   K   G    IVG SG GK
Sbjct: 341 SNTI-ELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSGSGK 399

Query: 488 STIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
           STI+ LLL++Y+   G+I+I+ ++I  +  KSL  +I +V+Q   L + T+++NI  G T
Sbjct: 400 STISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILLGST 459

Query: 548 YTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
            +    +         I+   +       I   P+  +T+IG  G  LSGGQ+QR+AIAR
Sbjct: 460 GSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRVAIAR 519

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
           A I+   IL LDEA SALD+     +        K K+  I++  H+LS I  +++ + L
Sbjct: 520 AFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQLSQI-EADDYLYL 576

Query: 659 GHDGSVVEMGKFKELYANPTSALSQ 683
             DG V+E G   EL  + T+  S+
Sbjct: 577 MQDGKVIESGIQSELLVDSTTTFSK 601

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  185 bits (469), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 171/326 (52%), Gaps = 8/326 (2%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LT + Y G   +L   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 342 SALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 401

Query: 424 LTDRKPSISPTVGHKYKPDRG---VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           L   +  I      K  P  G    I F++V+F Y   P   I KN +F IA G  + IV
Sbjct: 402 LRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIV 459

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSG GKSTI  L+ R+Y+P  G I I+  D+ +++  SLR+ IG+V Q+  L + TI +
Sbjct: 460 GPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWE 519

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           N+ +G     T EE+ +  ++      I+K     DT++G  G ++SGG+KQR+AIAR L
Sbjct: 520 NVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVL 578

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
           +K   I+  DEATSALD  +E  +  T     K+ S T + IAHRL TI  ++ +IVL  
Sbjct: 579 LKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-E 637

Query: 661 DGSVVEMGKFKELYANPTSALSQLLN 686
           DGSV E G   EL A   S    L +
Sbjct: 638 DGSVKEEGTHTELLARDHSLYKDLWD 663

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  185 bits (469), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 156/527 (29%), Positives = 246/527 (46%), Gaps = 28/527 (5%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   V A++  N I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQLSILLLFFTPPVLFSA 285
               ++R+M   T+ +S  + A++  ++ +    S     L+ Q        T   +   
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 286 SVFGKQIRNTS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           S+F   I+ T+      +D  +A  +   VA + L   + V+ F  E     +YN ++ +
Sbjct: 270 SIF--TIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMN 327

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
                              +L+   +   ++  G   V+   L++GDL            
Sbjct: 328 YRDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSV 387

Query: 400 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPT 457
            +  L + Y ++ Q       LF+L   +  I         P+     I F++V+F Y  
Sbjct: 388 PLNFLGSVYRDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY-- 445

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
            P  +I KN +F I  G    IVG SG GKSTI  L+ R+Y+P +G I I+ +DI + + 
Sbjct: 446 HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDI 505

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +DT
Sbjct: 506 DALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDT 564

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
           ++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S 
Sbjct: 565 IVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSR 624

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
           T V IAHRL TI  ++ +IVL  +G V E GK  EL A P S   +L
Sbjct: 625 TSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLAMPGSLYREL 670

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  185 bits (469), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 159/533 (29%), Positives = 252/533 (47%), Gaps = 35/533 (6%)

Query: 176 VALLIGCAANFGRF--ILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   F RF  +L   +   V A++  N I+    Q  +      +G  +SR   
Sbjct: 153 IGLTILCYG-FARFGAVLFGEVRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 211

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q   S   + FT  +L+
Sbjct: 212 G---LTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAAITFTTMILY 268

Query: 284 S-----ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           S      + +  Q R   +D  +A  +   VA + L   + V+ F  E     +Y+ ++ 
Sbjct: 269 SIFTIRTTAWRTQFR---RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLI 325

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                               +L+   +   ++  G   V+   L++GDL           
Sbjct: 326 KYRDSQIKVSQSLAYLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLS 385

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK---YKPDRGVIE--FKDVSF 453
             +  L + Y E+ Q       LF+L  RK  I    G      K   G  E  F++V+F
Sbjct: 386 VPLNFLGSVYRELKQSLIDMESLFQL--RKNEIKIENGTNPIVLKASDGPFEITFENVTF 443

Query: 454 SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
            Y ++   +I  N +F I  G    +VGPSG GKSTI  L+ R+Y+P  G I I+  D+ 
Sbjct: 444 GYDSKR--KILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVK 501

Query: 514 KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           + +  SLRR +G+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P 
Sbjct: 502 EYDVDSLRRVMGVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQ 560

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
            Y+T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T     +
Sbjct: 561 GYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFE 620

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           S S T V IAHRL TI  ++ +IVL  DG+V E G    L A P S  + L N
Sbjct: 621 SGSRTSVYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 255/519 (49%), Gaps = 16/519 (3%)

Query: 179  LIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHK--VGDLISRLGSDAY 236
            +I   +NF +  LL I SE  +  LR   +K+ L +  ++F + K    ++ + + +D  
Sbjct: 780  IIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLR 839

Query: 237  VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTS 296
             +   +++ +S     ++  + G+        +L+++ +   P ++  ++++G  ++ + 
Sbjct: 840  DLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSE 899

Query: 297  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 356
             D + +   L  +  + +S IKT++S   EG+    Y VA   +  V             
Sbjct: 900  TDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGIS 959

Query: 357  XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 416
              + +       +  YG  L++  + ++  +        +T      L     ++ +G  
Sbjct: 960  ITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQR 1019

Query: 417  AASRLFEL----TDRKPSISPTV----GHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLN 468
            AAS ++ +     D K    P       +    D  +++ K+++F+Y + PS+++   L 
Sbjct: 1020 AASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLT 1079

Query: 469  FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQ 528
             K+ PG  + I G SG GK+T+  LL+++Y+     I  + +DI     +SLR  I IV+
Sbjct: 1080 LKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVE 1139

Query: 529  QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSG 588
            Q+P ++SG+IRDN+        +  E+  V K     +FI   P+  DT+I    TLLSG
Sbjct: 1140 QKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSG 1197

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 648
            GQ QRI IARAL++KP ILILDE TSALD  S   IN    + +    +TI+SI H  S 
Sbjct: 1198 GQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESM 1255

Query: 649  IRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            +   +NV VL  +G +VE+G +  L A  +S L +LL++
Sbjct: 1256 MTSCQNVAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  169 bits (428), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 146/249 (58%), Gaps = 12/249 (4%)

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I F+++SF+YP+RP+  I   +N      ++  IVG SG GKST++ LLL++Y    G I
Sbjct: 358 ISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDI 417

Query: 506 TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT-----YTPTK----EEIR 556
            IDN +I  LN K+L  +I IV+Q+  L + TIR+NI +G++     Y   +    E ++
Sbjct: 418 LIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLK 477

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           +        +F+   PN  DTVIG  G  LSGGQ+QR+A+ARA ++ P ILILDEA SAL
Sbjct: 478 NACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSAL 537

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           DV     +     +L +S   TI+ + H L+ I   + + V+ H G ++E GK KEL  +
Sbjct: 538 DVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITD 594

Query: 677 PTSALSQLL 685
           P +   +L+
Sbjct: 595 PNTEFHKLV 603

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  184 bits (466), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 157/562 (27%), Positives = 259/562 (46%), Gaps = 40/562 (7%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           +AL + C  AA FG  +L   L   V AR+  N I+       E F +    DL   L  
Sbjct: 150 IALTVICYGAARFGS-VLFGELRNAVFARVAQNAIRTV---SLETFKHLMKLDLGWHLSR 205

Query: 234 DAYVVSRSM---TQKVSDGVKALI-------------CGVVGVGMMCSLSP-QLSILLLF 276
               ++R+M   T+ +S  + A++             CG++      S +    + +LL+
Sbjct: 206 QTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAGITFATMLLY 265

Query: 277 --FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             FT  V    + F        +D  +A  +   VA + L   + V+ F  E     +Y+
Sbjct: 266 SIFTIKVTAWRTAF-------RRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYH 318

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
            ++                     + +   +   ++  G   V+   L++GDL       
Sbjct: 319 NSLMKYRDSQVKIAQSLAFLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLV 378

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG---VIEFKDV 451
                 +  L + Y E+ Q       LF L + K  I         P+      I+F++V
Sbjct: 379 FQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENV 438

Query: 452 SFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQD 511
           +F Y TR   +I +N +F I  G    IVGPSG GKSTI  L+ R+Y+P +G + ++ +D
Sbjct: 439 TFGYDTRR--KILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKD 496

Query: 512 ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
           + + +  S R+ IG+V Q+  L + TI +N+ +G     T +E+ +  ++      I K 
Sbjct: 497 VREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKL 555

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQL 631
           P    T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  + 
Sbjct: 556 PVGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIREN 615

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAP 691
               S T V +AHRL TI  ++ ++VL  +G V E G   EL + P S   QL + +   
Sbjct: 616 FDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWDIQENL 674

Query: 692 GPSDQQLQIEKVIEKEDLNESK 713
              DQ+++ E+ +E + LN+ K
Sbjct: 675 DVIDQEIKQERQLE-DQLNQHK 695

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  180 bits (457), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 114/330 (34%), Positives = 175/330 (53%), Gaps = 10/330 (3%)

Query: 363 DLSFLTVLAYGSYL----VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           +L F + L    Y+    V++  L++GDL             +  L + Y E+ Q     
Sbjct: 355 NLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDM 414

Query: 419 SRLFELTDRKPSISPTVGHKYKPDR--GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS 476
             LF L   K +I   +  +  P++    I F++V+F Y   P  +I KN  F I  G  
Sbjct: 415 ESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKK 472

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSG 536
             IVGPSG GKSTI  L+ R+Y P  G I ID +DI +++  SLR+ IG+V Q+  L + 
Sbjct: 473 TAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFND 532

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
           TI +N+ +G     + ++I +  ++      I   P   +T++G  G ++SGG+KQR+AI
Sbjct: 533 TIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAI 591

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
           +R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI  ++ +I
Sbjct: 592 SRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKII 651

Query: 657 VLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           VL ++  V E G  K L   P S  S+L N
Sbjct: 652 VL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  180 bits (456), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 172/331 (51%), Gaps = 17/331 (5%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LTV+ Y G   ++   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 424 LTD--------RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGS 475
           L           KP +    GH        I F++V+F Y  +   +I KN +F+I  G 
Sbjct: 432 LKKNPIIIKNVEKPLMLAEKGHMPM----TIRFENVTFGYDKQR--KILKNASFQIESGQ 485

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMS 535
              IVGPSG GKSTI  LL R+Y+P  G I ++  D  + +  SLR+ IG+V Q+  L +
Sbjct: 486 KTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFN 545

Query: 536 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
            TI +N+ +G     + +EI  V  +      + K P   +T++G  G ++SGG+KQR+A
Sbjct: 546 DTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLA 604

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENV 655
           IAR L+K   I+  DEATSALD  +E A+  T  +  K  S T V IAHRL TI  ++ +
Sbjct: 605 IARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKI 664

Query: 656 IVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           IVL  +G+V E GK  EL A   S   +L N
Sbjct: 665 IVL-QEGTVREEGKHSELLARSGSLYKELWN 694

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  182 bits (462), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 151/501 (30%), Positives = 237/501 (47%), Gaps = 31/501 (6%)

Query: 192  LRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDG 249
            L  +SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 250  VKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309
               ++  + G+    +   +LS++ +   P ++  ++++G  ++      +     L   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 310  AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
              E + GIKT++    E + + RY+V    +  +G              + L       +
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 370  LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFE 423
              YG  LV      IG+ T   ++  +T   +F + T  S I Q      G  AASR+F 
Sbjct: 949  FYYGLKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFR 1002

Query: 424  L---TDRKPSISPTVGH-----KYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGS 475
            +   +DR    S   G      K    + +I   ++ F YP+  S  +F  LN +IA   
Sbjct: 1003 ILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQ 1062

Query: 476  SVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMS 535
            +V +V  SG GKST+  LL R Y     +I ID  DI++    SLR  I IV+Q+P L  
Sbjct: 1063 TVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFE 1122

Query: 536  GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
            G+IR N+ YG        +I  V KQ    +F+T  PN  DT +    +LLSGGQ QRI 
Sbjct: 1123 GSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRIC 1180

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRRSE 653
            IARAL++K  ILILDE TSALD ES     +    L+KS    +  ++I H    +R   
Sbjct: 1181 IARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACG 1236

Query: 654  NVIVLGHDGSVVEMGKFKELY 674
            NVIVL  DG   + G F ELY
Sbjct: 1237 NVIVL-QDGETAQQGTFDELY 1256

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 130/516 (25%), Positives = 245/516 (47%), Gaps = 56/516 (10%)

Query: 202 RLRANVIKKTLHQDAEFFDNHK--VGDLIS--------RLGSDAYVVSRSMTQKVSDGVK 251
           R+R  ++   L +  E+FD +   +GD +         R GS     + ++T +    + 
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITFQNFVAII 159

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           AL+C           S  L++++L  +P ++  A+ F + I N +K   + TG   +   
Sbjct: 160 ALVCTSF------YYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLT 213

Query: 312 EQLSGIKTVQSFVAEGNELSRY-NVAIR--DIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
             ++  + V+ +  +  E+ ++  + IR  D F                 SL     F+ 
Sbjct: 214 WSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDYFINAWFYVSANTSILRFLSLA---MFVQ 270

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG--LSTFYSEI--MQGAGAA-SRLFE 423
              +GS ++ ++++S+  +      T ++   + G  L+T   +I  +Q A    +R+ +
Sbjct: 271 GFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQD 325

Query: 424 LTDRKPSISPTVGHKYKPDRG----VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
             + K  ++     +   +       I F  +SF YP+RP   + KN++    P  +  I
Sbjct: 326 FLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFI 385

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539
           VG SG GKST++ LLL++YN   G I ++  ++  ++   + +++ +V+Q+  L + T+R
Sbjct: 386 VGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLR 445

Query: 540 DNITYGLTYTPTKEEIRS-VAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIA 595
           +N+  GL++    E++ S + + C      N I K P+  DT +G  G  LSGGQ+QR+A
Sbjct: 446 NNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVA 505

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGQLMK-----SKSMTIVSIAHRLSTIR 650
           +ARA ++   ++ILDEA SALD  +         QLM+     ++S T + + H L+ I 
Sbjct: 506 LARAYLRDTPVVILDEAISALDARNR-------RQLMENIRIWTRSKTAIILTHELNQIL 558

Query: 651 RSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
            S+  + L  +G + E G   EL  N  S   +  +
Sbjct: 559 PSD-FLYLMENGQIKEEGYQNELIENVESTFCKFFH 593

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  181 bits (458), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 141/491 (28%), Positives = 241/491 (49%), Gaps = 22/491 (4%)

Query: 196  SERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            SE  +  LR + ++K  +   E+   DN+K  +L + L +D   +  S +  +S     +
Sbjct: 776  SEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFV 835

Query: 254  ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
            I   VG+        +LS++ +   P ++  + ++G  ++    + +    +L  V  E 
Sbjct: 836  IVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEV 895

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            ++G+KT++    E +  +++NV  +    +G              + L  +S   +L Y 
Sbjct: 896  VTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGL-TMSIQGILYYY 954

Query: 374  SY-LVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--R 427
            +  LV+  + +   +      +L+T  T N    L     +I +G  AAS+++ + +   
Sbjct: 955  AIKLVIHGEYTTKKMFETFTLLLFTIMTCN---NLVNQIPDIRRGQRAASKIYRILEGID 1011

Query: 428  KPSISPTVGHKY-----KPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            +     T GH+       P   +I F D+SF+YPT P+V+I K+L+ +I  G  + IVG 
Sbjct: 1012 ESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGE 1071

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            SG GKST+  ++ R Y   + ++ +DN D++      LR  I +V+Q+P L  GTIR+N+
Sbjct: 1072 SGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENL 1131

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
             YG        ++ ++ K    ++F    P   +T I     LLSGGQ QR+ IARAL++
Sbjct: 1132 VYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQ 1189

Query: 603  KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
            +P ILILDE TSALD  S   IN    +     +M  +SI H    +R    V VL   G
Sbjct: 1190 RPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISITHDEQMVRACNKVAVLDQ-G 1246

Query: 663  SVVEMGKFKEL 673
             +VEMG  ++L
Sbjct: 1247 HIVEMGNREDL 1257

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 138/551 (25%), Positives = 248/551 (45%), Gaps = 27/551 (4%)

Query: 163 FSLPLYEFLSFFTVALLIGCAANFGRFILLR---ILSERVVARLRANVIKKTLHQDAEFF 219
           +S P++E      V L +G  +    +I +    +L ER   R+R  +I   L +  +++
Sbjct: 54  WSDPIHELRLRSMVILALGAGSIVIIWICISSWMLLGERQNFRVRTQLIDSYLQKPMKWY 113

Query: 220 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL-------SPQLSI 272
           D++        L  D    +R + +  S   +A       +  + +L       S  L++
Sbjct: 114 DDNDT------LTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTL 167

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           + +   P ++  A  F + I   S+     T   +++    +   + V+    +  E+  
Sbjct: 168 VTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQN 227

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           + +A++   +                  L    F+    +GS ++ + +L I D+     
Sbjct: 228 FQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQ 287

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTV--GHKYKPDRGV---IE 447
                G  + G       + +G      + E   +   +        ++  D G+   IE
Sbjct: 288 SCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIE 347

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI 507
            ++V F+YP+RP+V   KN++  +  G    +VG SG GKS++  LLL+ Y+   G+I+I
Sbjct: 348 LRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISI 407

Query: 508 DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT---KEEIRSVAKQCFC 564
           D  DI  ++ KS+ ++I +V+Q   L + T+R+NI +G   T      E +++  +    
Sbjct: 408 DGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLL 467

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
            NFI   P   DT+IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +
Sbjct: 468 DNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLL 527

Query: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
                   +S+  TI+ + H LS I   +++I L  DG VVE G+ + L  N       +
Sbjct: 528 MNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNM 584

Query: 685 LNEKAAPGPSD 695
           ++  A    +D
Sbjct: 585 VSLGAGTDLAD 595

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  178 bits (452), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 160/550 (29%), Positives = 256/550 (46%), Gaps = 43/550 (7%)

Query: 161 PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFD 220
           P  +LP+   L+ F+  +     A FG  +L   L   V A++  N I+       E F 
Sbjct: 177 PTIALPMSICLTIFSYGV-----ARFGA-VLFGELRNAVFAKVAQNAIRTV---SLETFQ 227

Query: 221 NHKVGDLISRLGSDAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSPQL-- 270
           +    DL   L      ++R+M   T+ +S  + A++  ++ +G   S     L+ Q   
Sbjct: 228 HLMKLDLGWHLKRQTGGLTRAMDRGTKGISYVLSAMLFHIIPIGFEISVVCGILTYQFGA 287

Query: 271 SILLLFFTPPVLFS-----ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
           S   + FT  +L+S      + +  Q R   +D  +A  +   VA + L   + V+ F  
Sbjct: 288 SFAGITFTTMLLYSIFTIRTTAWRTQFR---RDANKADNKGASVALDSLINFEAVKYFNN 344

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
           E    ++Y+ ++                     +L+   +   ++  G   V++  L++G
Sbjct: 345 ETYLSNKYHDSLLQYRDSTIKVAQSLAFLNSGQNLIFTSALTMMMYLGCTGVIEGNLTVG 404

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL-------TDRKPSISPTVGHK 438
           DL             +  L + Y E+ Q       LF+L        + K   +P +   
Sbjct: 405 DLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIM--- 461

Query: 439 YKPDRG--VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K   G   I+F++V+F Y T  + +I KN +F I  G    +VGPSG GKSTI  L+ R
Sbjct: 462 LKSSDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFR 519

Query: 497 YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
           +Y+P  G + I+  ++ + +  SLRR +G+V Q+  L + TI +N+ +G       EEI+
Sbjct: 520 FYDPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIK 578

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            V ++      I K P    T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSAL
Sbjct: 579 QVIEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSAL 638

Query: 617 DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
           D  +E A+  T      S + T + IAHRL TI  ++ +IVL  DG V E G   EL A 
Sbjct: 639 DTHTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLAT 697

Query: 677 PTSALSQLLN 686
             S  S L N
Sbjct: 698 KGSLYSNLWN 707

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  176 bits (446), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 133/435 (30%), Positives = 209/435 (48%), Gaps = 20/435 (4%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    S +LL+  FT    F  + +  + R   +D  +A  +   
Sbjct: 243 SMVCGILTYQFGASFAAITFSTMLLYSIFT----FRTTAWRTRFR---RDANKADNKAAS 295

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +Y+ ++                     +L+   +   
Sbjct: 296 VALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTA 355

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++      V+Q  L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 356 MMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQ 415

Query: 429 PSI--SPTVGHK--YKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
            +I  SP   +   +KP    I F++V+F Y   P  +I  N++F I  G    IVGPSG
Sbjct: 416 VTIKNSPNAQNLPIHKPLD--IRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSG 471

Query: 485 RGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y P  G I +   DI  L+  SLR+ IG+V Q+  L + TI +N+ +
Sbjct: 472 SGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKF 531

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
           G   +   E +R++ K       +   P    TV+G  G ++SGG+KQR+AIAR L+K  
Sbjct: 532 GNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDA 590

Query: 605 TILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
            ++  DEATSALD  +E A+ +T  Q   S S T V +AHRL TI  ++ +IVL   GSV
Sbjct: 591 PLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSV 649

Query: 665 VEMGKFKELYANPTS 679
            E G    L A+  S
Sbjct: 650 REEGTHSSLLASQGS 664

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 153/538 (28%), Positives = 269/538 (50%), Gaps = 35/538 (6%)

Query: 177  ALLIGCAA-----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLIS 229
             +++G AA     NF +  LL   SE  +  LR  V++K   +   +F  +++K  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP--QLSILLLFFTPPVLFSASV 287
             + +D   + RS+  +    + + I  V  +G++ +L+   +LS++ +   P ++  +++
Sbjct: 850  LVLNDLRDL-RSLVSEFLSAITSFIT-VSFIGLVWALASGWKLSLVCISMFPLIIIFSAI 907

Query: 288  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 347
            +G  ++    D + +  QL     + ++ IKT++   AE +    Y+     + Q+    
Sbjct: 908  YGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKR 967

Query: 348  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTF 407
                       +++       +  YG  LV+  + +   +        +T  +   L + 
Sbjct: 968  AIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQ 1027

Query: 408  YSEIMQGAGAASRLFELTDRKP-----------SISPTVGHKY--KPDRGVIEFKDVSFS 454
              +I +G  AAS ++ + D K            SI   +G  Y  K    ++  ++++F+
Sbjct: 1028 IPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIG-IIGETYHEKQTTPMLSIQNLTFA 1086

Query: 455  YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
            YP+ PSV I+KN+N  +  G ++ IVG SG GKST+ LLL R Y+   G+I +D  D++ 
Sbjct: 1087 YPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVND 1146

Query: 515  LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
             N   LRR I +V+Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P  
Sbjct: 1147 WNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLG 1206

Query: 575  YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
              T I  +  LLSGGQ QR+ IARAL++KP ILILDE TSALD  S   I     +++K 
Sbjct: 1207 LGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKK 1260

Query: 635  K--SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAA 690
               ++  + I H    +R  +++ V   DG V+E G F  LY N    + ++++EK A
Sbjct: 1261 GPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEKNA 1316

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 147/543 (27%), Positives = 250/543 (46%), Gaps = 40/543 (7%)

Query: 192 LRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK 251
           LRI S+ + A L    +K     D    D  ++   +  L S +   S    Q +     
Sbjct: 131 LRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQNL----- 185

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
             IC ++G     S S  L++++L  +P + F A  F + +   S+   E T +  ++  
Sbjct: 186 VAICALLGTSFYYSWS--LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS---FLT 368
             ++  + V+ +  +  E  ++    R I                   +L  L+   F+ 
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQ---RIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQ 300

Query: 369 VLAYGSYLVLQSQLSIGD-LTAF---MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
              +GS ++ Q +L+I D +T F   +L      N +  +      + +G  A  ++  L
Sbjct: 301 GFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVV----LQKGEVALQKIMNL 356

Query: 425 TDRKPSISP---TVGHKYKPDRGV--IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
            +  P  +P      H+Y  D     + F +VSFSYP+RPS  + +N + K   G    I
Sbjct: 357 LENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFI 416

Query: 480 VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539
           VG SG GKST++ LLL++Y+   G+I+I+ ++I  +  K L ++I +V+Q   L + T+R
Sbjct: 417 VGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLR 476

Query: 540 DNITYGLT-------YTPTKEE--IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQ 590
            NI  G T       Y+  K    I+   +       I   P+  +T+IG  G  LSGGQ
Sbjct: 477 KNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQ 536

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 650
           +QR+A+ARA I+   IL LDEA SALD+     +        K K+  I++  H L  + 
Sbjct: 537 QQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQV- 593

Query: 651 RSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLN 710
            S++ + L  +G V+E G   EL A+ TS  S+    +     SD +  +   I+++ LN
Sbjct: 594 ESDDHLYLMQEGKVIESGTQSELLADSTSTFSKWYCLQ--KDYSDTKTIVNSEIDEKSLN 651

Query: 711 ESK 713
            ++
Sbjct: 652 STE 654

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  178 bits (452), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 148/539 (27%), Positives = 257/539 (47%), Gaps = 38/539 (7%)

Query: 152  GSDFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKT 211
            GS F+ LK  +  L +    +F T          F +  ++   SE  +  LR  V++  
Sbjct: 744  GSSFYLLKWSLIVLSVAIIDAFCT----------FSKTFIMGYCSEYWIMDLRKKVMRTI 793

Query: 212  LHQDAEFFD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
             +   E+F    +K  ++ +   +D   +   +T+ ++     L+    G+        +
Sbjct: 794  TYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWK 853

Query: 270  LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            LS++ +   P ++  + V+G  ++    D + A  QL     E +  +KT++    + + 
Sbjct: 854  LSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHF 913

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGD 386
             +RY+   + +  +G                L       +  YG  LV+  + +   + +
Sbjct: 914  QNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFE 973

Query: 387  LTAFMLYTEYTGNAVFG----------LSTFYSEIMQGAGAASRLFELTDRKPSISPTVG 436
            +   +L+T  T   +             +T+   I++ A A     ++ +R   IS T  
Sbjct: 974  VFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTS- 1032

Query: 437  HKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
               + D  V+  KD++F+YP  PS  ++++LN  +   +SV +VG SG GKSTI  LL +
Sbjct: 1033 ---EKDTMVL-VKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTK 1088

Query: 497  YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EI 555
             Y+     I +D  D+S+ +  SLR  I +V+Q   L++GTIR+N+TYGL    T E ++
Sbjct: 1089 LYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDL 1148

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
              + K    ++F+++ PN  DT++     LLSGGQ QR+ IARAL+K   ILILDE TSA
Sbjct: 1149 IGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPHRILILDECTSA 1206

Query: 616  LDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            LD  S    N     + K    T I++I H    +R  E+V++L  +G++VE G F EL
Sbjct: 1207 LDALST---NIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLL-KNGAIVEQGSFVEL 1261

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 134/516 (25%), Positives = 238/516 (46%), Gaps = 27/516 (5%)

Query: 202 RLRANVIKKTLHQDAEFFDNHK---VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVV 258
           R+R N++   L +   ++D +    +G+  ++L      V +S ++  +  +++ +  + 
Sbjct: 95  RIRINMLGSYLSKSWTWYDGNGKRLLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLS 153

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGI- 317
            +G     S  L++++L  TP +   A  F K + N   DL+    + T  A E L+   
Sbjct: 154 LIGTSFYYSWSLTLIILCSTPIITAIAIYFAK-LTNKYTDLE---NKETSYAAELLTWSM 209

Query: 318 ---KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
                V+ + A+  E+S+++ ++     +                 L    F+    +G+
Sbjct: 210 RFNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGA 269

Query: 375 YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPSIS 432
            ++ +++L I D+          G  V    +  + I +G  A  +L  F   + K  + 
Sbjct: 270 TMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQ 329

Query: 433 PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
             +    K +   I F ++SF YP R S    +N++ ++  G    I+G SG GKST+A 
Sbjct: 330 AALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAK 389

Query: 493 LLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG------- 545
           LLLR+Y   +G+IT+DN  I  LN + L  +I +V+Q   L + T+R+NI  G       
Sbjct: 390 LLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEP 449

Query: 546 LTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIK 602
                 +E  R + K C     +  +    +  DTVIG  G  LSGGQ+QR+A+ARA ++
Sbjct: 450 ARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLR 509

Query: 603 KPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDG 662
              I+I DE+ SALDV     +        + K  T + + H LS I  ++ + ++ H G
Sbjct: 510 NTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-G 566

Query: 663 SVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQL 698
            V E G  ++L  + TS  S+    +A  G   + L
Sbjct: 567 RVCEYGYQEDLLKSETSYFSRFYQHQAPEGAVHESL 602

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 173/328 (52%), Gaps = 12/328 (3%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 365 SALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 424

Query: 424 LTDRKPSISPTVGHK--YKPDRGV---IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           L  RK  I     H+    P+      I+F++V+F Y      +I KN +F I  G    
Sbjct: 425 L--RKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYDKER--KILKNASFTIPAGWKTA 480

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTI 538
           +VGPSG GKSTI  L+ R+Y+P  G I ++  DI +++  SLR+ IG+V Q+  L + TI
Sbjct: 481 VVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTI 540

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
            +N+ +G       E ++++ K       I K P   +T++G  G ++SGG+KQR+AIAR
Sbjct: 541 WENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPKGRETIVGERGLMISGGEKQRLAIAR 599

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            L+K   I+  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL
Sbjct: 600 VLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL 659

Query: 659 GHDGSVVEMGKFKELYANPTSALSQLLN 686
             DG V E G  ++L A   S  S+L N
Sbjct: 660 -KDGQVEEEGTHRQLIAKKESLYSELWN 686

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  174 bits (440), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 151/533 (28%), Positives = 242/533 (45%), Gaps = 35/533 (6%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L + C  AA FG  +L   L   V AR+  N I+       E F +    DL   L  
Sbjct: 149 IMLTVVCYGAARFGA-VLFGELRNAVFARVGQNAIRNV---SMETFRHLMKLDLGWHLSR 204

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q   S   + FT  +L+
Sbjct: 205 QTGGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLY 264

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S   F      T   ++  +A  +   VA + L   + V++F  E     +Y  ++    
Sbjct: 265 SIFTFRTTAWRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYR 324

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   ++   L++GDL             +
Sbjct: 325 DSQVRVAQSLAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPL 384

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDR--------KPSISPTVGHKYKPDRGVIEFKDVSF 453
             L + Y E+ Q       LF L +         KP + P     +      I F++V+F
Sbjct: 385 NFLGSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFD-----IVFENVTF 439

Query: 454 SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
            Y   P  +I +N +F I  G    +VGPSG GKST+  L+ R+Y+P  G I ++  DI 
Sbjct: 440 GYD--PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIR 497

Query: 514 KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           + +  SLRR IG+V Q+  L + TI +N+ +G      +E  RS+ K       + + P 
Sbjct: 498 EYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPG 556

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
             +T++G  G ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T      
Sbjct: 557 GLNTIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFD 616

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
             S T V IAHRL TI  ++ +IVL  +G   E G   EL     S   +L N
Sbjct: 617 RGSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 153/542 (28%), Positives = 262/542 (48%), Gaps = 29/542 (5%)

Query: 163  FSLPLYEFLSFFT--VALLIGC--AANFGRFILLRILSERVVARLRANVIKKTLHQDAEF 218
            ++ P  E+L  F+  V+L+  C   + F +   L    E  +  LR     K +     +
Sbjct: 696  YNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISW 755

Query: 219  FD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276
            F   N+K   L + L +D   +   +T+ +S     ++   +G+    ++  +LS++ + 
Sbjct: 756  FSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIA 815

Query: 277  FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
              P V+    ++G  +  T    + +   L  +  E + G+KT+QS   +     ++N  
Sbjct: 816  IIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCK 875

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLY 393
            I+ + + G              ++L  L    +  YG  LVL  + +   L    A +L+
Sbjct: 876  IKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLF 935

Query: 394  TEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISP-----TVGHKYKPDRGVI 446
            T  T   V  L T   +I +G  + S + ++   D + +I P     T    + P++ VI
Sbjct: 936  TIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVI 992

Query: 447  EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
            E  ++SF+Y    + +   N+N ++       IVG SG GKST+  L+   Y+ + G+I 
Sbjct: 993  EVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN 1052

Query: 507  IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            I + DI+K + K L + + ++QQ PVL   TIR+N+ YGLT T   E + +V +     +
Sbjct: 1053 ICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKS 1112

Query: 567  FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
            FI    N  D+ +    +LLSGGQ QR+ +AR +++ P +LILDE TSALDV S   IN 
Sbjct: 1113 FIISLNNGLDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKIND 1170

Query: 627  TFGQLMKSKSMTIVSI--AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
              G    S+S+  V+I  +H+  TI+  + +  L  DG+V  MG ++EL  N      +L
Sbjct: 1171 IIG----SRSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN-NWEFRKL 1224

Query: 685  LN 686
            LN
Sbjct: 1225 LN 1226

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 135/477 (28%), Positives = 224/477 (46%), Gaps = 25/477 (5%)

Query: 194 ILSERVVARLRANVIKKTLHQDAEFFDNHK---VGDLISRLGSDAYVVSRSMTQKVSDGV 250
           +L ER    +R  +  +  +    +FD ++   +G+  ++L      V  S  +  +   
Sbjct: 97  MLGERQSYIIRKKLFHEYFNLPCSWFDKYRSDIMGEF-TQLHRCIEEVRSSSAEASAIMS 155

Query: 251 KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQI-RNTSKDLQEATGQLTRV 309
           ++L+  +  +G     S  L++++   TP ++  A +F K I + T K+  E+     R+
Sbjct: 156 QSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERL 215

Query: 310 AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
           A   L  I+ V+    +  E+S Y   I    +                 LL  L F+  
Sbjct: 216 AW-MLKNIEFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQG 274

Query: 370 LAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             +GS ++ Q +L+I   +T+F   L      N+  G +     + +G  A  RL ++ D
Sbjct: 275 FWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVV---LQKGDVAMKRLLKMID 331

Query: 427 RKPS-----ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
           R P      I    G    P    I F +VSF YP R + ++F  +NF I P     ++G
Sbjct: 332 RTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIG 387

Query: 482 PSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN 541
           PSG GKST+  L+L +Y+   G+I + + DI  +N   +  +I +V Q P L + TIR+N
Sbjct: 388 PSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNN 447

Query: 542 ITYGLTYT--PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARA 599
           I     +T  P+K E+  + K     N I + P+  DT IG  G  LSGGQ Q++A+ARA
Sbjct: 448 ILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARA 507

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
             +  +IL+LDE  SA+D+     +     +    K  T V I H L  IR ++N++
Sbjct: 508 FARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/514 (26%), Positives = 237/514 (46%), Gaps = 34/514 (6%)

Query: 195 LSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA-- 252
           L ER    +R  ++ + L +  E++D H       +L  D   V+R + +  S   +A  
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASA 153

Query: 253 -----LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 +  +  +G     S  L++++L   P ++  A +F   I   ++     TG+  
Sbjct: 154 ITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAA 213

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS-- 365
           ++    ++  + V+ +  +  E+  +   +    Q                S+L  LS  
Sbjct: 214 QLLNWSMNSAQLVKLYCTQAYEIHSFKELVG---QCNDLFIKSCFYVSANTSILRFLSLS 270

Query: 366 -FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +LSI D+          G+ +         + +G  A  ++ + 
Sbjct: 271 MFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDF 330

Query: 425 ---TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
              + R PS+ P          G I F+++SF+YPTRP   + K+++    PG S  I+G
Sbjct: 331 ISFSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIG 390

Query: 482 PSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN 541
            SG GKST+A LLL++YN   G+I I N ++ K+N   L  +I +V+Q   L + T+R+N
Sbjct: 391 KSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNN 450

Query: 542 ITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
           +  G++ +  K E         ++   +       I + P+  DT+IG  G  LSGGQ+Q
Sbjct: 451 LLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQ 510

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 652
           R+AIARA IK  ++LILDEA SALD+     I          K+  I++  H LS +   
Sbjct: 511 RVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGKTTIILT--HDLSQLDYD 568

Query: 653 ENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
           + + V   DG V E G  + L  +  +  S+L +
Sbjct: 569 DFLYVF-EDGEVKESGYQQALLQDEKTIFSKLYD 601

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 142/520 (27%), Positives = 244/520 (46%), Gaps = 25/520 (4%)

Query: 184  ANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT 243
            +NF +  +L   SE  +  LR   +   +++  ++F   +  +  S L +      R + 
Sbjct: 781  SNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEE--NKSSELSALLLNDLRDLR 838

Query: 244  QKVSDGVKALICGVVG--VGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
              VS+ + A+   +V   VG++ +L    +LS++ +   P ++  + ++G  ++      
Sbjct: 839  SLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMY 898

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            + A  +L     E ++ IKT++   A    +  Y V   ++ ++               +
Sbjct: 899  KTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITN 958

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             +       +  YG  LV + + S   +        +T  +   L +   +I +G  AAS
Sbjct: 959  TIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAAS 1018

Query: 420  RLFELTDRKPSISPTVGHKYKPDRGVIE----------FKDVSFSYPTRPSVQIFKNLNF 469
             L+ + D       +V    +    +I            K++ FSYP+  +V+I+KN+  
Sbjct: 1019 WLYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITL 1078

Query: 470  KIAPGS-SVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQ 528
             +     ++ IVG SG GKST+  LL + Y     +I ID  D+++ +   LR+ I +V+
Sbjct: 1079 HVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVE 1138

Query: 529  QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSG 588
            Q P L  GT+RDN+ YG     ++ EI  V K    + FI   P   D+ I     L+SG
Sbjct: 1139 QNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSG 1196

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS- 647
            GQ QR+ IARAL++KPTILILDE TSALD  S   IN     L+K+   T+++I    S 
Sbjct: 1197 GQAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSK 1252

Query: 648  TIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
             +  + N + +  DG + E G F EL  N  S L +++NE
Sbjct: 1253 QMMEACNSLAVIKDGRLAEQGNFAELMKN-NSELRRIINE 1291

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 138/512 (26%), Positives = 242/512 (47%), Gaps = 23/512 (4%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLG 232
            ++IG A+     NF +  LL  +SE+ V +LR N+++  L +D  +   +K  ++ +   
Sbjct: 766  VVIGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTM 825

Query: 233  SDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQI 292
            +D   +    +  +S      +   VG+     +  +L+++ L   P  +   +++G  +
Sbjct: 826  NDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFV 885

Query: 293  RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
            + +    + A  QL  +  E + G+KT++    E     RY    + + +          
Sbjct: 886  QKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYG 945

Query: 353  XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                  S L  L    +  YG  LV+  +     L        +T  +  GL +      
Sbjct: 946  SGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSS 1005

Query: 413  QGAGAASRLFELT-------DRKPSI---SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ 462
            +G  A + +F +        D   ++   +PT     +P   ++  + ++F+YP    VQ
Sbjct: 1006 RGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREP---LVVLRALNFAYPAAKDVQ 1062

Query: 463  IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            I+KN N +I  G+ V IVG SG GKST+  L+   Y     ++ ID  DI      +LR+
Sbjct: 1063 IYKNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRK 1122

Query: 523  HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
             I +V+Q+P   +GTIR+N+ YGL  T T  EI  V  +    NF+   P   +T +  +
Sbjct: 1123 IIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN 1182

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
              L+SGGQ QR++I RAL+++PT+LILDE TSALD  +  AI       +    +T++ I
Sbjct: 1183 --LVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVI 1238

Query: 643  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             H    ++  + ++VL  +G+V E G F +L+
Sbjct: 1239 THSKQMMKMCDRIVVL-KNGAVAEDGSFDDLF 1269

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 134/543 (24%), Positives = 241/543 (44%), Gaps = 44/543 (8%)

Query: 194 ILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV------- 246
           +L ER   R+R  +++  L +  +++D  K+ D+     +  Y ++    ++        
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYD--KIDDI-----NGMYTITNRCVEEARASCAEA 149

Query: 247 -----SDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE 301
                   V ALI  V         S +L+++ L   P +     VF K ++  +    E
Sbjct: 150 SGVLFQSAVTALILAVTAF----KFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENE 205

Query: 302 ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
            T   +      L+    V+ F  +  EL ++N A+    +                  L
Sbjct: 206 QTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFL 265

Query: 362 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 421
             + F+    YGS L+ + ++    +      +    +++  + +    + +G  A  ++
Sbjct: 266 SLMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQI 325

Query: 422 FELTDRKPSISPT-------VGH--KYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIA 472
            E  + +P   P        VGH    +     I F  VSF+YP RP  +    ++    
Sbjct: 326 AEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFR 385

Query: 473 PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPV 532
           P     IVG SG GKST+  LLL++Y+   G IT+++ ++  ++   L ++I +V+Q   
Sbjct: 386 PNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCT 445

Query: 533 LMSGTIRDNITYGLTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGPHGTLLSGG 589
           L +GT+ +NIT  L+  P  +   +V + C        +   P    T +G  G  +SGG
Sbjct: 446 LFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGG 503

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           Q+QR+A+ARA+++   +LILDEA SALD+     +          K+  I++  H LS +
Sbjct: 504 QQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHV 561

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANPTS---ALSQLLNEKAAPGPSDQQ-LQIEKVIE 705
              + + ++ H G V+E G   EL +NP S   AL++L N K      +++   IE  +E
Sbjct: 562 LDDDYLYMMEH-GQVIEQGYKSELLSNPNSRFRALNRLQNSKNERALEERRSFAIENKLE 620

Query: 706 KED 708
           +ED
Sbjct: 621 QED 623

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 142/504 (28%), Positives = 235/504 (46%), Gaps = 27/504 (5%)

Query: 186  FGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMT 243
            F +   L   SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   + RS+ 
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLV 866

Query: 244  QKVSDGVKALICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE 301
             +    +  LI  V  VG++ +     +LS++ +   P  +  +  +G  ++    D + 
Sbjct: 867  SEFLSSISTLII-VSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKT 925

Query: 302  ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
               +L     E   GI T++    E   L +Y    + + +                + L
Sbjct: 926  KVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTL 985

Query: 362  GDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
                   +  YG  LV     S   + +    +L+T  T  ++ G      +I +G  AA
Sbjct: 986  TLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAA 1042

Query: 419  SRLFELTDR-----KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAP 473
            + +F + D      K        +K+  D  +I  K++SFSYP+ PS  I+K L   +  
Sbjct: 1043 TYIFRIIDNQSPAAKDEKKKIASYKFTHD-PLISVKNLSFSYPSAPSTAIYKGLKLDVFS 1101

Query: 474  GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVL 533
            G ++ +VG SG GKST+ LL+   Y    G+I ID  DI++ +   LR  I +V+Q+P  
Sbjct: 1102 GETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQF 1161

Query: 534  MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQR 593
              GT+ +N+ YG++   T+ +++         +F+   P   DT I    +L+SGGQ QR
Sbjct: 1162 FDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQR 1219

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIAHRLSTIRR 651
            ++IARA+++KP IL LDE TSALD  +  AI      L+K     +T + I H    +R 
Sbjct: 1220 LSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRA 1275

Query: 652  SENVIVLGHDGSVVEMGKFKELYA 675
             E + VL  +G V E G F +LYA
Sbjct: 1276 CERIAVL-QNGKVAEDGSFDDLYA 1298

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 142/276 (51%), Gaps = 9/276 (3%)

Query: 444 GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G I FK+VSFSYPTRP+  + KN++       +  IVG SG GKSTI  LLL+ Y   TG
Sbjct: 367 GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTG 426

Query: 504 TITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQC 562
            I +D  DI  +    L  +I +V+Q   L + TI++NI  G       +  +R   +  
Sbjct: 427 AIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMA 486

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                I   PN  DTV+G  G  LSGGQKQR+A+ARA ++   ILILDEA S +D+    
Sbjct: 487 LLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGMDIIHRD 546

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
            +     +    K MT V + H L+ I   E+ +    +G + E G    L  N  S  +
Sbjct: 547 LLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFN 603

Query: 683 QLLN-EKAAPGPSDQQL---QIEKVIEK-EDLNESK 713
           +L   +KA  G S + +    +EK  E  E +NE+K
Sbjct: 604 RLWRLQKAKTGFSRRSVSTSNLEKFPENAEVVNETK 639

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/510 (26%), Positives = 250/510 (49%), Gaps = 29/510 (5%)

Query: 183  AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 240
             +NF +  +L   SE  +  LR   ++  L++D  +F  D +K  +L + L +D   +  
Sbjct: 773  VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRS 832

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
             +++ +S     ++  ++G+        +LS++ L   P ++  ++V+G  ++      +
Sbjct: 833  LVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 301  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
             +   L     E ++GIKT++S  AE + +  Y+    ++  +               ++
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNM 952

Query: 361  LGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGL----------STF 407
            +       +  YG  LV + + S   + +    +L+T  T  ++             +TF
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATF 1012

Query: 408  YSEIM-QGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKN 466
               I+ +G  +    FE   +   ++P    K  P   +I+ ++++F+YP+  +V ++++
Sbjct: 1013 LYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSETNVNVYED 1069

Query: 467  LNFKI-APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIG 525
            LN ++ A   ++ +VG SG GKST+  LL + Y     +I +D  D++     +LR  I 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL 585
            +V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P   DT I     L
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--L 1187

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIA 643
            LSGGQ QRI IARAL++KP ILILDE TSALD  S   I      ++K+   ++  + I 
Sbjct: 1188 LSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVIT 1243

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H    + R+ N I +  +G ++E G FKEL
Sbjct: 1244 HS-EKMMRACNTIAVLKNGKIIEKGGFKEL 1272

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 128/517 (24%), Positives = 233/517 (45%), Gaps = 43/517 (8%)

Query: 195 LSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL- 253
           L ER    +R  ++++ L +   ++D++        L  D   ++R + +  S   +A  
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 254 --------ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA-TG 304
                   I  ++G     S S  L IL    T P++ + +VF   + +   +L+   TG
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILC---TAPIIIAFAVFFSHMIHKYTELENTETG 212

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++A   +  I+ V+ +  +  E+  +     +   +                 L   
Sbjct: 213 KAAQLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALLRFLSLS 272

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +L I ++          G+ +         + +G  A  ++   
Sbjct: 273 MFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGF 332

Query: 425 TDRKPSISPTVGHK-----YKPDR----GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGS 475
                 +S +V H      Y+P+       I F +++FSYP+RPS  + KN++    P  
Sbjct: 333 ------LSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTK 386

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMS 535
              I+G SG GKST++ LLL++Y+   GTIT+   D+ ++N   L  ++ +V+Q   L +
Sbjct: 387 FTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFN 446

Query: 536 GTIRDNITYGLT------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGG 589
            T+R+NI  G++      +   +++++           +   P+  +T+IG  G  LSGG
Sbjct: 447 DTLRNNILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGG 506

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI 649
           Q+QR+AIARA ++   ILILDEA SALD+     +     Q    K  T + + H LS I
Sbjct: 507 QQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQI 564

Query: 650 RRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
              +   V+  +G V E G  K+L    TS  + +LN
Sbjct: 565 EPDDYTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  170 bits (430), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 151/529 (28%), Positives = 244/529 (46%), Gaps = 29/529 (5%)

Query: 176 VALLIGCA--ANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   + AR+  N I+    Q  E      +G  +SR   
Sbjct: 182 LGLTIMCYGLARFGA-VLFGELRNAIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTG 240

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQLSILLLFFTPPVLFSA 285
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q        T   +   
Sbjct: 241 G---LTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLY 297

Query: 286 SVFGKQIRNTS------KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           S+F   IR T+      K+  +A  +   VA + L   + V+ F  E    ++Y+ ++  
Sbjct: 298 SIF--TIRTTAWRTRFRKEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIK 355

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
                              SL+   +   ++  G   V+   L++GDL            
Sbjct: 356 YRDSQVKVAQSLAFLNSGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSV 415

Query: 400 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY--KPDRGV-IEFKDVSFSYP 456
            +  L + Y E+ Q       LF+L   +  I      K   K D    I+F++V+F Y 
Sbjct: 416 PLNFLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYD 475

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516
            +   +I KN +F I  G    I GPSG GKST+  L+ R+Y+P  G + ++  D+ + +
Sbjct: 476 GQR--KILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYD 533

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
              LR+ IG+V Q+  L + TI +N+ +G     + EEI  V  +    + I K P    
Sbjct: 534 IDQLRKAIGVVPQDTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSS 592

Query: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS 636
           T++G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +   S  
Sbjct: 593 TIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGE 652

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            T V IAHRL TI  ++ +IVL  +G+V E G  +EL A   S   +L 
Sbjct: 653 KTSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQELLARENSLYKELW 700

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  171 bits (432), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 140/241 (58%), Gaps = 4/241 (1%)

Query: 444 GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
           G IEF+DVSF+YPTRP   + KN++ KI  G++  IVG SG GKST+A LLL+ Y   TG
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 504 TITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
            I     +I  L+   L  +I +V+Q   L +GT++DN+T    Y     E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFAL 473

Query: 564 CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
            +  +   PN  DT++G HG  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 624 INYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQ 683
           I        K K+  I++  H  + I+  E V ++  +G+VVE G   +L  NP S  +Q
Sbjct: 534 IVEAIRHWRKGKTTIILT--HEYTQIKDDEYVYLMS-EGTVVESGFKYDLLENPDSYFAQ 590

Query: 684 L 684
           L
Sbjct: 591 L 591

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 247/510 (48%), Gaps = 33/510 (6%)

Query: 184  ANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSRS 241
            + F +  +L   SE  + RLR + + K   +  ++F    +   +L S + +D   + R 
Sbjct: 761  STFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDL-RG 819

Query: 242  MTQKVSDGVKALICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
            +  +    +  L+  V  +G++ +L    +LS++ +   P  +  + ++G  ++      
Sbjct: 820  LASEFLSAITTLVF-VASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAY 878

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            +    +L     E +  +KT++    + +    +   +  +  V               +
Sbjct: 879  KTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTN 938

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             L  +    +  +G  LV+Q + S+  +        ++      L     EI +G  AA+
Sbjct: 939  ALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAAT 998

Query: 420  RLFELTDRKPSISPTVGHKYKPD-------------RGVIEFKDVSFSYPTRPSVQIFKN 466
             +F++ +   S+  +     KPD             R  I+  ++SF++ + P  +IF +
Sbjct: 999  YIFKVLEDSGSVDTS-----KPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNS 1053

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGI 526
            L+ +I    +V IVG SG GKST++LLL R Y   +G + I   DI+K +  +LRR I I
Sbjct: 1054 LSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISI 1113

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
            V+Q+P    GT+R+N+ YGL    +  E+RSV K     +F+   PN  +T +  H  L+
Sbjct: 1114 VEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLM 1171

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS--KSMTIVSIAH 644
            SGGQ QR++IAR L+++P I+ILDE TSALD  +  AI     +L+++  K++T++ I H
Sbjct: 1172 SGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITH 1227

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
                ++  + V+VL   G V E G + EL+
Sbjct: 1228 SEQLMQICDRVLVL-KKGKVKEEGSYAELF 1256

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 244/510 (47%), Gaps = 21/510 (4%)

Query: 176  VALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGS 233
            V++  GC     +FIL  + SE  +  LR   + +  +QD  +F  D +K  ++ + + +
Sbjct: 799  VSVTDGCFTFLKKFIL-SVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILN 857

Query: 234  DAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIR 293
            D   +   ++  +S     +    +G+        +LS++ +   P  +    ++G  ++
Sbjct: 858  DLRDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQ 917

Query: 294  NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
                D + A  +L     E + GIKTV+    E +  ++Y +    +             
Sbjct: 918  KYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGF 977

Query: 354  XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSE 410
                 + L       +  YG  LV+  + +  +L      +++T  T +A+      +S 
Sbjct: 978  GVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 411  IMQGAGAASRLFE-LTDRKPSISPTVGHKYKPDRG------VIEFKDVSFSYPTRPSVQI 463
              +G  AA+ +F  L  R   +S     + +P         +I  +D++F+YP+   V++
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEV 1094

Query: 464  FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
            +K L+  I  G ++ IVG SG GKST+ L+L   Y     T+ ID+ DI K N  SLR+H
Sbjct: 1095 YKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKH 1154

Query: 524  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
            I +V+Q+     G+IRDN+ YGL    T  +I  V       +F+ + P   +T I  + 
Sbjct: 1155 ISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN- 1213

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
             L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T + I 
Sbjct: 1214 -LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVIT 1270

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H  + + +S N I+   +G + E G F+EL
Sbjct: 1271 HN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 124/552 (22%), Positives = 235/552 (42%), Gaps = 48/552 (8%)

Query: 182 CAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRS 241
           C A    ++LL    ER   R+R  ++   L +   ++D ++       L  D   + R 
Sbjct: 92  CWATLSSWMLL---GERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQIHRG 142

Query: 242 MTQKVSDGVKA----LICGVVGVGMMCS---LSPQLSILLLFFTPPVLFSASVFGKQIRN 294
           + +  S   ++     +  V  V ++ +    S  L++++L  TP ++  A +F K +  
Sbjct: 143 VEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEK 202

Query: 295 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            ++     T     +    +   + ++ F  E  EL +++++++   +            
Sbjct: 203 YTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAAN 262

Query: 355 XXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG 414
                 L  + F+    +G+ ++ + +L+ G +          G  +         + +G
Sbjct: 263 QASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKG 322

Query: 415 AGAASRLFELTDRKP-SISPTVGHKYK----PDRGV---------IEFKDVSFSYPTRPS 460
             A  ++  + + +  ++    G  ++    P  G+         I F++VSFSYP+RP+
Sbjct: 323 KVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPN 382

Query: 461 VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSL 520
                N++    P     IVG SG GKST++ LLL+ Y+   GTI +   DI       L
Sbjct: 383 EYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWL 442

Query: 521 RRHIGIVQQEPVLMSG--------TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 572
             +I +V+Q   L +         T +D+          +  I+   +       +   P
Sbjct: 443 LENITLVEQSCTLFNDSLLNNLLLTAKDD-------NKNEASIKRACQMALLEKLLFDLP 495

Query: 573 NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632
           +   TVIG +G  LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +        
Sbjct: 496 DGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWR 555

Query: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPG 692
             K+  I++  H LS I   ++ + L  DG V E G  ++L +  +   ++L N      
Sbjct: 556 AGKTTIILT--HELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTELHNAVIPSD 612

Query: 693 PSDQQLQIEKVI 704
           PS  +   EK I
Sbjct: 613 PSAIEASHEKAI 624

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 132/511 (25%), Positives = 244/511 (47%), Gaps = 31/511 (6%)

Query: 185  NFGRFILLRILSERVVARLRANVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSM 242
            NF +  +L   SE  +  LR  +++    +  E++   ++K  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 243  TQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA 302
            T+ +S     +   ++G+    +   +LS++ +   P ++  + ++G  ++N     + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 303  TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 362
               L  +  E ++ IKT++      + L  Y+   + + ++               + + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 363  DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYS------EIMQGAG 416
                  +  YG  LVL      G+ T+  ++  +T   +F ++T  S      ++ +G  
Sbjct: 919  TCIQSILYYYGLKLVLT-----GEYTSKTMFQTFTL-VLFTVTTCNSLVSQIPDVSRGQR 972

Query: 417  AASRLFELTDRKPSISP---------TVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNL 467
            AAS +  + D                T+ H+   D  +IE ++++F YP  P V ++++L
Sbjct: 973  AASWVLRIIDENEYTKEVNGEDCRVETIEHENDSD-PLIEIENLNFHYPNTPGVNVYQDL 1031

Query: 468  NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIV 527
            N KI  G ++ +VG SG GKST+  LL + Y+     I I+  DI+  +   LR  I +V
Sbjct: 1032 NLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVV 1091

Query: 528  QQEPVLMSGTIRDNITYGLTY-TPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL 585
            +Q+P L  GTIR+NITYG++   P  E E++ + +    H F+   P   DTV+     L
Sbjct: 1092 EQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDIG--L 1149

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA-- 643
            LSGGQ QR+ I R L++KP +LILDE TS+LD ++   +      L       I++I   
Sbjct: 1150 LSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVIT 1209

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            H    ++    ++VL   G VVE G+F +L+
Sbjct: 1210 HNRQMMQCCSRLVVLDV-GRVVEDGQFDDLH 1239

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 132/543 (24%), Positives = 256/543 (47%), Gaps = 43/543 (7%)

Query: 195 LSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI 254
           L ER   R+R+ ++++ L +  E++D      L   L  D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 255 CG----VVGVGMMC---SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 V  + ++C     S QL++++L  +P ++  A+ F + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAI---RDIFQVGXXXXXXXXXXXXXXSLLGDL 364
            +    +   +TV+    +  E+ ++   +    D F                 + +G L
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYF---------IRTSLFTAANIGIL 257

Query: 365 SFLTV------LAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ-GAG 416
            FLT+        +GS ++ + +L+I D +T F  Y+     ++   +  +   +Q G  
Sbjct: 258 RFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQV 315

Query: 417 AASRLFELTDRKPSI-SPTVGHKYKPDRGV-IEFKDVSFSYPTRPSVQIFKNLNFKIAPG 474
           A +++ +  +  P + S T+         V I   +++F+YP+RP+  + KN++ KI   
Sbjct: 316 ALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSA 375

Query: 475 SSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM 534
            +  IVG SG GKSTI  L++++Y    G I + ++DI  +    L ++I +V+Q   L 
Sbjct: 376 RTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLF 435

Query: 535 SGTIRDNITYGLTYTPTKEE---IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
           + T+++NI  G  YT        + S+       + I+  P+  +T +G  G  LSGGQ+
Sbjct: 436 NDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQ 495

Query: 592 QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRR 651
           QR+A+ARA ++   ILILDEA SALD+     +     ++ ++K+  I++  H L+ I  
Sbjct: 496 QRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQIND 553

Query: 652 SENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNE 711
           ++  I L  +  + E G  K L  +  +    + N +     +D +     + +K+++ E
Sbjct: 554 ND-YIYLFENNEIKENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKDEVYE 612

Query: 712 SKE 714
            K+
Sbjct: 613 KKD 615

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 162/572 (28%), Positives = 257/572 (44%), Gaps = 84/572 (14%)

Query: 154  DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
            D F  + P F + LY F  FF+  L     + F     + +LS + +  LRA  +K+ LH
Sbjct: 956  DKFKNRAPSFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILH 1009

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQ 269
                + D   +G +++R   D    + S+  ++++ V+ L+     +VGV +MC +  P 
Sbjct: 1010 TPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVGVCIMCIIYLPW 1065

Query: 270  LSILLLFFTPPVLFSASVF-GKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFV 324
             +I +     P LF   V      +++ ++++  EA  +  +     E L G+ T++S+ 
Sbjct: 1066 FAIAI-----PFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYR 1120

Query: 325  AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----- 379
            +E   +++ +  I  + + G                     FL V+A    L++      
Sbjct: 1121 SENRFIAKSDFLIDKMNEAGYLVVAVQRWVAI---------FLDVIAVCFALIITLLCVT 1171

Query: 380  -----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKP 429
                 S  S+G L  ++L      N V    T     M  A      A     E   RKP
Sbjct: 1172 RAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKP 1231

Query: 430  SISPTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
             +SP    +  P +G I F++V FSY P  P+V   KNL+  I  G  + I G +G GKS
Sbjct: 1232 EVSPP---EEWPTKGEIHFENVDFSYRPGLPTV--LKNLSLDIKSGEKIGICGRTGAGKS 1286

Query: 489  TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN------- 541
            TI   L R    ++G + ID+ DIS +    LRR + I+ Q+PVL  GTIR N       
Sbjct: 1287 TIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEH 1346

Query: 542  ---------ITYGLTYTPTKEEIRSVA-KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQK 591
                     +  G        EI++    +   H+ + KF    D ++   G   S G++
Sbjct: 1347 QDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGER 1404

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINY----TFGQLMKSKSMTIVSIAHRLS 647
            Q +A+ RAL+++  ILILDEATS++D E++G I       FG        TI+ IAHRL 
Sbjct: 1405 QLLALTRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TILCIAHRLK 1458

Query: 648  TIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            TI   + ++VL   G V E    K L+A   S
Sbjct: 1459 TILTYDRILVL-EKGEVAEFDTPKTLFAQEDS 1489

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 115/223 (51%), Gaps = 21/223 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F +LNF+I  G  + +VGP G GK+++      + N  +G I I N D+  L C      
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQI-NGDL--LLCGY---- 701

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + +++DNI +G  Y   K +   V + C   + +   P    T IG  G
Sbjct: 702 -------PWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            H+LS + R+  VIVLG+DGS  ++G  +EL    +S L  LL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL-KQRSSTLVNLL 851

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 137/520 (26%), Positives = 235/520 (45%), Gaps = 36/520 (6%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHK---- 223
            + FL  FT++    C  N+ R +           RLRA   K   +++  +F++ +    
Sbjct: 789  FTFLKCFTLS---KCGENWIRAL-----------RLRA--FKNISNRELAWFNSEQNSTS 832

Query: 224  -VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVL 282
             V  L+     D   ++      V+  V    CG++      +   +LS++ +   P  +
Sbjct: 833  NVSSLVINDLRDLRALASEFLAAVTTLVVVSFCGLIWA---LASGWKLSLVCISLIPAFI 889

Query: 283  FSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 342
                 +G  ++    + + A   +       +  IKT++    E   +  Y V       
Sbjct: 890  LFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKL 949

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 402
             G              + L  ++   +L YG  LV+  + S   +   +    +T     
Sbjct: 950  AGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCM 1009

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPT--VGHKYKPDRG-----VIEFKDVSFSY 455
             L     EI +G  AA+ LF + D +   +     G      RG     +I  KD+ FSY
Sbjct: 1010 SLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSY 1069

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKL 515
                +  +++ LN  +  G +V +VG SG GKST+  L+ R Y   +G+I  D  D+++ 
Sbjct: 1070 SFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEW 1129

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
               +LR+ I +V+Q P L  G+I DN+TYGL+ +  + EIR + +     +F+   P   
Sbjct: 1130 EEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGL 1189

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
             + I     +LSGGQ QR+AI RAL++KP +L+LDE TSALD +  G I   F +   S+
Sbjct: 1190 QSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQ 1245

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
            S T + + H    + R+ N I+   +G+++E G F+ LY+
Sbjct: 1246 STTTLVLTHS-EQMMRACNRILTFANGNIIEDGSFERLYS 1284

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 130/507 (25%), Positives = 226/507 (44%), Gaps = 27/507 (5%)

Query: 195 LSERVVARLRANVIKKTLHQDAEFFD-NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
           L ER   RLR  +++  L +   ++D N ++    ++L      +  S  +  +   + +
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNV 158

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           +     +G     S  L+++++  +P V+  A  F +++   +K     T          
Sbjct: 159 VTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWS 218

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           L   K V+    +  EL+R+   ++   Q                  L    F+    YG
Sbjct: 219 LDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYG 278

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFELTDR 427
           +     S+++IG L    + T ++ + V   ST  S + Q      GA    ++    + 
Sbjct: 279 N-----SRINIGKLKPGDVVTCFS-SCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNS 332

Query: 428 KPSISPTVGHKYK---------PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           + + S +  +K +          +R  I F++V F+YPTRP   + K ++     G +  
Sbjct: 333 RDA-SESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTF 391

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTI 538
           ++G SG GKSTI  LLL +Y   +GTI ++ QD+ ++N   L R+I +V+Q   L + T+
Sbjct: 392 VIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETL 451

Query: 539 RDNITYGLTYTPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIA 597
            +N+T G       E  ++   +     N I       +T IG  G  LSGG++QR+A+A
Sbjct: 452 ANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALA 511

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 657
           RA  +   ILILDEA SA D   +  +     +    K+  I++  H LS I  ++ V V
Sbjct: 512 RAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILT--HELSDILDTDYVYV 569

Query: 658 LGHDGSVVEMGKFKELYANPTSALSQL 684
           +  DG + E G    L +NP S  S L
Sbjct: 570 MS-DGQIREHGYKSGLLSNPKSEFSNL 595

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  158 bits (400), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 256/549 (46%), Gaps = 58/549 (10%)

Query: 171  LSFFTVALLIGCA-ANFGRFILL--RILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            + + ++  LIG A A  G   +L    L  +   ++  +++KK +H    FFD+  +G +
Sbjct: 1106 MYYLSIYFLIGIAQALLGSLKVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRI 1165

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSILLL-----FFTPPV 281
            ++R   D   + + +   V     +L+  V  + ++  ++PQ LS+ +L     +     
Sbjct: 1166 MNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIGYF 1225

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG----NELSRYNVAI 337
              +AS   K+  + +K        + +   E L G+ T+++F  EG      LS+ +   
Sbjct: 1226 YLAASREFKRFDSITK------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENN 1279

Query: 338  RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQLSIGDLTAFMLYTEY 396
            R  F +               +L+       V   GS+++     +  G     + Y   
Sbjct: 1280 RPFFYLWVANRWLSFRIDMVGALV-------VFGSGSFIIWNIKNIDAGMAGISLTYAIS 1332

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKYK-PDRGVIEFKDVSF 453
                   L   YS +     +  RL E    +++P    T     + P  G IE  D+S 
Sbjct: 1333 FTEGALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSL 1392

Query: 454  SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
             Y      ++ KN+ F +AP + + IVG +G GKSTI   L R+ +P TG I IDN DI+
Sbjct: 1393 RYAEGLP-RVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDIT 1451

Query: 514  KLNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGL-----TYTPTK------EEIRS-VAK 560
             +N   LRR I I+ Q+P L +GTI+ N+  YG       +T  +      E++ S +  
Sbjct: 1452 SINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIET 1511

Query: 561  QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            +      + KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S
Sbjct: 1512 ESISSQNVNKFLNL-NNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNS 1570

Query: 621  EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680
            +  I  T  +  +  S TI++IAHRL ++   + ++V+       + G+ KE Y +P S 
Sbjct: 1571 DAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYSL 1620

Query: 681  LSQLLNEKA 689
               LLN+K+
Sbjct: 1621 ---LLNKKS 1626

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 139/552 (25%), Positives = 241/552 (43%), Gaps = 74/552 (13%)

Query: 170 FLSFFTVALLIGCAANFGRFILLRI----LSERVVARLRANVIKKTLHQDAEFFDNHKV- 224
           FLS   V++  G A   GR + +RI    +SE     LR  V  K+    AE  D   V 
Sbjct: 412 FLSRILVSICEGQALFLGRRVCIRIKSIVISEIYNKALRRKVSVKSNKVSAEDLDPQDVN 471

Query: 225 -------------------GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 265
                              G +I+ +  DA+ VS  +   +   V+A +  ++ + ++  
Sbjct: 472 EQKHIDGDEESSDPSSANLGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYR 530

Query: 266 L--SPQL--SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGI 317
           L  S  +  +I++L   P   + A++ GK        +Q+AT  +T  R+ +  E L  I
Sbjct: 531 LIGSSAIIGTIVILIAAPANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAI 582

Query: 318 KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLAYGSY 375
           + ++ F  E N    +  +I D+ +                S +  +  S +T  A+  Y
Sbjct: 583 RIIKFFSWEDN----FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFAFY 638

Query: 376 LVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL---TDRKPS 430
           + +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ +    TD    
Sbjct: 639 IYVQKEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKY 697

Query: 431 ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFK----NLNFKIAPGSSVCIVGPSGRG 486
              TV     P    +EFK+ + S+ +  S Q FK    N++FKI  G    ++GP+G G
Sbjct: 698 DQLTVA----PQGDQLEFKNTTVSWDS--SAQDFKLKDLNIDFKI--GKLNVVIGPTGSG 749

Query: 487 KSTIALLLLRYYNPTTGTI---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNIT 543
           K+++ + LL       G I   ++D ++   ++       I    Q   L++ T+R+NI 
Sbjct: 750 KTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNIL 809

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKK 603
           +   Y   +    SV + C              T IG  G  LSGGQKQR+++ARA+   
Sbjct: 810 FNSPYNEAR--YTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSN 867

Query: 604 PTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
              ++LD+  SA+D  +   I  N   G LM  ++  +VS  H ++   ++ +++V+  D
Sbjct: 868 SRHILLDDCLSAVDSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILED 925

Query: 662 GSVVEMGKFKEL 673
           G V + G   EL
Sbjct: 926 GKVKDQGDPMEL 937

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 134/512 (26%), Positives = 239/512 (46%), Gaps = 36/512 (7%)

Query: 183  AANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSR 240
            A  F +  +L    E  +  LR N  +  + +D  +F   N+   ++ S + +D     R
Sbjct: 787  AFTFLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----R 842

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSL------SPQLSILLLFFTPPVLFSASVFGKQIRN 294
             +    S+ + AL    + V  +C L        +LS++ +   P  +  + ++G  ++N
Sbjct: 843  DLRALASEFLAAL--STLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQN 900

Query: 295  TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
                 +    +L     + +  +KT++    E N+++R +  + ++   G          
Sbjct: 901  YEARYKTCIAELENELYKAIRCMKTIKCLQME-NKVAR-SYEMLEVTSKGAARKRAMGTG 958

Query: 355  XXXXSLLGDLSFLT---VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEI 411
                S    L+F+T   +L +G  LV+  + + G +   +    +T      L +   EI
Sbjct: 959  FGVASS-NALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEI 1017

Query: 412  MQGAGAASRLFELTDRKPSISPTV-GHKYKP------DRGVIEFKDVSFSYPTRPSVQIF 464
             +G  AA+ LF+L   +     +V   ++ P       + +I  K + FSY    +  ++
Sbjct: 1018 SRGQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVY 1077

Query: 465  KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHI 524
            KNL+ K+  G  V ++G SG GKST+  LL R Y    G+I+ID  DI++ + K+LR  I
Sbjct: 1078 KNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCI 1137

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGT 584
             +V+Q+P+  SG+I +N+TYGL    + EE+  +        F+   P    +VI     
Sbjct: 1138 AVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ-- 1195

Query: 585  LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSI 642
            LLSGGQ QR+AI RAL++KP +L+LDE TSALD       ++   + +K      T + +
Sbjct: 1196 LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVV 1251

Query: 643  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             H    +R    ++   + G +VE G    L+
Sbjct: 1252 THSEQMMRSCHRILTF-NKGEIVEEGSIDNLF 1282

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 153/597 (25%), Positives = 260/597 (43%), Gaps = 51/597 (8%)

Query: 114 RDWKXXXXXXXXXXXSCSIGMSI-PKVIGIVLDTLKTSSGSDFFDLKIPIFSL-----PL 167
           RDW             CS+   I P V  I++       G+ F  L+ P+         L
Sbjct: 24  RDWWLLMIISI-----CSVAYGIVPAVTSILM-------GAVFNLLQKPVIQQFDSVNTL 71

Query: 168 YEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRANVIKKTLHQDAEFFD-N 221
              L+  T+A+LI   A+   F  L I     L ER   RLR  +++    +   ++D N
Sbjct: 72  MRDLTIRTMAILITGIASIP-FCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDIN 130

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPV 281
            ++    ++L      +  S  +  +   + L+  +  +G     S  L+++++  +P V
Sbjct: 131 EQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLV 190

Query: 282 LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           +  A    + +    K     T     +    L+  K V+    +  E++++  ++    
Sbjct: 191 IGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCR 250

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNA 400
                              L    F+    YG+  +    L  GD +T F        + 
Sbjct: 251 MNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF-------SSC 303

Query: 401 VFGLSTFYSEIMQ------GAGAASRLFEL--TDRKPSISPTVGHKYKP---DRGVIEFK 449
           +   ST  S + Q      GA    ++ E   +D        V   + P   ++  I F+
Sbjct: 304 ILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFE 363

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           +VSF+YP+R    + KNLN K+  G    IVG SG GKSTI+ LLL+ Y P +G I +++
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVND 423

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNF 567
            DI ++N + L R I +V+Q   L   +I++NI   LT    +++ R     +       
Sbjct: 424 VDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQACQAAMLEGV 481

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I       DT+IG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +   
Sbjct: 482 IRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEA 541

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
                K ++  I++  H L+ I   ++ ++L  DG+V+E G+  +L ++ TS  S L
Sbjct: 542 IRFWRKGRTTIILT--HELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLL 595

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 156/554 (28%), Positives = 249/554 (44%), Gaps = 66/554 (11%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            F + LY   SFF  A   G      +F LL  +  R    L    + + LH    + D  
Sbjct: 950  FYMGLY---SFFVFA---GYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTT 1003

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++++ ++ ++     +VGV +MC +  P  +I +    
Sbjct: 1004 PLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAI---- 1055

Query: 279  PPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
            P +    ++     ++T ++++  EA  +  +     E L G+ T++S+ +E   L++ +
Sbjct: 1056 PFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSD 1115

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGD-LSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              I  + + G               L+    + +  L   +     S +S+G L  ++L 
Sbjct: 1116 YLINKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQ 1175

Query: 394  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGVIEF 448
                 N V    T     M  A      A+ L  E   R+P +SP    +  P  G IEF
Sbjct: 1176 LPGLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPP---ENWPSEGKIEF 1232

Query: 449  KDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI 507
            K V FSY  RP + I  K+L+  I  G  + I G +G GKSTI   L R    + G I I
Sbjct: 1233 KHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILI 1290

Query: 508  DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE---------IRSV 558
            DN DISKL    LRR + I+ Q+PVL  GTIR N+       P  E          +R  
Sbjct: 1291 DNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDDLLWDSLVRGG 1344

Query: 559  AKQCFCHNFITK------------FPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
            A +    N I              F    D ++   G   S G++Q +A+ RAL+++  +
Sbjct: 1345 AIERAALNKIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLALTRALVRQAKV 1404

Query: 607  LILDEATSALDVESEGAINYTFGQLMKS-KSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
            LILDEATS++D E++G I     +++K     TI+ IAHRL+TI   + ++VL   G V 
Sbjct: 1405 LILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVA 1460

Query: 666  EMGKFKELYANPTS 679
            E  K K L+    S
Sbjct: 1461 EFEKPKVLFDQEDS 1474

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 102/206 (49%), Gaps = 20/206 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F ++   I  G  + +VGP G GK++    L  + N T G I + N D+  L C      
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQV-NGDL--LLCGY---- 679

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   K E   V + C     +   P    T IG  G
Sbjct: 680 -------PWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMG 668
            H+LS + R+  VIVLG DGS  E+G
Sbjct: 790 -HQLSLLERASRVIVLGTDGS-FEIG 813

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 141/544 (25%), Positives = 259/544 (47%), Gaps = 64/544 (11%)

Query: 173  FFTVALLIGCAANF---GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLIS 229
            + ++  LIG   +     + +L  +L  R   ++  +++ +TLH    FFD   +G +++
Sbjct: 1108 YLSIYFLIGLTQSLLAASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMN 1167

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSILLL-----FFTPPVLF 283
            R   D   V + +T  +      L+  +  + ++  ++PQ LS+ +L     +       
Sbjct: 1168 RFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYM 1227

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
            +AS   K+  + SK        + +   E L G+ T++++   G+E SR+   + ++ ++
Sbjct: 1228 AASRELKRFESISK------SPIYQHFSETLVGVATIRAY---GDE-SRF--MLENLHKI 1275

Query: 344  GXXXXXXXXXXXXXXSL---LGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTE 395
                            L   +  +    +   G +++     + S ++   LT  + +TE
Sbjct: 1276 DENNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE 1335

Query: 396  YTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKP--SISPTVGHKYKPDRGVIEFKDV 451
                    L  FY+++     +  RL E  +  ++P      T+ H   P  G IE KD+
Sbjct: 1336 ----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDL 1391

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            S  Y P  P  ++ KN++F + P + + IVG +G GKSTI   + R+ NP +G I ID+ 
Sbjct: 1392 SLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDV 1449

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIRS 557
            +I+ +N   LRR I I+ Q+P L +GTI+ N+     +T              T+EE+++
Sbjct: 1450 NIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQN 1509

Query: 558  VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
               Q        KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D
Sbjct: 1510 NGTQTGTSENANKFLNL-ENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASID 1568

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANP 677
              S+  I  T  +  +    TI++IAHRL ++   + +IV+       + G+ KE Y +P
Sbjct: 1569 YASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-------DAGEVKE-YDHP 1618

Query: 678  TSAL 681
             S L
Sbjct: 1619 YSLL 1622

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (48%), Gaps = 11/229 (4%)

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           I FK+V+ ++         ++LN +  PG+   ++GP+G GK+++ L LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 506 TID----NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
            +      QD+  ++   L   I    Q   L++ T+R+NI +   Y   +E   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDA 827

Query: 562 CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +     +  T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 622 GAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             I  N   G LM  ++  +VS  H ++   ++  ++V+  +G V + G
Sbjct: 888 LWIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILENGRVKDQG 934

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 154/571 (26%), Positives = 250/571 (43%), Gaps = 75/571 (13%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            Y    +FT+      A      IL    + +   +L +++          FF+   +G +
Sbjct: 984  YYLFIYFTLGFASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGRI 1043

Query: 228  ISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLF 283
            ++R  +D Y    ++ RS +Q   + ++     VV    +CS + Q     +F   P+ F
Sbjct: 1044 LNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVV----ICSTTWQF----IFLIIPMAF 1095

Query: 284  SASVFGKQIRNTSKDLQEATGQ----LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
                + +    TS++L+         L    +E L G+ T++ F A+ +     N +   
Sbjct: 1096 LYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGF-AQQDRFIHINQS--- 1151

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
              +V                L   L FL +++  G+  +   +L  G LTA M+      
Sbjct: 1152 --RVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMI------ 1203

Query: 399  NAVFGLSTFYS-EIMQGAGAASRL-------------FELTDRKPSISPTVGHKYKPD-- 442
                GLS  Y+ ++ Q      R+              E     PS +P +    +P   
Sbjct: 1204 ----GLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEE 1259

Query: 443  ---RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
               +G IEFK+ S  Y  RP +  + KN+N KI P   V IVG +G GKS++ L L R  
Sbjct: 1260 WPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRII 1317

Query: 499  NPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
              ++G+I ID  +I++L    LR  + I+ Q+  +  G+IR+NI    T   +++EI + 
Sbjct: 1318 EASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNA 1375

Query: 559  AKQCFCHNFITKF---------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKK 603
             +       I K                 N  D  I   G+ LS GQ+Q I +ARAL+  
Sbjct: 1376 LEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVP 1435

Query: 604  PTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
              +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +IVL  +G 
Sbjct: 1436 SNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLD-NGE 1492

Query: 664  VVEMGKFKELYANPTSALSQLLNEKAAPGPS 694
            V E  K + L  N  S    L  E     P+
Sbjct: 1493 VAEFDKPEILLTNKNSLFYSLCYESGVLKPN 1523

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 119/249 (47%), Gaps = 18/249 (7%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           + +F +  +P  ++  KN+NF+   G   CIVG  G GKS     +L       G     
Sbjct: 619 NATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKG----- 673

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                     S+  ++  V Q   +M+GT++DNI +G  Y P  E      K C     +
Sbjct: 674 --------FASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTIDL 723

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
           +  P+   T++G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I   
Sbjct: 724 SILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNV 783

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            G     KS T +   +++  +  ++++ +L  +G + E G + ++ A   S+LS+L+ E
Sbjct: 784 LGAKGLLKSKTRILTTNKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLITE 842

Query: 688 KAAPGPSDQ 696
                 S +
Sbjct: 843 YGKKKDSSE 851

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 141/536 (26%), Positives = 246/536 (45%), Gaps = 56/536 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            +++K LH    FFD+  +G +++R   D   V + +T        +L+  +  V ++  +
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +PQ  I+ +       F    +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDE 1301

Query: 327  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQ 381
                   L + +   R  F +                L+G L    V   G +++L    
Sbjct: 1302 SRFIQENLHKIDENNRPFFYLWVANRWLAMRI----DLIGSL---VVFGAGVFILLNIDH 1354

Query: 382  LSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPSISPTV 435
            +  G     LT  + +TE        L   YS +     +  RL E  + +++P   P +
Sbjct: 1355 IDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIM 1410

Query: 436  GHKYK-PDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALL 493
                  P  G +E  DVS  Y P  P  ++ KN++F + P S V +VG +G GKSTI   
Sbjct: 1411 TPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITA 1468

Query: 494  LLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--- 550
            L R+ +P TG I IDN DIS ++ + LRR I I+ Q+P L +GTI+ N+     Y+    
Sbjct: 1469 LFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDI 1528

Query: 551  ----------TKEEI--RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
                      ++EE+   ++         + KF +  ++ I   G  LS GQ+Q + +AR
Sbjct: 1529 FAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQRQLVCLAR 1587

Query: 599  ALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            +L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL ++   + ++V+
Sbjct: 1588 SLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM 1645

Query: 659  GHDGSVVEMGKFKELYANPTSAL----SQLLNEKAAPGPSDQQLQIEKVIEKEDLN 710
                   + G+ KE Y +P S L    SQ  +   + G  +  +++ K    E LN
Sbjct: 1646 -------DQGEVKE-YDHPYSLLLNKNSQFYSMCESSGELEVLIELAKEAFVEKLN 1693

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 122/523 (23%), Positives = 214/523 (40%), Gaps = 42/523 (8%)

Query: 177 ALLIGCAANFGRFILLR----ILSERVVARLRANVIKKTLHQDAEFFD-------NHKVG 225
           A+  G A  FGR + ++    I+SE     LR  V   +  Q  +  D        H+ G
Sbjct: 458 AIFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELNEEEHRDG 517

Query: 226 D-----------LISRLGSDAYVVSR--SMTQKVSDGVKALICGVVGVGMMCSLSPQLSI 272
           D           +I+ +  DA+ VS   +      + V      +V +  +  LS  +  
Sbjct: 518 DEESGTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGA 577

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           LL+    PV F    +  Q++  S      T +  +   E    I+ ++ F  E N   +
Sbjct: 578 LLIVVLMPVNFRLVTWLGQLQKKSLSY---TDKRIQNLNEAFQAIRIIKFFSWEDN-FEK 633

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
              AIRD+ ++                     + +T  A+  Y+ +Q Q ++    AF  
Sbjct: 634 GIQAIRDV-ELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQ-TLTTPVAFTA 691

Query: 393 YTEYT--GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKD 450
            + ++     +  LS   S ++Q   +  R+ E  + +P           P    + F++
Sbjct: 692 LSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFEN 750

Query: 451 VSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI--- 507
            + S+ +       +NLN     G    ++GP+G GK++I + LL       G I +   
Sbjct: 751 ATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSL 810

Query: 508 DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
           D + +  ++   +   I    Q   L++ T+R+NI +   Y+  +     V + C     
Sbjct: 811 DPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEAR--YNDVIEACGLKRD 868

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--N 625
                    T IG  G  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N
Sbjct: 869 FEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDN 928

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
              G LM+ +  T + I+H ++   R+  ++VL  +G V E G
Sbjct: 929 CITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 148/545 (27%), Positives = 250/545 (45%), Gaps = 46/545 (8%)

Query: 168  YEFLSFFTVALLIGCAA----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHK 223
            Y  L F  V   IG       N     +L   S R   +L   + K  +     FF+   
Sbjct: 989  YNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP 1048

Query: 224  VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLF 283
             G +I+R  SD   V  ++    S   ++++  ++ V ++    P   +L        L+
Sbjct: 1049 TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYLY 1108

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
              S +    R   +    +   +  +  E LSG  T+ ++     ++ R++    +  Q 
Sbjct: 1109 YQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQF 1164

Query: 344  GXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTG 398
                           S+ L  +  L VL+ G    S L    QLS G +   M Y     
Sbjct: 1165 SINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVT 1224

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK-----PDRGVIEFKDVSF 453
            +++  +      I     +  R+ E  D  P  +P V  +++     P++G IEFK+ S 
Sbjct: 1225 SSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYST 1283

Query: 454  SYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDI 512
            SY  R ++  + K++N  I+PG  + +VG +G GKST+++ L R   PT GTI+IDN DI
Sbjct: 1284 SY--RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDI 1341

Query: 513  SKLNCKSLRRHIGIVQQEPVLMSGTIR-----------DNITYGLTYTPTKEEIRSVAKQ 561
            + +  + LR HI I+ Q+     GTIR           D++ + +  +  K  + ++AK+
Sbjct: 1342 TSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKE 1401

Query: 562  CFC---HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                  ++  ++  +  D  +   G+ LS GQKQ + +ARAL+ K  IL+LDEAT+++DV
Sbjct: 1402 INDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDV 1461

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT 678
            E++  I  T  +    +  TI++IAHRL T+  S+ +IVL  DG     G+ KE +  P 
Sbjct: 1462 ETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL--DG-----GEVKE-FDKPE 1511

Query: 679  SALSQ 683
            + L Q
Sbjct: 1512 TLLEQ 1516

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 120/240 (50%), Gaps = 21/240 (8%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS---KLNCKSLRRHI 524
           NF++   S +C+VG  G GKSTI   +L      +G    +N  +S   ++N  +    +
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG----NNDHLSPQFQINATT----V 690

Query: 525 GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGT 584
               QE  +M+ +++DNI +G  Y   +   ++  K C     I   P+  +T++G  G 
Sbjct: 691 AYCPQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGI 748

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIV 640
           +LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS  IV
Sbjct: 749 VLSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IV 806

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT-SALSQLLNEKAAPGPSDQQLQ 699
              + +S ++ S  + +L  + S+ + G + ++  N   S L  +L+E     P    +Q
Sbjct: 807 LATNTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHEFDLEKPDTPAVQ 865

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  152 bits (384), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 227/500 (45%), Gaps = 59/500 (11%)

Query: 202  RLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            R+   ++ K LH    F D+  +G +++R   D   V + +T  +     A  C V  + 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLE---AAFFCLVQCIS 1197

Query: 262  MMCSLSPQLSILLLFFTPPVLFSA-------SVFGKQIRNTSKDLQE----ATGQLTRVA 310
             +        IL+ F TP  LF A        + G    NTS++L+         + +  
Sbjct: 1198 TI--------ILITFITPQFLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHF 1249

Query: 311  EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
             E L+G+ T+++F   G+E+      +  I +                  +  +  L + 
Sbjct: 1250 SETLTGVATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIF 1306

Query: 371  AYGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
              G +++L      S ++   LT  + +TE        L  FYS +     +  RL E  
Sbjct: 1307 GSGVFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYM 1362

Query: 426  D--RKPSISPTVGHKYK-PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            D  ++P    T+      P  G IE KD+S  Y      ++ K ++F I P + V IVG 
Sbjct: 1363 DVPQEPYNEGTITTSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGR 1421

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+  P TG+I ID  DI+ ++ ++LRR I I+ Q+P L +GTIR N+
Sbjct: 1422 TGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNL 1481

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHN----------------FITKFPNTYDTVIGPHGTLL 586
                 Y P +E  R + +     +                 + KF N  +  I   G  L
Sbjct: 1482 DPFGKY-PDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNL 1539

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRL 646
            S GQKQ + +ARAL++ P +++LDEAT+++D  S+  I  T   +      T+++IAHRL
Sbjct: 1540 SQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRL 1597

Query: 647  STIRRSENVIVLGHDGSVVE 666
             ++   + ++V+   G V+E
Sbjct: 1598 RSVIDYDKILVMDA-GEVIE 1616

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 109/459 (23%), Positives = 198/459 (43%), Gaps = 30/459 (6%)

Query: 224 VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---SPQLSILLLFFTPP 280
           +G +I+ +  DA+ VS  +   +   ++A++  VV   ++  L   +  + IL++    P
Sbjct: 494 IGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMIP 552

Query: 281 VLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           V F   S+ GK      K     T +  +   E L  I+ ++ F  E N  S     I +
Sbjct: 553 VNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSE----IDE 604

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIG--DLTAFMLYTE 395
           I +                + +  L+   +T  ++  Y+ +Q Q+       TA  L+ +
Sbjct: 605 IREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFTVYIYVQKQVLTAPVAFTALALF-Q 663

Query: 396 YTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSY 455
                +  LS   S ++Q   +  R+    D + +       K  PD   + F++ + ++
Sbjct: 664 LLKQPLDQLSNMLSYVIQSKVSLDRVQNFLDEEDT-QKYNQLKVAPDGNKLAFENATIAW 722

Query: 456 PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK- 514
                    K+L+     G    ++GP+G GK+++ L LL      +G I + + D    
Sbjct: 723 SNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHE 782

Query: 515 --LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQCFCHNFITKF 571
             ++   +   I    Q   L++ T+R+NI   L Y+P  E+  + V   C        F
Sbjct: 783 MLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFELF 839

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFG 629
                T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   G
Sbjct: 840 DAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITG 899

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LM+ ++  +VS  H ++   ++  ++V+  +G +   G
Sbjct: 900 PLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 144/534 (26%), Positives = 245/534 (45%), Gaps = 43/534 (8%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L  ++ K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   +      + F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L   + LT+    +    + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLAT-AMLTLATMNT----KKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFELTDRKPSISPTVGHKYKPD-----RGVIEFKDVSFSYPTRPSVQ-IF 464
            I     +  R+ E  +  PS + ++  + +PD     RG IEFKD S  Y  R ++  + 
Sbjct: 1263 IETNIVSVERIVEYCEL-PSEAQSINPEKRPDKNWPSRGSIEFKDYSTKY--RENLDPVL 1319

Query: 465  KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHI 524
            K++N KI P   V IVG +G GKST++L L R   PT G I ID  +IS L    LR H+
Sbjct: 1320 KDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHL 1379

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF------------- 571
             I+ Q+     GT++ N+     Y  +++E++   +       + K              
Sbjct: 1380 AIIPQDAQAFEGTVKTNLDPFNRY--SEDELKKAVELAHLKPHLEKMLENEPSDSEESCD 1437

Query: 572  -PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQ 630
              +  D  I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  T  +
Sbjct: 1438 IKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRR 1497

Query: 631  LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
              K +  TI++IAHR+ T+  S+ +IVL  +GSV E     +L +N  S    L
Sbjct: 1498 EFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 158/328 (48%), Gaps = 46/328 (14%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYKPDRGVIEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P+V  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKNLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  KN++ F+   G+ VCIVG  G GKS
Sbjct: 620 ITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKS 679

Query: 489 TIALLLLRYYNPTTGTITIDNQDIS-KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
           T    +L      +G+     + I  KL  +S    +    QE  +M+ ++++NI +G  
Sbjct: 680 TFLKAILGQLPCMSGS----KESIPPKLIIRS--SSLAYCSQESWIMNASVKENILFGHK 733

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
           +     ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I 
Sbjct: 734 FDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIY 791

Query: 608 ILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ +  L  +G +V
Sbjct: 792 LLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIV 850

Query: 666 EMGKFKELY--ANPTSALSQLLNEKAAP 691
           E G +  +    N TS L +LL E  +P
Sbjct: 851 EQGNYDSVMNRENSTSKLKKLLEEFDSP 878

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 153/558 (27%), Positives = 242/558 (43%), Gaps = 60/558 (10%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQD 215
            F  + P F + LY   SFF  A  I     F     + I++ + +  LRA  +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKWL-NLRA--VKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSI 384
              I  + + G                     FL ++A    L++           S  S+
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASV 1149

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTVGHKY 439
            G L  ++L      N +    T     M  A      A     E + RKP ++P    + 
Sbjct: 1150 GVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPP---ES 1206

Query: 440  KPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G I F++V F+Y  RP + I  KNLN  I  G  + I G +G GKSTI   L R  
Sbjct: 1207 WPSMGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 499  NPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 550
              T G I IDN DIS+L    LRR + I+ Q+PVL  GTIR N+      T         
Sbjct: 1265 ELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALV 1324

Query: 551  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
                  K+++  V  Q       H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKELYANPTS 679
            G V E      L++   S
Sbjct: 1440 GEVAEFDTPWTLFSQEDS 1457

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/228 (31%), Positives = 113/228 (49%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S + FK+LNF I  G  + I GP G GKS++   +      T G + + N D+  L C
Sbjct: 598 KTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEV-NGDL--LMC 654

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + ++RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             + +  H+LS I R+  VIVLG DG  V++G   EL A   + ++ L
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLINLL 806

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 143/551 (25%), Positives = 245/551 (44%), Gaps = 54/551 (9%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLI 228
            F  +  LIG A+    N    ILL   + R   +L  N+    ++   +FF+   +G ++
Sbjct: 1006 FVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRIL 1065

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  +D   V  ++        K++   ++ V ++    P   +  LF     ++   +F
Sbjct: 1066 NRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQKLF 1125

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQ 342
              Q R   +    +   +  +  E L G+  +++      F    NE  ++N  I  +F 
Sbjct: 1126 IVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFN--INCVFD 1183

Query: 343  VGXXXXXXXXXXXXXXSLL----GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                            +L+    G LS  T+ +          L+ G +   M Y     
Sbjct: 1184 YRSTNRWLSIRLQTIGALMVLITGMLSLSTISS-------SKPLTAGMVGLLMSYVLQVT 1236

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRGVIEFKDVSF 453
             ++  +      I  G  +  R+ E  +  PS +  +   Y+P      +G I+FK+ S 
Sbjct: 1237 TSLMWIVRSSVMIETGIVSVERIMEYCEL-PSEAEQIVDDYRPASNWPSKGAIQFKNYST 1295

Query: 454  SYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDI 512
             Y  R ++  + KN++  I PG  V IVG +G GKST+ L L R   P  GTI ID  DI
Sbjct: 1296 RY--RANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDI 1353

Query: 513  SKLNCKSLRRHIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQ 561
            SK+    LR H+ I+ Q+     GT+R N           +   +T +  K  ++ + ++
Sbjct: 1354 SKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEE 1413

Query: 562  CFCHNFITKFP-NTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                   ++ P N Y +  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++DVE
Sbjct: 1414 SG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVE 1468

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            ++  I  T  +    +  TI++IAHR+ T+  S+ ++VL   G V E      L A+ ++
Sbjct: 1469 TDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLADKST 1525

Query: 680  ALSQLLNEKAA 690
               QL  EKA 
Sbjct: 1526 LFYQLC-EKAG 1535

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 135/311 (43%), Gaps = 50/311 (16%)

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAV-----------FGLSTFYSEIMQGAGAASRLFELT 425
           ++++ +SIG +  F+L  E   + +           F +    +  +  + A+ +  + T
Sbjct: 576 IIETNVSIGRVKKFLLGEELDRSFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGT 635

Query: 426 DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
           D + SI  TV          +  KD+ F               F+       C+VG  G 
Sbjct: 636 DEETSIGSTV----------VALKDIDF---------------FRAKKNVLTCVVGRVGS 670

Query: 486 GKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           GK+T+   +L     T+G+         KL  +     +    QE  +M+ +I++NI +G
Sbjct: 671 GKTTLLKSILGQLPCTSGS---QKAIPPKLIIRG--ESVAYCPQEAWIMNDSIKENILFG 725

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPT 605
             Y  T   +    K C         P+  +T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 726 HRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQKARLSLARAVYSRSD 783

Query: 606 ILILDEATSALDVESEGAINYTF----GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           I +LD+  SA+D     +I +        L+K+K+  I+   + +S +  S+ + VL  D
Sbjct: 784 IYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILTTNDISVLEHSDRIYVL-QD 840

Query: 662 GSVVEMGKFKE 672
           G ++E   + E
Sbjct: 841 GRIIEESTYAE 851

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 140/511 (27%), Positives = 238/511 (46%), Gaps = 66/511 (12%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            V+KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +P   ++ +F    + F   + G      S++L+     +   + +   E L GI T+++
Sbjct: 1198 TPGFLVVAIF----IGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRA 1253

Query: 323  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ--- 379
            F   G+E       ++ I +                  +  +    V A G +++L    
Sbjct: 1254 F---GDERRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKK 1310

Query: 380  --SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPS----I 431
              S L+   LT  + +TE        L   YS +     +  RL E  + +++PS     
Sbjct: 1311 LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAF 1366

Query: 432  SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIA 491
            +P +     PD+G IE  D+S  Y T    ++ KN++F + P   V IVG +G GKSTI 
Sbjct: 1367 NPPIEW---PDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTII 1422

Query: 492  LLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
              L R+ +P TG I IDN DI+ +  K LR+ I I+ Q+P L SGT++ N+     Y  T
Sbjct: 1423 TALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEY--T 1480

Query: 552  KEEIRSVAKQCFCHNFIT-----KFPNTYDTV----------------IGPHGTLLSGGQ 590
             E+I    K+    N +T       P++ D                  I   G  LS GQ
Sbjct: 1481 DEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQ 1537

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 650
            +Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I 
Sbjct: 1538 RQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSII 1595

Query: 651  RSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
              + ++V+       + G+ +E Y +P S L
Sbjct: 1596 DYDKILVM-------DAGEVRE-YDHPYSLL 1618

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 133/548 (24%), Positives = 240/548 (43%), Gaps = 70/548 (12%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRANV-----------I 208
           LY F  FF   L+  C A    FGR + +R    I+SE     LR  +           I
Sbjct: 394 LYVFGMFFCRILVAICQAQALFFGRRVCIRMKAIIISEIYTKALRRKISPNSSKVSTDEI 453

Query: 209 KKTLHQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 262
                 + E  D  +      +G +I+ +  DA+ VS  +   +   V+A I  +V + +
Sbjct: 454 DPQALNETEEIDGDEESTTANLGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTL 512

Query: 263 MCSL---SPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
           +  L   +  +  +L+    P+ F  A++ GK      KD    T +  +   E    I+
Sbjct: 513 LYKLLGWAAVIGAILIVCMLPLNFKLANLIGK----LQKDNLGVTDKRIQKLNETFQSIR 568

Query: 319 TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYG 373
            ++ F  E N         RDI  +               +L+  + F+T      +++ 
Sbjct: 569 IIKFFSWEEN-------FERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFA 621

Query: 374 SYLVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            Y+ +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ E  D + + 
Sbjct: 622 FYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET- 679

Query: 432 SPTVGHKYKP---DRGVIEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
                 KY      R  I F++ +F++  + PS ++ KNLN +   G    ++G +G GK
Sbjct: 680 -----EKYNQLTISRNKIAFENATFAWDKKNPSFKL-KNLNVEFKLGKLNVVIGSTGSGK 733

Query: 488 STIALLLLRYYNPTTGTI---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
           +++ + LL   +   G +   ++D ++   +    +   I    Q   L++ T+R+NI +
Sbjct: 734 TSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILF 793

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
              Y  T+   ++V + C              T IG  G  LSGGQKQR+++ARAL    
Sbjct: 794 NSPYNETR--YKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSS 851

Query: 605 TILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHD 661
             ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ T++ +E V+VL  +
Sbjct: 852 RHVLLDDCLSAVDSHTALWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVLD-N 908

Query: 662 GSVVEMGK 669
           G + + G+
Sbjct: 909 GRIKDQGE 916

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 143/529 (27%), Positives = 246/529 (46%), Gaps = 51/529 (9%)

Query: 203  LRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVG 259
            L  N + + LH    + D   +G +++R   D    + S+  ++++ V+ +   +  +V 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNIVA 1002

Query: 260  VGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQL 314
            V +MC +  P  +I +    P + F   +     ++TS++++     Q + V     E L
Sbjct: 1003 VIVMCIVYLPWFAIAV----PFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVL 1058

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++S+  +    ++ +  I  + + G               ++  + F  ++A  S
Sbjct: 1059 GGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVA-IIFALIIALLS 1117

Query: 375  Y--LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDR 427
               +   S  S+G L  ++L      N+V    T     M  A      A++L  E   +
Sbjct: 1118 VTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 428  KPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
            KP +SP       P +G I F DV F+Y +   V + K LN  I  G  + I G +G GK
Sbjct: 1178 KPELSPPESW---PSKGEIRFLDVDFAYRSGLPV-VLKGLNLDIKSGEKIGICGRTGAGK 1233

Query: 488  STIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
            STI   L R    T+G I ID+ DIS L    LRR + I+ Q+PVL  GTIR N+     
Sbjct: 1234 STIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSN 1293

Query: 548  YTPT-------------KEEIRSVAKQCF----CHNFITKFPNTYDTVIGPHGTLLSGGQ 590
            Y  +             KE +  V  +       H  + KF    D ++   G+  S G+
Sbjct: 1294 YDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGE 1351

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIR 650
            +Q +A+ RAL+++  ILILDEATS++D E++G I     +  +  + TI+ IAHRL TI 
Sbjct: 1352 RQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTIL 1409

Query: 651  RSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQ 699
            + + ++VL   G + E  +  +L+++  S    +  E++    SD ++Q
Sbjct: 1410 QYDRILVL-EKGVIAEFDQPFKLFSDKDSIFRSMC-ERSNITESDFKIQ 1456

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 121/253 (47%), Gaps = 29/253 (11%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F NL+F+I  G  + I GP G GKS++      + N T G I + N D+  L C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQV-NGDL--LFCGY---- 640

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T++DNI +G  +   KE+  +V + C     +   P    T IG  G
Sbjct: 641 -------PWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL--------NEKAAPGPS 694
            H+LS I +++ VIVLG DGS  ++G   EL       L+ LL        NE     P 
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERENENRDESPV 807

Query: 695 DQQLQIEKVIEKE 707
             +   E +I++E
Sbjct: 808 ADEENDELLIQEE 820

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 154/551 (27%), Positives = 250/551 (45%), Gaps = 73/551 (13%)

Query: 173  FFTVALLIGC-AANFGRF-ILLRILS-ERVVARLRANVIKKTLHQDAEFFDNHKVGDLIS 229
            + TV  LIG   A  G F  ++  LS  R   ++  N++   LH    FFD   VG +++
Sbjct: 1041 YLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMN 1100

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF- 288
            R   D   V + +   +   +  LI     + ++  ++P+      F T  V+     F 
Sbjct: 1101 RFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPR------FLTVAVIVFVLYFF 1154

Query: 289  -GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
             GK     S++L+         + +   E L G+ T+++F   G+E       +  I Q 
Sbjct: 1155 VGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAF---GDERRFILENMNKIDQN 1211

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFMLYTEYTG 398
                             +  +    VLA GS+++L      S L+   LT  +L+T+   
Sbjct: 1212 NRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD--- 1268

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY----------KPDRGVIEF 448
                 L   YS       +  RL E +  +      +GH             P  G IE 
Sbjct: 1269 -GALWLVRLYSTFEMNMNSVERLKEYSSIEQE--NYLGHDEGRILLLNEPSWPKDGEIEI 1325

Query: 449  KDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI 507
            +++S  Y P  P V   +N++FK+ P S + IVG +G GKSTI   L R   P TG I I
Sbjct: 1326 ENLSLRYAPNLPPV--IRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKI 1383

Query: 508  DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK-----EEIRSVAKQC 562
            D QDISK++  +LRR I I+ Q+P+L +GTI+ N+     Y   K      ++  ++   
Sbjct: 1384 DGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHE 1443

Query: 563  F--CHNFITKFPNTYDTVIGPH------GTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            F    N   +F +T++  +  H      G  LS G++Q + IAR+L+++P I++LDEATS
Sbjct: 1444 FEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATS 1503

Query: 615  ALDVES----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            ++D +S    +G I   F +       TI++IAHRL ++   + +IV+       + G+ 
Sbjct: 1504 SIDYDSDHLIQGIIRSEFNK------STILTIAHRLRSVIDYDRIIVM-------DAGEV 1550

Query: 671  KELYANPTSAL 681
            KE Y  P+  L
Sbjct: 1551 KE-YDRPSELL 1560

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 143/521 (27%), Positives = 228/521 (43%), Gaps = 62/521 (11%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  +   +   V+A+I  +V VG++      S    +SI+L+ F
Sbjct: 444 NLGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMF 502

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
            P     A++ GK  + T K     T Q      E L  I+ V+ F  E N        I
Sbjct: 503 -PLNFLLANLLGKFQKQTLK----CTDQRISKLNECLQNIRIVKYFAWERN-------II 550

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
            +I  +               S+   L F+T  L  G    + + +   DL A + +T  
Sbjct: 551 NEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPLAFTTL 610

Query: 397 TGNAVFG-----LSTFYSEIMQGAGAASRL---FELTDRKPSISPTVGHKYKPDRGVIEF 448
           +   +       LS   S I Q   +  R+     + D +     T+     PD+  IEF
Sbjct: 611 SLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTIS----PDKNKIEF 666

Query: 449 KDVSFSYPTRPS-VQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           K+ + ++    S +  FK   LN K   G    I+G +G GKS + L LL   N  +G+I
Sbjct: 667 KNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSI 726

Query: 506 TIDN----QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
            + +     D+   +C+ L        Q   L++ T+++NI +   Y   ++    V   
Sbjct: 727 IVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--EDRYNKVIDA 783

Query: 562 CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  + 
Sbjct: 784 CGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTA 843

Query: 622 GAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVL-----GHDGSVVEM---GKF 670
             I  N   G LMK++  T + + H +S T+R +   IVL      + G++ E+   G F
Sbjct: 844 VWIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLF 901

Query: 671 KELYANPTSALSQLLNEK-----AAPGPSDQQLQIEKVIEK 706
           KE Y   +S  S  +NEK      AP  +D Q +IE V E 
Sbjct: 902 KEKYVQLSSRDS--INEKNANRLKAPRKNDSQ-KIEPVTEN 939

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 151/569 (26%), Positives = 252/569 (44%), Gaps = 74/569 (13%)

Query: 146  TLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVAL--LIGCAANFGRFILLRILSERVVARL 203
            TL T++ + F+ L I I    L   +S   V L  + G  A+   F LL           
Sbjct: 1115 TLSTTTRNTFYYLSIYILLGTLRALISTVKVILSYISGLKASRKIFTLL----------- 1163

Query: 204  RANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM 263
                +KK L+    FFD+   G +++R   D   +   +         +L+  +  + ++
Sbjct: 1164 ----LKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLI 1219

Query: 264  CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKT 319
              ++P    + LFF   +  S  + G      S++LQ         + +   E L G+ T
Sbjct: 1220 GYITP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTT 1275

Query: 320  VQSFVAE----GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            +++F  E     + LS+ +   R  F +               + +       +LA G +
Sbjct: 1276 IRAFGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAFRIDFIGAFV-------ILASGIF 1328

Query: 376  LVLQ-SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSIS 432
            ++L  + L  G     ++Y          L   YS +     +  RL E    +++PS  
Sbjct: 1329 ILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTG 1388

Query: 433  PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
                    PDRG IE  ++S  Y +    ++ KN+ F + P S V IVG +G GKSTI  
Sbjct: 1389 LYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIIT 1447

Query: 493  LLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY---- 548
             L R+ +P TGTI +DN DI+ +  K LR+ I I+ Q+PVL +GTI+ N+     Y    
Sbjct: 1448 ALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDR 1507

Query: 549  ----------------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
                            TPT  +I S +      N + KF +   + I   G+ LS GQ+Q
Sbjct: 1508 IFEALKRVNLIVQEELTPT--DIPSSSSSLSFEN-VNKFLDL-TSEITEGGSNLSQGQRQ 1563

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 652
             + +AR+L++ P  ++LDEAT+++D  S+  I  T  +  +    TI++IAHRL +I   
Sbjct: 1564 LVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIIDY 1621

Query: 653  ENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            + V+       V++ G+  E Y +P + L
Sbjct: 1622 DKVL-------VIDSGELAE-YDHPYTLL 1642

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 105/216 (48%), Gaps = 9/216 (4%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI---TIDNQDISKLNCKSL 520
            KNLN     G    IVGP+G GK+++ + LL   N + G I    ++ ++   ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              IG   Q   L++ T+R+NI +   Y   +    +V   C     +        T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMT 638
             G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  +   G LM+ ++  
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCV 907

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
           +VS  H  +   ++ + +V+  +  V   G+  EL+
Sbjct: 908 LVS--HNTALTLKNADWVVILENAKVTAQGEPLELF 941

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  148 bits (373), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 141/545 (25%), Positives = 246/545 (45%), Gaps = 56/545 (10%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ   + +  +    F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYF 1221

Query: 288  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 347
            +    R   +    +   + +   E L G+ T+++F  EG  +      I +  +     
Sbjct: 1222 YMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYL 1281

Query: 348  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 402
                        ++G L    +   G +++     L S ++   LT  + +TE       
Sbjct: 1282 WVANRWLAFRIDMIGSL---VIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GAL 1334

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDVSFSY-P 456
             L   YSE+     +  R+ E  + +    P   HK       P  G IE  D+S  Y P
Sbjct: 1335 WLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYAP 1392

Query: 457  TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516
              P  ++ KN++F +   S V IVG +G GKSTI   L R+  P TG I IDN DIS ++
Sbjct: 1393 NLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVD 1450

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK------------EE------IRSV 558
             + LRR I I+ Q+P L SGTI+ N+     ++  K            EE      +R V
Sbjct: 1451 LQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREV 1510

Query: 559  AKQCFCHNF--ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            A      +   + KF +  ++ +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++
Sbjct: 1511 ATDTSSADSENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASI 1569

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ KE Y +
Sbjct: 1570 DYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDH 1619

Query: 677  PTSAL 681
            P S L
Sbjct: 1620 PYSLL 1624

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 117/533 (21%), Positives = 219/533 (41%), Gaps = 50/533 (9%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRANVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPAAEDPQAINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGL 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +IL +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAILGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN- 578

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIG-- 385
              +   I+ I +                S +  ++   +T  ++  Y+ +Q ++     
Sbjct: 579 ---FENDIKAIRESELALLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPV 635

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK----- 440
             TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      
Sbjct: 636 AFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------EKYDQLTID 688

Query: 441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P+     F++ + S+         K+LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 TTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
             G + +   D  +   +        I    Q   L++ T+++NI +   +  T+   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKA 806

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 618 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  148 bits (373), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 140/557 (25%), Positives = 245/557 (43%), Gaps = 64/557 (11%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            Y  + +F + L      +   F L  I       ++ A ++ K +H    FFD   +G +
Sbjct: 1160 YYLIMYFMIGLTGATVGSLKTF-LTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRI 1218

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   V + +T  ++    + +     + ++  ++PQ      FF   +L S   
Sbjct: 1219 MNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQ------FFVVAILISIMY 1272

Query: 288  F--GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            +  G      S++L+         + +   E L G+ T+++F   G+E+      +  I 
Sbjct: 1273 YLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKID 1329

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                  +  +    V   G +++     + S ++   LT  + +TE 
Sbjct: 1330 ENNKPFFYLWVANRWLSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE- 1388

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRL----------FELTDRKPSISPTVGHKYKPDRGVI 446
                   L  FYSE+     +  R+          +++ D      PTV     PD G I
Sbjct: 1389 ---GALWLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW----PDEGKI 1441

Query: 447  EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
            E  D+S  Y      ++ KN++F + P S V +VG +G GKSTI   L R+ +P +G I 
Sbjct: 1442 EVNDLSLRYAANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIK 1500

Query: 507  IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKE 553
            IDN DI+ +    LRR I I+ Q+P L +GT++ N+     Y               + E
Sbjct: 1501 IDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGE 1560

Query: 554  EIR----SVAKQCFCH-NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
            E+     +V+ Q   H N   +F +  + +    G  LS GQ+Q I +AR+L++ P IL+
Sbjct: 1561 ELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQLICLARSLLRNPKILL 1619

Query: 609  LDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            LDEAT+++D ES+  +  T  G+   S   TI++IAHRL ++   + ++V+   G V+E 
Sbjct: 1620 LDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVMDA-GEVIEY 1675

Query: 668  GKFKELYANPTSALSQL 684
                 L  N  S   ++
Sbjct: 1676 DHPYSLLLNRNSEFYKM 1692

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 111/481 (23%), Positives = 206/481 (42%), Gaps = 44/481 (9%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           +++++ D E   N K+G +I+ +  DAY +S  +   +    +A++  V+ + ++  L  
Sbjct: 525 EESINADEESGSNAKLGTIINLMAIDAYKISE-ICAYLHFFAEAIVMTVIALVLLYRLIG 583

Query: 269 QLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 324
             +IL   ++    PV F  A++ G   + T   L E   ++ ++  E L  I+ ++ F 
Sbjct: 584 NAAILGTVIILVLLPVNFKLATLLGDYQKLT---LGETDKRIHKL-NEALQSIRIIKFFS 639

Query: 325 AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQ 379
            E N         RDI ++                + G + F+T       ++  Y+ +Q
Sbjct: 640 WENN-------FERDIMEIRERELQMLIKRTLAWVMGGFVWFVTPSIVTTASFAWYIYVQ 692

Query: 380 SQLSIG--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH 437
            ++       TA  L+T    + +  +S   S  +Q   +  R+         +S     
Sbjct: 693 GEVLTTPVAFTALSLFT-LLRDPLDRVSDMLSFAIQSKVSLERV------GAFLSEAETE 745

Query: 438 KYKP-----DRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
           KY+      +   + F + + S+ T  S    +NLN     G    ++G +G GK+++ +
Sbjct: 746 KYEQLTVDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLM 805

Query: 493 LLLRYYNPTTGTI---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            LL   +   G I   +++ +     N       I    Q   L++ T+R+NI +  ++ 
Sbjct: 806 ALLGEMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFD 865

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             +     V + C              T IG  G  LSGGQKQRI++ARAL      L+L
Sbjct: 866 ENR--YHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLL 923

Query: 610 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
           D+  SA+D  +   I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V + 
Sbjct: 924 DDCLSAVDSHTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQ 981

Query: 668 G 668
           G
Sbjct: 982 G 982

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 151/562 (26%), Positives = 243/562 (43%), Gaps = 67/562 (11%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQD 215
            F  + P F + LY   SFF  A  I     F     + I++ + +  LRA  +++ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKCL-NLRA--VRRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSI 384
              I  + + G                     FL ++A    L++           S  S+
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASV 1149

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKY 439
            G L  ++L      N +    T     M  A      A++L  E   RKP ++P    + 
Sbjct: 1150 GVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPP---ES 1206

Query: 440  KPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P +G I F++V F+Y  RP + I  KN N  I  G  + I G +G GKSTI   L R  
Sbjct: 1207 WPSKGKIVFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 499  NPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN----------------I 542
              T G I ID+ DIS+L    LR+ + I+ Q+PVL  GTIR N                +
Sbjct: 1265 ELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALV 1324

Query: 543  TYGLTYTPTKEEIR-SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
              G        E+R     +   H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKELYANPTSALSQ 683
            G V E       Y  P +  SQ
Sbjct: 1440 GEVAE-------YDTPWALFSQ 1454

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 112/228 (49%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S + FK+LNF I  G  + I GP G GKS++   +        G I + N D+  L C
Sbjct: 598 KTSFRGFKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEV-NGDL--LMC 654

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             + +  H+LS I R+  VIVLG DG  V++G  +EL A   + ++ L
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKTLINLL 806

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 137/514 (26%), Positives = 235/514 (45%), Gaps = 34/514 (6%)

Query: 189  FILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAY----VVSRSMTQ 244
            ++   I   R +  L  N +   L     FF+   +G +++R  +D Y    V+ R+ +Q
Sbjct: 1017 WVFCTIQGSRYLHTLMTNAV---LRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQ 1073

Query: 245  KVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
               + VK        +G++C  + Q     +F   P+      + +    TS++L+    
Sbjct: 1074 FFVNAVKVSFT----IGVICVTTWQF----IFVIVPLGVFYIYYQQYYLRTSRELRRLDS 1125

Query: 305  QLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVGXXXXXXXXXXXXXX 358
             +TR       +E L GI T++ +  +    S+ N   + +                   
Sbjct: 1126 -ITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQINQCRVDNNMSAFYPSVNANRWLAYRL 1183

Query: 359  SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
             L+G +  L         + Q  L+ G +   + Y      ++  +     E+     + 
Sbjct: 1184 ELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSV 1243

Query: 419  SRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT---RPSVQ-IFKNLNFKIAPG 474
             R+ E  D K S +P +   ++P     E  D+ F + +   RP +  + K++NF I P 
Sbjct: 1244 ERIKEYADLK-SEAPEIIEDHRPQETWPEEGDIKFEHYSTRYRPELDLVLKDINFHIKPK 1302

Query: 475  SSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM 534
              + IVG +G GKS++ L L R    + G I IDN DIS +    LR  + I+ Q+  + 
Sbjct: 1303 EKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVF 1362

Query: 535  SGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI-TKFPNTYDTVIGPHGTLLSGGQKQR 593
             GTIR+NI     Y  T E+I  V +     + I T   +  DT +   G+ LS GQ+Q 
Sbjct: 1363 EGTIRENIDPTNQY--TDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQL 1420

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 653
            + +ARAL+    IL+LDEAT+A+DVE++  +  T     K +  TI++IAHR++TI  ++
Sbjct: 1421 MCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDND 1478

Query: 654  NVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
             ++VL  +GS+ E  + K+L  N +S    L  E
Sbjct: 1479 RIMVLD-NGSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/242 (26%), Positives = 119/242 (49%), Gaps = 22/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L       G  TI 
Sbjct: 630 DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSILGDLFRVKGFATIH 689

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                         ++  V Q   +M+GT++DNI +G  Y    E      K C     +
Sbjct: 690 G-------------NVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTIDL 734

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
           +   +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 735 SVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 794

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  +++V +L  +G +V+ G + E+  +  S L++L+
Sbjct: 795 LGPNGLLHTKTKVLAT--NKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNKLI 851

Query: 686 NE 687
            E
Sbjct: 852 ME 853

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 143/519 (27%), Positives = 243/519 (46%), Gaps = 63/519 (12%)

Query: 200  VARLRAN------VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            VA +RA+      ++K  L+    FFD+  +G +++R   D   + + +T  +     +L
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 254  ICGVVGVGMMCSLSPQLSI------LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
            I  V  + ++  ++PQ  I      LL +F      S +   K++ + S+        + 
Sbjct: 1183 IQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSR------SPIH 1236

Query: 308  RVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL 367
            +   E L GI T+++F  E   L      I D  +                 L+G L   
Sbjct: 1237 QHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGAL--- 1293

Query: 368  TVLAYGSYLVLQSQLSIGDLTAFML--YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
             VLA GS+++L  +     L    L    ++T  A++ +   YS +     +  RL E T
Sbjct: 1294 IVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYT 1352

Query: 426  --DRKPS-ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
              +++PS +   V     P  G IE KD+S  Y      ++ KN+ F +     V IVG 
Sbjct: 1353 TIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSKCKVGIVGR 1411

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ +P TG I ID+ DI+ +  K LR+ I I+ Q+P L +GT++ N+
Sbjct: 1412 TGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNL 1471

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITK----FPNTYDTV----------------IGPH 582
                 Y  ++ EI    K+    N ++      P+T D+                 +   
Sbjct: 1472 DPYNEY--SEAEIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEG 1526

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
            G+ LS GQ+Q I +AR+L++ P +++LDEAT+++D  S+  I  T  +  +  + TI++I
Sbjct: 1527 GSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIRE--EFSNSTILTI 1584

Query: 643  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            AHRL +I   + ++V+       + G+ KE Y +P S L
Sbjct: 1585 AHRLRSIIDYDKILVM-------DAGEVKE-YDHPYSLL 1615

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 124/555 (22%), Positives = 227/555 (40%), Gaps = 75/555 (13%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRANVI----------- 208
           +Y FL F    L   CAA     GR + +R    I+SE     LR  +            
Sbjct: 400 MYIFLMFLARILTAICAAQALFLGRRVCIRMKAIIISEIYSKALRRKISPNSTKEPTDVV 459

Query: 209 -------KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
                  K+ +  D E      +G +I+ +  DA+ VS  +   +   ++A+I  +V + 
Sbjct: 460 DPQELNDKQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALF 518

Query: 262 MMCSLSPQLSI----LLLFFTPPVLFSASVFG----KQIRNTSKDLQEATGQLTRVAEEQ 313
           ++  L    ++    +++ F P     AS+ G    K +  T K +Q+          E 
Sbjct: 519 LLYRLIGWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EA 570

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLA 371
              I+ ++ F  E N    +   I++                   SL+  +  S +T  +
Sbjct: 571 FQAIRIIKFFSWEEN----FEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSAS 626

Query: 372 YGSYLVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
           +  Y+ +Q Q     ++   L+ F L      N +  LS   S ++Q   +  R+ E  +
Sbjct: 627 FAVYIYVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLN 682

Query: 427 RKPSISPTVGHKYKP---DRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPS 483
            + +       KY+     R  +  ++ +F++         KNL      G    IVGP+
Sbjct: 683 EEET------KKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPT 736

Query: 484 GRGKSTIALLLLRYYNPTTGTI---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL       G +   +++ ++   +    +   I    Q   L++ T+R+
Sbjct: 737 GSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRN 796

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NI +   Y   +    +V   C              T IG  G  LSGGQKQR+++AR+L
Sbjct: 797 NILFNAPYNENR--YNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSL 854

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
                 L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +++
Sbjct: 855 YSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVII 912

Query: 659 GHDGSVVEMGKFKEL 673
             +G V E G+  EL
Sbjct: 913 MENGRVKEQGEPVEL 927

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 134/505 (26%), Positives = 229/505 (45%), Gaps = 53/505 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P   ++ +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAF--- 1036

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1037 GDERRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1096

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHKY 439
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1097 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HTP 1150

Query: 440  KPD---RGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             P+   +G IE  D+S  Y P+ P  ++ KN++F + P   V IVG +G GKSTI   L 
Sbjct: 1151 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALF 1208

Query: 496  RYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----- 550
            R+ +P +G I IDN DI+ +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1209 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFE 1268

Query: 551  --------TKEEIRSV-----AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIA 597
                    T+EE+ S               + KF    D  I   G  LS GQ+Q + +A
Sbjct: 1269 ALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRL-DNEITEGGANLSQGQRQLVCLA 1327

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            R+L++ P +++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I   + ++
Sbjct: 1328 RSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKIL 1384

Query: 657  VLGHDGSVVEMGKFKELYANPTSAL 681
            V+       + G+ KE Y +P S L
Sbjct: 1385 VM-------DAGEVKE-YDHPYSLL 1401

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 106/465 (22%), Positives = 205/465 (44%), Gaps = 32/465 (6%)

Query: 224 VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---SPQLSILLLFFTPP 280
           +G +I+ +  DA+ VS  +   +   V+AL+  +V + ++  L   S  + +LL+    P
Sbjct: 258 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIVGVLLIIVILP 316

Query: 281 VLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           + F  A++ G    N  K+    T +  +   E    I+ ++ F  E N   +    IRD
Sbjct: 317 LNFKLANLLG----NLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN-FEKDIQNIRD 371

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG--DLTAFMLYTEYT 397
             ++                     S +T +++ +Y+ +Q ++       TA  L+T   
Sbjct: 372 Q-ELKMLVKRSIVWALTAFVWFVTPSIVTTVSFATYIYIQGEVLTTPVAFTALSLFT-LL 429

Query: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP---DRGVIEFKDVSFS 454
            N +  LS   S ++Q   +  R+    +   +       KY      R  I F++ +FS
Sbjct: 430 RNPLDMLSDMLSYVIQSKVSLDRVQVFLEEDET------EKYDQITVSRKRIGFENATFS 483

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI---TIDNQD 511
           +  +      KN++ +   G    ++GP+G GK+++ + LL   +   G +    +D ++
Sbjct: 484 WDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPRE 543

Query: 512 ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
              +    +   I    Q   L++ T+++NI +   +   + +  +V + C         
Sbjct: 544 DLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYD--AVVEACGLKRDFEIL 601

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFG 629
                T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N   G
Sbjct: 602 SAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITG 661

Query: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            LM+ ++  +VS  H ++   ++ + +V   +G V + G+  EL+
Sbjct: 662 PLMEGRTCILVS--HNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 131/512 (25%), Positives = 230/512 (44%), Gaps = 56/512 (10%)

Query: 202  RLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            ++  +++K +LH    FFD+  +G +++R   D   V + +   +      L+     + 
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIV 1228

Query: 262  MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
            ++  ++PQ   + +F      F  +V+    R   +        + +   E L+GI TV+
Sbjct: 1229 LITLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTVR 1288

Query: 322  SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
            ++  E   +      I +  +                 ++G  +F+ + A G  +   ++
Sbjct: 1289 AYGDESRFMRENLEKIDENNKPFFYMWVSNRWLSFRTQIIG--AFVILGAGGFSIWNINK 1346

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTVGHKY 439
            +  G     + Y     +A   L  FY +      +  R+ E    D++P    TV    
Sbjct: 1347 IDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPA 1406

Query: 440  K-PDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
              P+ G IE  DVS  Y P  P  ++ KN++F +   S V IVG +G GKSTI   L R+
Sbjct: 1407 DWPENGKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRF 1464

Query: 498  YNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY--------- 548
              P TG I IDN DI  ++ + LRR I I+ Q+P L +GTIR N+     Y         
Sbjct: 1465 LEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLDPYTQYSDKEIFDSL 1524

Query: 549  ---------------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQR 593
                           +P+  +  S+  + F H    ++       +   G+ +S GQ+Q 
Sbjct: 1525 ICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYN------VSEGGSNISQGQRQL 1578

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYT----FGQLMKSKSMTIVSIAHRLSTI 649
            + +AR+L+ KP I++LDEAT+++D ES+  I  T    FG      + TI++IAHRL ++
Sbjct: 1579 LCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFG------NSTILTIAHRLRSV 1632

Query: 650  RRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
               + ++V+       + G+ +E Y +P S L
Sbjct: 1633 IDYDKILVM-------DAGEVEE-YDHPYSLL 1656

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 129/550 (23%), Positives = 228/550 (41%), Gaps = 83/550 (15%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRANVIKKT-----------LHQ 214
           F+S   VA+  G A   GR I +R    I+SE  +  LR  +I KT           L++
Sbjct: 464 FISKCIVAVCEGQALFIGRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNE 523

Query: 215 DAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           D++   + +      VG +I+ +  DA+ V+          + A +   +G  +M  +S 
Sbjct: 524 DSKIDGDEESTASANVGAIINLIAVDAFKVAE---------IGAYLHTFIGTIIMTFVS- 573

Query: 269 QLSILLLFFTPPVLFSASVFGK-----------QIRNTSKDLQE----ATGQLTRVAEEQ 313
              I LLF    +L SA+  G            +I N   +LQ+     T +  +   E 
Sbjct: 574 ---IYLLF---NLLGSAAFIGALTIIVLIPVNYKIANWLGNLQQKNLKTTDKRIQKLNET 627

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-----T 368
              I+ ++ F  E N          DI ++               S    + F+     T
Sbjct: 628 FQAIRIIKFFSWEKN-------FENDIHKIREEELYILLLRCLVWSFSTFIFFISPTIVT 680

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG-----LSTFYSEIMQGAGAASRLFE 423
            L++  Y+ +Q Q    +LT+ + +T  +  A+       ++   S ++Q   +  R+  
Sbjct: 681 SLSFAYYIFIQKQ----ELTSPVAFTALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQT 736

Query: 424 LTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPS 483
             D +P            ++  + FK+ + S+         +NL+     G    ++GP+
Sbjct: 737 FLD-EPDTKKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPT 795

Query: 484 GRGKSTIALLLLRYYNPTTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL     T G I I + D      +        I    Q   L++ T+R+
Sbjct: 796 GSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRN 855

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600
           NI +   Y   + +   VA        I    +   T IG  G  LSGGQKQRI++ARAL
Sbjct: 856 NILFNSPYNKDRYDAAIVAAGLKRDFEILAAGDL--TEIGERGITLSGGQKQRISLARAL 913

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
                 ++LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ +++V+
Sbjct: 914 YSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVM 971

Query: 659 GHDGSVVEMG 668
             +G V + G
Sbjct: 972 LKNGRVADQG 981

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 145/565 (25%), Positives = 251/565 (44%), Gaps = 74/565 (13%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            F + LY   SFF     +     F    ++ I++ +    L    +K+ LH    + D  
Sbjct: 934  FYMGLY---SFFVFGGYLFMNIQFTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDTT 987

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILLLFFTPPV 281
             +G +++R   D   +   +T+ +   + +    ++GV ++C +  P  +I + F     
Sbjct: 988  PLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVF 1046

Query: 282  LFSASVF---GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
            +  A  +   G++I+     +Q +      +  E L G+ T++++ ++   +++ +  I 
Sbjct: 1047 VLIADHYQSAGREIKRLEA-IQRSFVYNNLI--EVLGGMDTIKAYKSQDRYMTKMDFLIN 1103

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLY 393
             + +V                ++  ++F  ++   S L +  Q      ++G L  ++L 
Sbjct: 1104 KMNEVSYMVVSVQRWVAIFLDMIA-VAFALII---SLLCVTRQFHISPSAVGVLLTYVLQ 1159

Query: 394  --------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
                          TE   N+   L T+ +E+ Q A           RK   SP      
Sbjct: 1160 LPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAY---------RKSDYSPPDNW-- 1208

Query: 440  KPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G + F+DVSF+Y P  P+V   KN+N  IA G  + I G +G GKSTI   L R  
Sbjct: 1209 -PTNGEVIFEDVSFAYRPGLPTV--LKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 499  NPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 550
              T+G I ID  D  KL    LRR + I+ Q+PVL  GTIR N+     ++         
Sbjct: 1266 ELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLI 1325

Query: 551  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
                  K+++  +  Q       +N + KF    D ++   G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALV 1383

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I        + +  TI+ IAHRL TI   + ++VL   
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EK 1440

Query: 662  GSVVEMGKFKELYANPTSALSQLLN 686
            G V E  K + L+ N  S    + +
Sbjct: 1441 GEVAEFDKPEILFNNEKSIFRSMCD 1465

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F NLNF+I  G  + I GP G GKS++   +  +   TTG + I+      L C      
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH---MLLCGY---- 669

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   +E+ + V + C     I   P    T IG  G
Sbjct: 670 -------PWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F Q ++SK+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H+LS I +++ VIVL  +GS V++G  +EL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 149/563 (26%), Positives = 245/563 (43%), Gaps = 60/563 (10%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQD 215
            F  + P F + LY   SFF  A  I      G++ +L ++       L    +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMN---GQYTILCVMGIMASKWLNLKAVKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMMCSLS-PQLS 271
              + D   +G +++R   D    + S+  ++++ ++ L      +VGV +MC +  P  +
Sbjct: 980  MSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFA 1035

Query: 272  ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELS 331
            I + F     +  A  +    R   +        +     E L G+ T++++ ++   L+
Sbjct: 1036 IAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLA 1095

Query: 332  RYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAF 390
            + +  I  + + G               ++  + + +  L   +     S  S+G L  +
Sbjct: 1096 KSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTY 1155

Query: 391  MLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGV 445
            +L      N +    T     M  A      A+ L  E   RKP ++P    +  P +G 
Sbjct: 1156 VLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPP---ESWPSKGE 1212

Query: 446  IEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I  ++V FSY  RP + +  KNLN  I  G  + I G +G GKSTI   L R    + G 
Sbjct: 1213 IVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGK 1270

Query: 505  ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR---- 556
            I ID+ DISKL    LRR + I+ Q+PVL  GTIR N+       P    T +E+     
Sbjct: 1271 ILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFDERTDDELWDALV 1324

Query: 557  ---SVAKQCF------------CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
               ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKNDLSEAKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKELYANPTSALSQL 684
            G V E      L+    S    +
Sbjct: 1440 GEVAEFDTPWTLFTQENSIFRNM 1462

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 121/250 (48%), Gaps = 21/250 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S + FK+LNF+I  G  + I GP G GKS++   +      T G I + N D+  L C
Sbjct: 598 KTSFRGFKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + +  +RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 655 GY-----------PWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQ 696
             + +  H+LS I R+  VIVLG DG  V++G   EL A     L +LL   +     ++
Sbjct: 762 RILAT--HQLSLIERASRVIVLGTDGQ-VDIGTVDELKAR-NQTLIKLLQFSSQNSKEEE 817

Query: 697 QLQIEKVIEK 706
            +  E +I +
Sbjct: 818 DVPEEGIINE 827

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  146 bits (368), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 153/591 (25%), Positives = 268/591 (45%), Gaps = 78/591 (13%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A      G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINNLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDV 451
                   L   YSE+     +  R+ E  + +    P   HK       P  G IE  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNEHKEIPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            S  Y P  P  ++ KN++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEI-- 555
            DIS ++ + LRR I I+ Q+P L SGTI+ N+     ++              ++E++  
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQ 1504

Query: 556  ---RSVAKQCFCHNF--ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
               R  + +    N   + KF +   + I   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GATRETSNEASSTNSENVNKFLDL-SSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ 
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEV 1614

Query: 671  KELYANPTSALSQLLNEKAA-------PGPSDQQLQIEKVIEKEDLNESKE 714
            KE Y +P S    LLN+++A        G  D  +++ K    E LN  K+
Sbjct: 1615 KE-YDHPYSL---LLNKQSAFYSMCEHSGELDILIELAKKAFVEKLNSKKD 1661

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 116/540 (21%), Positives = 218/540 (40%), Gaps = 61/540 (11%)

Query: 173 FFTVALLIG------CAAN---FGRFILLR----ILSERVVARLRANVI----------- 208
           F+   + +G      C A    FGR + +R    I+SE     LR  +            
Sbjct: 395 FYVTVMFVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDP 454

Query: 209 -----KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM 263
                +K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++
Sbjct: 455 QEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALL 513

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
             L    +I+ +     +L       K I +  K     T    +   E    I+ ++ F
Sbjct: 514 YRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYF 573

Query: 324 VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVL 378
             E N         +DI  +               S+   L F+T       ++  Y+ +
Sbjct: 574 SWEEN-------FEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYV 626

Query: 379 QSQLSIG--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL---TDRKPSISP 433
           Q ++       TA  L+T    + +  LS   S ++Q   +  R+ +     D K     
Sbjct: 627 QGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQL 685

Query: 434 TVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALL 493
           T+     P+     F++ + S+         K+LN +   G    ++GP+G GK+++ + 
Sbjct: 686 TI----DPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 494 LLRYYNPTTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           LL       G + +   +  +   ++       I    Q   L++ T+++NI +   +  
Sbjct: 742 LLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNE 801

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            +   ++V + C              T IG  G  LSGGQKQR+++ARAL      ++LD
Sbjct: 802 AR--YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLD 859

Query: 611 EATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           +  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 860 DCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 147/521 (28%), Positives = 229/521 (43%), Gaps = 80/521 (15%)

Query: 211  TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQL 270
             LH    FFD   VG +++R   D             +G+   +   + V + C +    
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDI------------EGIDQELIPYLEVTVFCLIQCSS 1129

Query: 271  SILLLFFTPPVLFSASVF--------GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIK 318
             +LL+    P  FS +V         GK     S+DL+         + +   E L G+ 
Sbjct: 1130 ILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVC 1189

Query: 319  TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV- 377
            T+++F   G+E       +  I Q                  +  +    VL  GS+++ 
Sbjct: 1190 TIRAF---GDEKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILF 1246

Query: 378  ----LQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
                + S L+   LT  +L+T+    +   L   YS       +  RL E        S 
Sbjct: 1247 NIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEY-------SS 1295

Query: 434  TVGHKY---------------KPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
             V  KY                P  G IE +++S  Y +   + + KN+ FK+ P S V 
Sbjct: 1296 IVQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLPL-VLKNVCFKVDPQSKVG 1354

Query: 479  IVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTI 538
            IVG +G GKSTI   L R   P TG I ID+QDISK++  +LRR I I+ Q+PVL +GTI
Sbjct: 1355 IVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTI 1414

Query: 539  RDNITYGLTYTPTK--------EEIRSVA-KQCF----CHNFITKFPNTYDTVIGPHGTL 585
            + NI     Y   +          I S+  KQ F      N   KF N    ++   G  
Sbjct: 1415 KSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGGLN 1473

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK--SMTIVSIA 643
            LS G++Q + IAR+L+++  I++LDEATS++D +S+  I      +++SK    TI++IA
Sbjct: 1474 LSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIA 1529

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
            HRL ++   + ++V+   G + E G   EL  N  S   ++
Sbjct: 1530 HRLRSVIYYDKILVMDA-GEIKEYGHPYELLKNERSTFYRM 1569

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 114/242 (47%), Gaps = 14/242 (5%)

Query: 441 PDRGVIEFKDVSFSYPTRPS-VQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
           PDR  IEFK  +  +    + +  FK  +LN   + G    ++G +G GKS + + LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 498 YNPTTGTITID----NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 553
            +  +G I I       D+   +   L        Q   L+S TI++NI +  +Y   K 
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYD--KS 775

Query: 554 EIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEAT 613
             + V   C  +  +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  
Sbjct: 776 RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCL 835

Query: 614 SALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           SA+D  +   I  N   GQLMK++  T + + H +    R+ +  ++  DG V   G  K
Sbjct: 836 SAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIK 893

Query: 672 EL 673
           EL
Sbjct: 894 EL 895

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  145 bits (366), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 233/540 (43%), Gaps = 31/540 (5%)

Query: 167  LYEFLSFFTVALLIGCAANFGR-FILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVG 225
            +++F+  +    +   A N  R  +LL   + R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    +   ++++   V V ++    P   I+        ++  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQ 1112

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
            + +    R   +    +T  +  +  E L G   + +F        R++    +  Q   
Sbjct: 1113 AFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFDFINFNNVQFNI 1168

Query: 346  XXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGNA 400
                         S+ L  +    VLA      S +  + +LS G +   M Y     ++
Sbjct: 1169 NCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSS 1228

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFKDVSFSYP 456
            +  +     +I     +  R++E  +  P     I      K  P  G I FK+ S  Y 
Sbjct: 1229 LMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYK 1288

Query: 457  TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516
            T+  + + K +N  I P   + +VG +G GKST++L L R    T GTI ID  DISK+ 
Sbjct: 1289 TKGDLAL-KGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMG 1347

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF----- 571
             K LR H+GI+ Q+     GT+R N+     Y+ T+E   S+       + +  F     
Sbjct: 1348 LKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDN 1406

Query: 572  -------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
                       D  I  +G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I
Sbjct: 1407 SELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKII 1466

Query: 625  NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
              T    +K K  TI++IAHR+ T+  S+ +IVL   G V E    + L +N  S    L
Sbjct: 1467 QETIRSELKEK--TILTIAHRIDTVLDSDKIIVLDA-GQVKEFDTPENLLSNKQSIFYAL 1523

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 120/230 (52%), Gaps = 16/230 (6%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            +N+N F+   G   CIVG  G GKST+   +L       G +   N  +  L  K L R
Sbjct: 638 LENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIR 690

Query: 523 H--IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              +    QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P   +T++G
Sbjct: 691 ASTVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVG 748

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMK-SKSMT 638
             G  LSGGQK RI++ARA+  +  + +LD+  SA+D E S+  +     + M   ++ T
Sbjct: 749 EKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKT 808

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT-SALSQLLNE 687
           +V   + +S + RS+ + +L   GS+VE G F E+ ++P  S L ++++E
Sbjct: 809 VVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  145 bits (365), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 137/508 (26%), Positives = 235/508 (46%), Gaps = 62/508 (12%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ K LH +  FFD+  +G +++R   D   V + +   +   +  +I     + ++  +
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 267  SPQLSILL-----LFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 317
            +P+  I+      L++   VL+ A          S++L+         + +   E L G+
Sbjct: 1204 TPEFLIIAILVAGLYYAIGVLYLAG---------SRELKRFDSITKSPIYQHFSETLVGV 1254

Query: 318  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 377
             TV+++  E     R N+ + D  +                  +  +  L +   G +++
Sbjct: 1255 TTVRAYGDEA-RFMRENLKMID--ENNKPFFYLWVSNRWLAFRIDVVGALVIFGSGVFVL 1311

Query: 378  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPS 430
            L      S L+   L+  + +TE    +   L   YS +     +  RL E    +++P 
Sbjct: 1312 LNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQEPY 1367

Query: 431  ISPTVGH-KYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
             S ++      P+ G IE  DVS  Y P  P  ++ KN  F + P   V IVG +G GKS
Sbjct: 1368 KSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGRTGAGKS 1425

Query: 489  TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
            TI   L R+ +P TG+I IDN DIS +  K LRR I I+ Q+P L SGTI+ N+     Y
Sbjct: 1426 TIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPYDEY 1485

Query: 549  TP-------------TKEEIRS--VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQR 593
            +              T++E+ S    +Q        KF N  +  I   G+ LS GQ+Q 
Sbjct: 1486 SEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQGQRQL 1544

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 653
            + +AR+L++ P +++LDEAT+++D  S+  I  T     +    TI++IAHRL T+   +
Sbjct: 1545 VCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVIDYD 1602

Query: 654  NVIVLGHDGSVVEMGKFKELYANPTSAL 681
             ++V+       + G+ KE + +P S L
Sbjct: 1603 KILVM-------DAGEVKE-FDHPYSLL 1622

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 129/559 (23%), Positives = 236/559 (42%), Gaps = 85/559 (15%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLRILSERVVARLRANVIKK------------- 210
           LY FL FF   ++  C+     FGR + +R+ S  +V+ + +  +K+             
Sbjct: 398 LYVFLMFFCRVIVAACSGQALFFGRRVCVRMRS-ILVSEIYSKALKRKISNDKSASLKDL 456

Query: 211 --------TLHQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
                    +  D E  D  +      +G +I+ +  D + V+  +   +   V+A++  
Sbjct: 457 NEQEEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVA-DICAYLHHFVEAVVMT 515

Query: 257 VVGVGMMCSLSPQLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEE 312
           +V + ++  L    +I+   L+    P+ F  AS+ GK      K   E T +  +   E
Sbjct: 516 IVALILLFKLLGVAAIVGASLIIALLPLNFKLASLLGKY----QKKSLEVTDKRIQKLNE 571

Query: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL-- 370
               I+ ++ F  E N         +DI +V               ++   + F+T    
Sbjct: 572 AFQAIRIIKFFSWEDN-------FEKDILEVRERELRMILIRSIVWAISSFVWFVTPTIV 624

Query: 371 ---AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL--------STFYSEIMQGAGAAS 419
              ++  Y+ +Q ++         +   +T  ++F L        S   S ++Q   +  
Sbjct: 625 TGASFTYYVYVQGEV-------LTIPVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLD 677

Query: 420 RL---FELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS 476
           R+    E  D K     TV  KY+     I FK+ + ++         +N++     G  
Sbjct: 678 RIQEFLEEEDTKKYEQLTV-DKYQNK---IAFKNATTTWNKEKQDFKLRNIDIDFKIGKL 733

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPTTGTITI---DNQDISKLNCKSLRRHIGIVQQEPVL 533
             I+GP+G GK+++ + LL   +   G I +   D ++  KL+   L   I    Q   L
Sbjct: 734 NVIIGPTGSGKTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWL 793

Query: 534 MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TVIGPHGTLLSGGQKQ 592
           ++ T+R+NI +    +P  EE  +   +        +  N  D T IG  G  LSGGQKQ
Sbjct: 794 LNDTVRNNILFN---SPYCEERYNAVVEASGLKRDFEILNAGDMTEIGERGITLSGGQKQ 850

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIR 650
           R+++ARAL      L+LD+  SA+D  +   I  N   G LM++++  +VS  H ++   
Sbjct: 851 RVSLARALYSNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENRTCILVS--HNIALTL 908

Query: 651 RSENVIVLGHDGSVVEMGK 669
           R+ + +V   +G +VE G+
Sbjct: 909 RNADYVVKLENGKIVEHGE 927

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 220/482 (45%), Gaps = 47/482 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ K +H    FFD+  +G +++R   D     + +T  +     +L+  V  V ++  +
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 267  SPQ------LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
            +PQ      L  +L +F      + S   K++ + S+        + +   E L G+ T+
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTTI 1241

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ- 379
            ++F   G+E       ++ I +                  +  +  L +   G +++L  
Sbjct: 1242 RAF---GDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLNI 1298

Query: 380  SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS----ISP 433
              +  G     + Y          L   YS +     +  RL E  D  ++P     ++P
Sbjct: 1299 DHIDSGKAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTP 1358

Query: 434  TVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
             V     P +G IE  D+S  Y P  P  ++ KN++F + P S V IVG +G GKSTI  
Sbjct: 1359 PVEW---PQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIIT 1413

Query: 493  LLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-- 550
             L R+ +P TG I IDN DI+ ++ + LRR I I+ Q+P L +GTI+ N+     YT   
Sbjct: 1414 ALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQ 1473

Query: 551  -----------TKEEIR---SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
                       T+EE+    +          I KF +   + I   G  +S GQ+Q + +
Sbjct: 1474 IFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCL 1532

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            AR+L++ P I++LDEAT+++D  S+  I  T  +       TI++IAHRL ++   + ++
Sbjct: 1533 ARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKIL 1590

Query: 657  VL 658
            V+
Sbjct: 1591 VM 1592

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 107/479 (22%), Positives = 211/479 (44%), Gaps = 38/479 (7%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           ++ ++ D E   +  +G +I+ +  DA+ VS  +   +   V+A++  +V   ++  L  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLG 520

Query: 269 QLSIL---LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
             +I+   L+    P+ F  + +   ++   K+    T +  +   E    I+ ++ F  
Sbjct: 521 FAAIVGAALIVAMMPLNFKLATWLGHLQ---KETLSVTDKRIQKLNEAFQAIRIIKFFSW 577

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLS 383
           E N    +   IRD+ +                S +  ++   +T  A+  Y+ +Q ++ 
Sbjct: 578 ENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEVL 633

Query: 384 IGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK- 440
              +  TA  L++      +  LS   S ++Q   +  R+ E  + K +       KY  
Sbjct: 634 TTPIAFTALSLFS-LLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT------EKYNQ 686

Query: 441 ----PDRGVIEFKDVSFSYPT-RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
                D+  I F++ + ++   RP  ++ KNLN     G    I+GP+G GK+++ + LL
Sbjct: 687 LSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALL 745

Query: 496 RYYNPTTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
              +  +G I + + D  +   +    +   +    Q   L++ T+++NI +   Y   +
Sbjct: 746 GEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGR 805

Query: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            E  +V + C      +       T IG  G  LSGGQKQRI++AR+L      ++LD+ 
Sbjct: 806 YE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDC 863

Query: 613 TSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            SA+D  +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 864 LSAVDSHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 150/576 (26%), Positives = 265/576 (46%), Gaps = 71/576 (12%)

Query: 141  GIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVAL---LIGCAANFGRFILLRILSE 197
             I+L++  + S S++   K+   +   Y  + +F + L   ++G       F  + I + 
Sbjct: 1072 NILLNSCDSKSASEYVTQKVNNHTTKYY-LIIYFAIGLAHSILGSIKTMLSF-YVGINAS 1129

Query: 198  RVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK---ALI 254
            R + +L   ++ K LH    FFD+  +G +++R   D   + + +T  V   V     LI
Sbjct: 1130 RKIFKL---LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLI 1186

Query: 255  CGVVGVGMMCS---LSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
              V+ +  + +   +   L ILL +F      S S   K+  +T+K        + +   
Sbjct: 1187 ATVLLITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTK------SPIYQHFS 1240

Query: 312  EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
            E L G+ T++++   G+E+      +  I +                  +  +  L +  
Sbjct: 1241 ETLVGVTTIRAY---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFG 1297

Query: 372  YGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             G  +++      S L+   LT  + +TE    +   L   YS +     +  R+ E  D
Sbjct: 1298 AGVLVLMNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMD 1353

Query: 427  --RKPSISPTVG-HKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGP 482
              ++P  +  V   K  P  G IE  D+S  Y P+ P  ++ KN++F + P   V +VG 
Sbjct: 1354 IEQEPYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGR 1411

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ +P TG I IDN DI+ ++ K LR+ I I+ Q+P L +GTI+ N+
Sbjct: 1412 TGAGKSTIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL 1471

Query: 543  TYGLTYTPTK-----------------EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL 585
                 Y   +                  ++ SV+ +      + KF N   + I   G+ 
Sbjct: 1472 DPYNEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLNL-QSEISEGGSN 1525

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T     + K  TI++IAHR
Sbjct: 1526 LSQGQRQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHR 1583

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            L ++   + ++V+       + G+ KE Y +P S L
Sbjct: 1584 LRSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1611

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 128/542 (23%), Positives = 229/542 (42%), Gaps = 67/542 (12%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRANVI----------------- 208
           FL+  TVA+  G A  FGR I +R    I+SE     LR  V                  
Sbjct: 404 FLARATVAVSDGLALFFGRRICIRMRSIIISEIYSKALRRQVSNSSDAEKSKDDFEIDPQ 463

Query: 209 ----KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR--SMTQKVSDGVKALICGVVGVGM 262
               KK ++ D E      +G +I+ +  D + ++   +     +      I  +V +  
Sbjct: 464 EENDKKNVNGD-EKSKTANLGAIINLMAVDTFKIADIGAYMHFFAGSFIMTIIALVLLYK 522

Query: 263 MCSLSPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           +  ++  +  +LL    PV F  A++ G+  + T       T Q  +   E L  I+ ++
Sbjct: 523 LLGVAAIVGTILLLCMIPVSFKLATLLGEYQKKT----LAVTDQRIQKLNEVLQAIRIIK 578

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL--TVLAYGS---YL 376
            F  EGN          +I  +               +L G + +L  T++  GS   Y+
Sbjct: 579 FFSWEGN-------FEEEILTIREKELKILLIRSAVWALGGFVWYLTPTIVTAGSFAYYI 631

Query: 377 VLQ-SQLSI-GDLTAFMLYTEYTG--NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432
            +Q  QL+     TA  L++   G  + +  +++F  +         +  +  D K    
Sbjct: 632 FIQGEQLTTPVAFTALSLFSLLRGPLDQISDMASFVIQSKVSLDRIQKFLDEDDTKKYEQ 691

Query: 433 PTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
            ++G+K       I  ++V+ S+  +      +NLN     G    ++GP+G GK+++ +
Sbjct: 692 LSLGNK-------ISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLM 744

Query: 493 LLLRYYNPTTGTITIDNQD---ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            LL   +   G IT+ + D       +   L   +    Q   L++ T+++NI +   Y 
Sbjct: 745 ALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEY- 803

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILIL 609
             +E   +V   C              T IG  G  LSGGQKQRI++ARAL      ++L
Sbjct: 804 -NEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILL 862

Query: 610 DEATSALDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVE 666
           D+  SA+D  +   I  N   G LM++++  +VS  H ++ T++ +E VI++  +G +  
Sbjct: 863 DDCLSAVDSHTAAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMID-NGKISH 919

Query: 667 MG 668
           +G
Sbjct: 920 IG 921

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 146/560 (26%), Positives = 244/560 (43%), Gaps = 54/560 (9%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQD 215
            F  K P F + LY   SFF  A  I     +     + I++ +    L    +K+ LH  
Sbjct: 927  FKNKSPSFYMGLY---SFFVFAAFIFMNGQYTILCAMGIMASK---WLNLKAVKRILHTP 980

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 981  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1039

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1040 PFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1099

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              I  + + G               ++  + + +  L   +     S  S+G +  ++L 
Sbjct: 1100 FLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQ 1159

Query: 394  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTVGHKYKPDRGVIEF 448
                 N +    T     M  A      A+ L  E   RKP ++P    +  P +G I F
Sbjct: 1160 LPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPP---ESWPSKGEIAF 1216

Query: 449  KDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITI 507
            K+V FSY  RP + +  KNLN  I  G  + I G +G GKSTI   L R    + G I I
Sbjct: 1217 KNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILI 1274

Query: 508  DNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR------- 556
            D+ +IS++    LRR + I+ Q+PVL  GTIR N+       P    T++E+        
Sbjct: 1275 DDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFNERTEDELWDALVRGG 1328

Query: 557  SVAKQCF------------CHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
            ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+++ 
Sbjct: 1329 AIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQS 1386

Query: 605  TILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
             ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   + ++VL   G V
Sbjct: 1387 KILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILVL-EKGEV 1443

Query: 665  VEMGKFKELYANPTSALSQL 684
             E      L++   S    +
Sbjct: 1444 AEFDTPWALFSQEDSIFKNM 1463

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 114/228 (50%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S + FK+L+F+I  G  + I GP G GKS++   +      T G I + N D+  L C
Sbjct: 598 KTSFKGFKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDL--LMC 654

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T++DNI +G  +   KE+   V   C     +   P    T
Sbjct: 655 GY-----------PWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKT 761

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             + +  H+LS I ++  VIVLG DG  V++G   EL A   + ++ L
Sbjct: 762 RVLAT--HQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQTLINLL 806

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 245/539 (45%), Gaps = 49/539 (9%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L  N+ K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   +      + F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L      T +   + +  + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLA-----TAMLALTTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFELTDRKPSISPTVGHKYKPD-----RGVIEFKDVSFSYPTRPSVQ-IF 464
            I     +  R+ E  +  PS + ++  + +PD     +G IEFK+ S  Y  R ++  + 
Sbjct: 1263 IETNIVSVERIVEYCEL-PSEARSINPENRPDESWPSKGSIEFKNYSTKY--RENLDPVL 1319

Query: 465  KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHI 524
            K++N +I P   + IVG +G GKST++L L R   PT G+I ID+ +IS L    LR H+
Sbjct: 1320 KDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHL 1379

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYT--------------PTKE-----EIRSVAKQCFCH 565
             I+ Q+     GT+R N+     Y+              P  E     EIR        +
Sbjct: 1380 AIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEEN 1439

Query: 566  NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
              ++   N     I  +GT LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I 
Sbjct: 1440 GNVSDVLNVK---INENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQ 1496

Query: 626  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             T  +  K +  TI++IAHR+ T+  S+ +IVL  +G+V E     +L ++  S    L
Sbjct: 1497 DTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKASIFYSL 1552

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 154/327 (47%), Gaps = 44/327 (13%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTVGHKYKPDRGVIEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P++  +  P   VIE  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKNLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  KN++ F+   G  VC+VG  G GKS
Sbjct: 620 ITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKS 679

Query: 489 TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           T    +L      +G+         KL  ++    +    QE  +M+ ++R+NI +G  +
Sbjct: 680 TFLKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFGHKF 734

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
                ++    K C     +   P+  +T++G  G  LSGGQK R+++ARA+  +  I +
Sbjct: 735 DKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYL 792

Query: 609 LDEATSALDVE-SEGAINYTF-GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
           LD+  SA+D E S+  + Y   G+    K+ TI+   + +  ++ S+ +  L  +G ++E
Sbjct: 793 LDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYAL-ENGEIIE 851

Query: 667 MGKFKELY--ANPTSALSQLLNEKAAP 691
            G ++ +    N  S L +LL E  +P
Sbjct: 852 QGNYEGVMNRENTNSKLKKLLEEFDSP 878

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 133/493 (26%), Positives = 216/493 (43%), Gaps = 13/493 (2%)

Query: 201  ARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260
            ARL   + K  L     FF+   VG +++R  +D Y V   + +  S     +   V  +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 261  GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
             ++CS++ Q    +L  +   LF    + +  R   +        +    +E L+G+ TV
Sbjct: 1075 IVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTV 1134

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
            +SF  +   +      I                       +G +  L       + + Q 
Sbjct: 1135 RSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQG 1194

Query: 381  QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS---ISPTVGH 437
            +L+ G L   + Y      ++  +     E+     +  R+ E TD KP    I PT   
Sbjct: 1195 KLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRP 1254

Query: 438  -KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             K  P  G I+F+  S  Y  RP +  I +++N  I P   V IVG +G GKS++ + L 
Sbjct: 1255 PKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLF 1312

Query: 496  RYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
            R      G I ID+  I  +    LR  + I+ Q+  +  GT R+NI     +  T +EI
Sbjct: 1313 RLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF--TDDEI 1370

Query: 556  RSVAKQCFC-HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             +  +      + +T      +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+
Sbjct: 1371 WNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATA 1430

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G + E      L 
Sbjct: 1431 AIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-KGRIAEFDTPCNLL 1487

Query: 675  ANPTSALSQLLNE 687
             + TS    L NE
Sbjct: 1488 KDETSIFYSLCNE 1500

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 114/238 (47%), Gaps = 18/238 (7%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D ++ +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L       G+ T  
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAMLGDLFRVKGSAT-- 676

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                      L   +  V Q   +M+GTI+DNI +G  Y    E      K C     +
Sbjct: 677 -----------LHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLDL 723

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
              P+   T +G  G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y 
Sbjct: 724 NTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYV 783

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G     K+ T +   +++  +  ++++ +L  +G +V+ G + ++ +N  S L +L+
Sbjct: 784 IGPTGLLKTKTRILTTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI 840

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 150/561 (26%), Positives = 256/561 (45%), Gaps = 70/561 (12%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            F + +Y F  F     +     N  +F LL  L  R    L    +++ LH    + D  
Sbjct: 899  FYMGMYSFFVFGAYLFM-----NL-QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTT 952

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGV---VGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++++ ++ ++  V   +GV +MC +  P  +I +    
Sbjct: 953  PLGRILNRFTKD----TDSLDNELTESIRLMLSQVGNLIGVIVMCIVYLPWFAIAV---- 1004

Query: 279  PPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
            P +L    +     ++T ++++  EA  +  +     E L G+ T++++ ++   L++ +
Sbjct: 1005 PFLLIIFVLICDHYQSTGREIKRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTD 1064

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----SQLSIGDLTAF 390
              I  + + G               LL  ++ +  L      V +    S  S+G L  +
Sbjct: 1065 YLINKMNEAGYLIVAVQRWVAI---LLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTY 1121

Query: 391  MLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTVGHKYKPDRGV 445
            +L      N +    T     M  A      A     E   RKP +SP    +  P++G 
Sbjct: 1122 VLQLPGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPP---ESWPEKGD 1178

Query: 446  IEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I+F DV+F+Y  RP + +  KN+N KI  G  + I G +G GKSTI   L R    + G 
Sbjct: 1179 IDFIDVNFAY--RPGLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGK 1236

Query: 505  ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE---------EI 555
            I ID  DI K+    LR+ + I+ Q+PVL  GTIR N+       P KE          I
Sbjct: 1237 IVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNL------DPFKECSDDLLWDALI 1290

Query: 556  RS-VAKQCFCHNFITKFP---NTY--------DTVIGPHGTLLSGGQKQRIAIARALIKK 603
            R+ V ++   ++   + P   N+Y        D ++   G+  S G++Q +A+ RAL++ 
Sbjct: 1291 RTGVVERENLNDIKLEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRN 1350

Query: 604  PTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
              ILILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G 
Sbjct: 1351 SKILILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGV 1407

Query: 664  VVEMGKFKELYANPTSALSQL 684
            + E  K  EL+ +  S    +
Sbjct: 1408 IAEYEKPWELFNDKNSIFRSM 1428

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 109/224 (48%), Gaps = 24/224 (10%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F +LN +I  G  + + GP G GK+++   +  +   T+G + ++ +    L C      
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE---LLLCGY---- 633

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGP 581
                  P +++ T+RDNI +G  Y    EE R   + + C     +   P    T IG 
Sbjct: 634 -------PWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIV 640
            G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
           +  H+LS I R++ +IV+G +GS  + G   EL     + +S L
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQTLVSLL 783

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 132/505 (26%), Positives = 228/505 (45%), Gaps = 53/505 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P    + +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAF--- 1249

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1250 GDERRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1309

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPSISPTVGHKY 439
            L+   LT  + +TE        L   YS +     +  RL E    +++P    T  H  
Sbjct: 1310 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQST--HNP 1363

Query: 440  KPD---RGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             P+   +G IE  D+S  Y P+ P  ++ KN+ F + P   V IVG +G GKSTI   L 
Sbjct: 1364 PPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALF 1421

Query: 496  RYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----- 550
            R+ +P +G I IDN DI+ +  K LR+ I I+ Q+P L +GT++ N+     Y+      
Sbjct: 1422 RFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFE 1481

Query: 551  --------TKEEIRSVAK------QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAI 596
                    T+EE+   A            N + KF    +  I   G+ LS GQ+Q + +
Sbjct: 1482 ALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSNLSQGQRQLVCL 1539

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVI 656
            AR+L++ P +++LDEAT+++D +S+  I  T     +    TI++IAHRL +I   + ++
Sbjct: 1540 ARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDYDKIL 1597

Query: 657  VLGHDGSVVEMGKFKELYANPTSAL 681
            V+       + G+ KE Y +P S L
Sbjct: 1598 VM-------DAGEVKE-YDHPYSLL 1614

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 108/468 (23%), Positives = 200/468 (42%), Gaps = 38/468 (8%)

Query: 224 VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---SPQLSILLLFFTPP 280
           +G +I+ +  DA+ VS  +   +   V+AL+  +V + ++  L   S  +  LL+    P
Sbjct: 472 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIIGALLIVAILP 530

Query: 281 VLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           + F  A++ GK      K+    T +  +   E    I+ ++ F  E N         +D
Sbjct: 531 LNFRLATLIGK----LQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN-------FEKD 579

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQSQLSIG--DLTAFML 392
           I  +               +L   + F+T      +++  Y+ +Q ++       TA  L
Sbjct: 580 IQSIRDQELKMLVKRSVAWALTAFVWFITPTIVTSVSFAFYIYVQGEVLTTPVAFTALSL 639

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVS 452
           +T    N +  LS   S ++Q   +  R+    +           +    R  I F++ +
Sbjct: 640 FT-LLRNPLDMLSDMLSYVIQSKVSLDRV---QEFLEEEETEKYEQITVHRNKIGFENAT 695

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI---TIDN 509
           FS+  +      KN+N     G    ++GP+G GK+++ + LL   +   G +    +D 
Sbjct: 696 FSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDP 755

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EIRSVAKQCFCHNFI 568
           ++   +    +   I    Q   L++ T+++NI +    +P  E    +V + C      
Sbjct: 756 REDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEACGLKRDF 812

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NY 626
                   T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N 
Sbjct: 813 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENC 872

Query: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
             G LM+ ++  +VS  H ++   ++   +V   +G V + G+  ELY
Sbjct: 873 ISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 142/550 (25%), Positives = 249/550 (45%), Gaps = 66/550 (12%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINHLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDV 451
                   L   Y+E+     +  R+ E  + +    P   HK       P  G IE  D+
Sbjct: 1332 ---GALWLVRLYAEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            S  Y P  P  ++ KN++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV---------- 558
            DIS ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V          
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQ 1504

Query: 559  --AKQCFCHNFITKFPNT-----YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
               ++    N  T   N        + +   G+ LS GQ+Q + +AR+L++ P I++LDE
Sbjct: 1505 GTTREADNDNSSTNSENVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDE 1564

Query: 612  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
            AT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ K
Sbjct: 1565 ATASIDYGSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVK 1615

Query: 672  ELYANPTSAL 681
            E Y +P S L
Sbjct: 1616 E-YDHPYSLL 1624

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 115/531 (21%), Positives = 219/531 (41%), Gaps = 46/531 (8%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRANVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPINEDPQEINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGF 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENF 579

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG--DL 387
               N AIR+  ++                     + +T  ++  Y+ +Q ++       
Sbjct: 580 EKDIN-AIREN-ELSLLLMRSIVWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVAF 637

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK-----PD 442
           TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      P+
Sbjct: 638 TALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------KKYDQLTIDPN 690

Query: 443 RGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
                F++ + S+         K+LN +   G    ++GP+G GK+++ + LL      +
Sbjct: 691 GKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLS 750

Query: 503 GTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
           G + +   +  +   ++       I    Q   L++ T+++NI +   +   +   ++V 
Sbjct: 751 GKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEAR--YKAVV 808

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  
Sbjct: 809 EACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSH 868

Query: 620 SEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 869 TASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 139/517 (26%), Positives = 230/517 (44%), Gaps = 65/517 (12%)

Query: 202  RLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            ++  +++   LH    FFD   +G +++R   D   V + +T  +      L+  V  + 
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 262  MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 317
            ++  ++PQ  IL +F    + F   + G      S++L+         + +   E L GI
Sbjct: 1219 LIAFITPQFLILAIF----IGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGI 1274

Query: 318  KTVQSFVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
             T++++  E       L + +   +  F +               SL+       V   G
Sbjct: 1275 VTIRAYGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGSLV-------VFGAG 1327

Query: 374  SYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--D 426
             +++L      S L+   LT  + +TE    A   L  FY+++     +  RL E    D
Sbjct: 1328 VFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEID 1383

Query: 427  RKP-----SISPTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIV 480
            ++P       S  +     P  G IE  ++S  Y P  P  ++ KN+ F + P   V +V
Sbjct: 1384 QEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVV 1441

Query: 481  GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540
            G +G GKSTI   L R+ +  TG I ID+ DI+ +N   LRR I I+ Q+P L SGTIR 
Sbjct: 1442 GRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRS 1501

Query: 541  N-----------ITYGLTYTPTKEEIRSVAKQCFCHNF-----ITKFPNTYDTVIGPHGT 584
            N           I   L       E  S        +      + KF N  +  I   G 
Sbjct: 1502 NLDPYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNE-ITEGGN 1560

Query: 585  LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
             LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI++IAH
Sbjct: 1561 NLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAH 1618

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            RL ++   + ++V+       + G+ KE Y +P S L
Sbjct: 1619 RLRSVCDYDKILVM-------DAGEVKE-YDHPYSLL 1647

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 116/470 (24%), Positives = 209/470 (44%), Gaps = 50/470 (10%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI----LLLFFT 278
            +G +I+ +  DA+ VS  +   +   V+AL+  VV + ++  L    ++    L++ F 
Sbjct: 511 NLGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFL 569

Query: 279 PPVLFSASVFG----KQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           P  L  A++ G    K +  T K +Q+          E    I+ ++ F  E N  +R  
Sbjct: 570 PLNLKLATLLGEYQKKSLAVTDKRIQKLN--------ETFQAIRIIKYFSWEDN-FTRDI 620

Query: 335 VAIRD-----IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
             +R+     +F+                S++   SF    A+  Y+  ++  +    TA
Sbjct: 621 ETVREKELHLLFKRSLIWAFSSFIWFITPSIVTSCSF----AFYIYVQGETLTTPVAFTA 676

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY-----KPDRG 444
             L+T      +  LS   S ++Q   +  R+ +L   K +       KY       +  
Sbjct: 677 LSLFT-LLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKET------EKYSQLTIDKNGN 729

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I F++ + ++  + S    ++LN    PG    ++GP+G GKS++ L LL   +   G 
Sbjct: 730 RIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGN 789

Query: 505 I---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           I   ++D +D   ++   +   I    Q   L++ T+R+NI +   Y   +     V   
Sbjct: 790 IIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYN-AVVEAC 848

Query: 562 CFCHNF-ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           C   +F I K  +   T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +
Sbjct: 849 CLKRDFEILKAGDM--TEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHT 906

Query: 621 EGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
              I  N   G LM++++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 907 ALWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 129/485 (26%), Positives = 220/485 (45%), Gaps = 31/485 (6%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    V+ R+ +Q   + VK     +V    +C  + Q    
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIV----ICFTTWQF--- 1090

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
             +F   P+      + +    TS++L+         +    +E L GI T++ +  +   
Sbjct: 1091 -IFIIIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRF 1149

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                   + +                     +G L  L       + + Q  L+ G +  
Sbjct: 1150 THINQCRVDNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGL 1209

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRG 444
             + Y      ++  +     E+     +  R+ E +D K S +P V   ++P     D G
Sbjct: 1210 SLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLK-SEAPAVIEDHRPAETWPDEG 1268

Query: 445  VIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
             I+F+  S  Y  RP +  I K++N  I P   V IVG +G GKS++ L L R    ++G
Sbjct: 1269 DIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSG 1326

Query: 504  TITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
             I IDN  I+++    LR  + I+ Q+  +  GT+R+NI     Y  T E+I +V     
Sbjct: 1327 RIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWNVLALSH 1384

Query: 564  CHNFITKFPNT-YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              + I    +   +  +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1385 LKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDK 1444

Query: 623  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
             I  T     K +  TI++IAHR++TI  S+ +IVL  +G++ E    ++L  NP+S   
Sbjct: 1445 VIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSSLFY 1501

Query: 683  QLLNE 687
             L  E
Sbjct: 1502 SLCQE 1506

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 121/242 (50%), Gaps = 22/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L       G  TI 
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIH 687

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                         ++  V Q   +M+GT+++NI +G  Y   ++  +   K C     +
Sbjct: 688 G-------------NVAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTIDL 732

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + + 
Sbjct: 733 AVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHV 792

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  +++V +L  +G +V+ G + E+  + +S LS+L+
Sbjct: 793 LGPNGLLHTKTKVLAT--NKVSVLSIADSVSLL-ENGEIVQQGTYDEIMKDDSSPLSKLI 849

Query: 686 NE 687
            E
Sbjct: 850 TE 851

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 145/551 (26%), Positives = 247/551 (44%), Gaps = 68/551 (12%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL          ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LSI     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     + S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNIDHIDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK-----YKPDRGVIEFKDV 451
                   L   YSE+     +  R+ E    K    P   HK       P  G IE  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYM--KIEQEPYNQHKEVPPSQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            S  Y P  P  ++  N++F +   S + IVG +G GKSTI   L R+  P TG I IDN 
Sbjct: 1387 SLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV---------- 558
            DIS ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V          
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQ 1504

Query: 559  -----AKQCFCHNF---ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
                 A      N    I KF +   + +   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GAVREADNDTSSNSSENINKFLDL-SSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V+       + G+ 
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEV 1614

Query: 671  KELYANPTSAL 681
            KE Y +P S L
Sbjct: 1615 KE-YDHPYSLL 1624

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 101/474 (21%), Positives = 197/474 (41%), Gaps = 30/474 (6%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           +K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHLLG 518

Query: 269 QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 328
             +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 329 ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG--D 386
                N  IR+  ++                     + +T  ++  Y+ +Q ++      
Sbjct: 579 FEKEIN-TIREN-ELSLLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVA 636

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS-------ISPTVGHKY 439
            TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       I P  G ++
Sbjct: 637 FTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDTKKYDQLTIDPN-GKRF 694

Query: 440 KPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
             +   I +   +  +         K+LN +   G    ++GP+G GK+++ + LL    
Sbjct: 695 ALENSTISWDKDNQDFK-------LKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMY 747

Query: 500 PTTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
              G I +   +  +   ++       I    Q   L++ TI+ NI +   +   +   +
Sbjct: 748 LLNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEAR--YK 805

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           +V + C              T IG  G  LSGGQKQR+++ARAL      ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 617 DVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + + G
Sbjct: 866 DSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  138 bits (348), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 150/562 (26%), Positives = 238/562 (42%), Gaps = 92/562 (16%)

Query: 156 FDLKIPIFSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAN 206
           F  + P F + LY F  F         FTV   +G  A+  +F+ L+             
Sbjct: 441 FKNRSPSFYMGLYSFFVFGQYMFMNIQFTVLCFLGVTAS--KFLNLK------------- 485

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMM 263
            +K  LH    F D   +G +++R   D    + SM  ++++ ++ +   +  ++GV +M
Sbjct: 486 AVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIGVIVM 541

Query: 264 CSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           C +  P  +I + F     +  A  +    R   +        +     E L G+ T+++
Sbjct: 542 CIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRA 601

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           + ++   L + +  I  + + G               +L  +  L +    + L +  Q 
Sbjct: 602 YRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALII----TLLCVTRQF 657

Query: 383 SI-----GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLF--------ELTDRKP 429
            I     G L  ++L      N V    T   +   G  +A RL         E   R+P
Sbjct: 658 KISPSSTGVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEYRRP 714

Query: 430 SISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKS 488
            +SP    +  PDRG I+F+ VSF+Y  RPS+  + KN +  I  G  + I G +G GKS
Sbjct: 715 EMSPP---ENWPDRGEIKFEGVSFAY--RPSLPPVLKNFSLNIGSGEKIGICGRTGAGKS 769

Query: 489 TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI------ 542
           TI   L R      G I IDN +I+ L    LR  + I+ Q+PVL  GTI+ N+      
Sbjct: 770 TIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEK 829

Query: 543 ---------TYGLTYTPTKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGPHGTLLSGG 589
                      G    P  E+I     Q       H+ + KF    +  +   G   S G
Sbjct: 830 TDQELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLG 885

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGQLMKSKSMTIVSIAHR 645
           +KQ +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHR
Sbjct: 886 EKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFGDC------TILCIAHR 939

Query: 646 LSTIRRSENVIVLGHDGSVVEM 667
           L+TI   + ++VL   G V E 
Sbjct: 940 LNTILNYDRILVL-EQGEVAEF 960

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 128/256 (50%), Gaps = 23/256 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S + F+NLNF I  G  + + GP G GK+++   +  +   + G++ ++ +    L+C
Sbjct: 100 KTSFKGFQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSC 156

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   K   R V K C   + +   P    T
Sbjct: 157 GY-----------PWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMT 203

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKS 636
            IG  G  LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K+
Sbjct: 204 EIGERGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKT 263

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS--ALSQLLNEKAAPGPS 694
             + +  H+L+ I ++  +IVLG+DGS   +G ++EL  + +    L Q  ++K+    +
Sbjct: 264 RILAT--HQLALIEKATRLIVLGNDGSFT-IGTYEELQKSNSQLKKLLQFTSDKSEEDDN 320

Query: 695 DQ-QLQIEKVIEKEDL 709
           DQ Q + +K +  EDL
Sbjct: 321 DQKQNENDKEVHAEDL 336

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 144/537 (26%), Positives = 240/537 (44%), Gaps = 47/537 (8%)

Query: 178  LLIGCAANFGRFI--LLRILSERVVARLRANVIKKTLHQDA------EFFDNHKVGDLIS 229
            L I  A  FG  +  L++ +   V   +R +     L  DA       FF+   +G +++
Sbjct: 991  LFIYFALGFGSALSTLIQTVILWVFCTIRGSRYLHDLMTDAVLKAPMSFFETTPIGRILN 1050

Query: 230  RLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
            R  +D Y    ++ R+ +Q   + VK     V  + ++C+ + Q     +F   P+    
Sbjct: 1051 RFSNDIYKIDSILGRTFSQFFVNAVKV----VFVMAVICATTWQF----IFVIIPLGVFY 1102

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
              + +    TS++L+     +TR       +E L GI T++ +  E          + + 
Sbjct: 1103 IYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQEKRFGHINQCRVDNN 1161

Query: 341  FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYT 397
                               L+G +  L       + + +  L+   +G   ++ L    T
Sbjct: 1162 MSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVGLSLSYALQITQT 1221

Query: 398  GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR-----GVIEFKDVS 452
             N +  ++    E+     +  R+ E    + S +P +  + +PD      G I+F++ S
Sbjct: 1222 LNWIVRMTV---EVETNIVSVERVKEYAQLE-SEAPRIVEEKRPDEMWPTEGDIKFENYS 1277

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQD 511
              Y  RP +  + KN+N  I P   V IVG +G GKS++ L L R    T G I ID   
Sbjct: 1278 TRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIP 1335

Query: 512  ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
            I+++    LR  + I+ Q+  +  GT+R+NI    T   T EEI  V +       +   
Sbjct: 1336 INEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSHLKEHVLSM 1393

Query: 572  -PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQ 630
              +  D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T   
Sbjct: 1394 GADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRT 1453

Query: 631  LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
              K +  TI++IAHRL+TI  S+ +IVL   G +VE     EL A P S    L NE
Sbjct: 1454 AFKDR--TILTIAHRLNTIMDSDRIIVLD-KGEIVEFDTPDELLAKPESLFYSLCNE 1507

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 138/285 (48%), Gaps = 22/285 (7%)

Query: 409 SEIMQGAGAASRLFE-LTD---RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI- 463
           +  ++ + + +RLF  LT+   +K SI      + K D  +    + +F +  +P  ++ 
Sbjct: 583 TSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNATFLWKRKPEYKVA 642

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
            KN+NF+   G   CIVG  G GKS +   +L       G  T+               +
Sbjct: 643 LKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRVKGFATVHG-------------N 689

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
           +  V Q P +M+GT+++NI +G  Y   +E      K C     +    +   T++G  G
Sbjct: 690 VAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKACALTIDLGILVDGDQTLVGEKG 747

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + +  G      S T V  
Sbjct: 748 ISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVLC 807

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            +++S +  ++++ +L  +G +V+ G ++E+ ++  S L +L+ E
Sbjct: 808 TNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIKE 851

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 142/550 (25%), Positives = 236/550 (42%), Gaps = 58/550 (10%)

Query: 173  FFTVALLIGCAANFGR----FILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLI 228
            F  + +LI   A F       +LL + S R   +L  ++    L     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPV--LFSAS 286
            +R  SD           V D V+     V+   ++  L   + ++++ +  P+  L +A+
Sbjct: 1076 NRFSSD--------MNSVDDNVQY----VISFFLISILDYVVVVVIIGYQVPLFLLVNAA 1123

Query: 287  VFGKQI----------RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
            + G  +          R   + +  +   +  +  E L+G   + +F    N  SR++  
Sbjct: 1124 LLGIYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFDYL 1179

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSL----LGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFM 391
              +  Q                S+    +G L  LT  L   +       LS G +   M
Sbjct: 1180 NIEAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLM 1239

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG----HKYKPDRGVIE 447
             Y     N +  +     ++     +  R+ E  D  P   P +      K  P +G + 
Sbjct: 1240 SYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVV 1299

Query: 448  FKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIT 506
            FKD S  Y  R ++  + K LN +I P   + IVG +G GKST++L L R   P  GTI 
Sbjct: 1300 FKDYSARY--RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIV 1357

Query: 507  IDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            ID  DI+K+    LR H+ I+ Q+     G++R N+     Y  + +EI    +      
Sbjct: 1358 IDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDEIWRALELSHLKP 1415

Query: 567  FITKFPNT---------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             I K  N           +T I  +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+D
Sbjct: 1416 HILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1475

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANP 677
             E++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E      L A+ 
Sbjct: 1476 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVLDQ-GEVKEFDSPSNLLADK 1532

Query: 678  TSALSQLLNE 687
             +    L ++
Sbjct: 1533 NTIFYNLCSQ 1542

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 134/271 (49%), Gaps = 36/271 (13%)

Query: 441 PDRGVIEFKDVSF--SYPTRPSVQ--------------IFKNLN-FKIAPGSSVCIVGPS 483
           P+  VIE  + +F  + PT+ + +                KN++ F+   G  VC+VG  
Sbjct: 613 PNVPVIEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRV 672

Query: 484 GRGKSTIALLLLRYYNPTTGTITIDNQDISKLN--CKSLRRHIGIVQQEPVLMSGTIRDN 541
           G GKST    LL      + +    +Q   K++  C S    + +  Q+  +++ +++ N
Sbjct: 673 GAGKSTFLHALLGQLPCISSS---HDQATPKMHFRCDS----VALCSQQAWILNASVKYN 725

Query: 542 ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
           + +G  Y   +   ++  + C     +    +  +T++G  G  LSGGQK RI++ARA+ 
Sbjct: 726 VLFGHKYD--EASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQKARISLARAVY 783

Query: 602 KKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIAHRLSTIRRSENVIV 657
            +  + +LD+  SA+D E  +  I++   +   L+K+K  T++   + +S ++ S+++  
Sbjct: 784 SRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYA 841

Query: 658 LGHDGSVVEMGKFKELYA-NPTSALSQLLNE 687
           L  +G +VE G F E+ + +  S L  L+ E
Sbjct: 842 L-ENGEIVERGSFDEIMSKDAESKLKTLIAE 871

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 140/563 (24%), Positives = 234/563 (41%), Gaps = 74/563 (13%)

Query: 163  FSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
            F + LY F  F         FT+   IG  A+                 L    +K+ +H
Sbjct: 934  FYMGLYSFFVFGAYIFMTSQFTILCYIGIGAS---------------KNLNIQALKRIIH 978

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSI 272
                F D   +G +++R   D   +   + + V   V      +VGV +MC +  P  +I
Sbjct: 979  TPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCVMCIVYLPWFAI 1037

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
             + F     +F  + +    R   +        +     E L G+ T++ + +E   +++
Sbjct: 1038 AVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIKFYKSEERYIAK 1097

Query: 333  YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDL 387
             +  I  + + G               ++  ++F  ++   + L +  Q      S+G L
Sbjct: 1098 SDYLIDKMNEAGYLTVCVQRWVAILVDMIA-VAFALII---TLLCVTRQFHISASSVGVL 1153

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL--------FELTDRKPSISPTVGHKY 439
              ++L      N    L    S++     +  RL         E    KP  +P    + 
Sbjct: 1154 LTYVLQLPGLFNT---LLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPP---ES 1207

Query: 440  KPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P+ G I+F++V F+Y  RP + I  KN+N +I     + I G +G GKSTI   L R  
Sbjct: 1208 WPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 499  NPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN---------------IT 543
              T+G+I ID+ DI+KL    LR+ + I+ Q+PVL  G IR N               + 
Sbjct: 1266 ELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLV 1325

Query: 544  YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGPHGTLLSGGQKQRIAIARALI 601
             G    P  E++     Q    +  +   + +  D V+   G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIAP--EDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALV 1383

Query: 602  KKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
            +   ILILDEATS++D E++  I             TI+ IAHRL TI   + ++VL H 
Sbjct: 1384 RNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH- 1440

Query: 662  GSVVEMGKFKELYANPTSALSQL 684
            G V E      L+ + T+    +
Sbjct: 1441 GEVAEFDTPMNLFKDETTIFHNM 1463

 Score =  100 bits (249), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 108/206 (52%), Gaps = 20/206 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F NLNF+I  G  V I GP G GK+++      +   T+GTI I N D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQI-NGDL----------- 659

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
             ++   P + + T+RDNI +G  Y   K   + V + C   + +   P    T IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEEDK--YKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    +L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMG 668
            H+LS I ++  +IVLG+DGS VE+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIG 798

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 149/572 (26%), Positives = 238/572 (41%), Gaps = 83/572 (14%)

Query: 168  YEFLSF-FTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGD 226
            Y F+S  FT+   IG AA+                 L    +K+ LH    F D   +G 
Sbjct: 907  YFFMSLQFTILCYIGLAAS---------------KWLNLKAVKRLLHTPMSFMDTTPLGR 951

Query: 227  LISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILLLFFTPPVLFSA 285
            +++R   D   +   +T+ V   V      + GV +MC +  P  +I + F     +  A
Sbjct: 952  VLNRFTKDTDTLDNELTESVRLFVYQ-TANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVA 1010

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E LSG+ T++++ +E   L + +  I  + + G 
Sbjct: 1011 DHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEAGY 1070

Query: 346  XXXXXXXXXXXXXSLLG----------------DLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                          ++                 D+S  +V    +Y VLQ    +  L  
Sbjct: 1071 LVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTY-VLQLPGLLNGLLR 1129

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFK 449
             M   E   N+V  +  + +E+ Q A           RKP ++P    +  P  G + F 
Sbjct: 1130 AMTQAENDMNSVERIVNYATELPQEAAY---------RKPEMTP---QEPWPSNGEVVFD 1177

Query: 450  DVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
            +VS SY  RP +  + K ++  I  G  + I G +G GKSTI   L R      G + ID
Sbjct: 1178 NVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLID 1235

Query: 509  NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YG------------LTYTPTKEEI 555
              D SKL    LRR + I+ Q+PVL  G+IR N+  +G             + T   EE+
Sbjct: 1236 GVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEAEEV 1295

Query: 556  RSVAKQ--------CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
              V  Q           H F        D  +   GT  S G++Q +A+ RAL+++  IL
Sbjct: 1296 EKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALTRALVRQSKIL 1349

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I     Q  +    TI+ IAHRL TI   + ++VL  +G+V E 
Sbjct: 1350 ILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVL-DNGTVKEF 1406

Query: 668  GKFKELYANPTSALSQLLNE---KAAPGPSDQ 696
               + L+    +   ++ ++   KA   P +Q
Sbjct: 1407 DTPRSLFRIKDTIFREMCDKSGIKAEDFPGEQ 1438

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 120/256 (46%), Gaps = 21/256 (8%)

Query: 452 SFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQD 511
           +F+   + S   FKNLNF+I  G  V I G  G GKS++   L  +   T G I    ++
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIF---KN 615

Query: 512 ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
            S L C             P + + T+RDNI +G ++   +   + V + C     +   
Sbjct: 616 GSLLLCGY-----------PWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDIL 662

Query: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ 630
           P    T IG  G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++     
Sbjct: 663 PAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMG 722

Query: 631 LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAA 690
           ++  K+  + +  H+LS I R+  VI LG  GS  ++G  +EL     S   +L+     
Sbjct: 723 MLDGKTRILAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLMEFSTQ 778

Query: 691 PGPSDQQLQIEKVIEK 706
              ++Q+ +++   E+
Sbjct: 779 TKSANQREEVDDHAEE 794

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 145/549 (26%), Positives = 245/549 (44%), Gaps = 64/549 (11%)

Query: 164  SLPLYEFL-SFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            S   YE L S F V   I     F     + + S +   +L    + K LH    F ++ 
Sbjct: 519  SASFYEGLYSLFIVLFFIFLVCQFCVCFFVGLNSSK---KLNLRAVHKVLHTPMSFIEST 575

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++ D V+     +  + G+ +MC +  P  +I++ F  
Sbjct: 576  PIGRIMNRFTKD----TDNLDGQILDNVRLTFYHMSTMFGICIMCIVYLPWFAIVIPFLI 631

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
              ++F  + +    R   +        +     + L G+  ++++  +   + + +  I 
Sbjct: 632  FTIVFIFNFYQGSSREIRRLEAVRRSFIFNNINDVLGGLDIIKAYQVQNRFIFKSDYLIN 691

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDL-----SFLTVL------AYGSYLVLQSQLSIGDL 387
               +                S++G L     S L V          + ++L   L I ++
Sbjct: 692  KTNEASYLYTGVQLWNNILVSIIGVLFALIISLLCVTKQFKISGSSTGVLLTYVLQIPNI 751

Query: 388  TAFMLYT----EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR 443
              ++L T    E   N+V  L T+ + + Q         E T  KP  SP  GH + P+ 
Sbjct: 752  LNYLLDTLKKAENDMNSVERLVTYATNLPQ---------ERTSSKPETSP--GHIW-PEN 799

Query: 444  GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
            G I+FKD +F Y     + I KN N  +  G  + I G +G GKSTI   L R    T G
Sbjct: 800  GKIQFKDANFRYKEGLPL-ILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDELTDG 858

Query: 504  TITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI---TYGLTYTPTKEEIRS--V 558
             I ID+ DIS L    LR+++ I+ Q+P+L  GTIR N+   +Y    T  +  I S  +
Sbjct: 859  AIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILSGFI 918

Query: 559  AKQCFCH--------NFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
             +  F H          +TKF  T    +   GT  S G+KQ +A  RA+I    +++LD
Sbjct: 919  DRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLGEKQLLAFTRAIIHHSKVVVLD 976

Query: 611  EATSALDVESEGAINYTFGQLMKSKSM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            EA+S++D E++  I     Q + SK     TI+ IAHRL+TI + + ++VL H G+++  
Sbjct: 977  EASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNTILKYDRILVLDH-GNIIGF 1030

Query: 668  GKFKELYAN 676
               + L+ N
Sbjct: 1031 ENPRVLFEN 1039

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 105/214 (49%), Gaps = 26/214 (12%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F NLNF I  G  + I GP G GK+++   +        GTI ID               
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEID--------------- 248

Query: 524 IGIVQ--QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
            G +Q    P + + T+RDNI +G  Y   KE+   V + C     +  F     T IG 
Sbjct: 249 -GNLQLCGYPWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGE 305

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTI 639
            G  LSGGQK RI +ARA+ K   I + D+  SA+D      I  N   G L   K+  I
Sbjct: 306 LGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXI 364

Query: 640 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
           ++  H+LS I++++ ++VLG+D S  E+G +KEL
Sbjct: 365 LA-THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 232/515 (45%), Gaps = 36/515 (6%)

Query: 189  FILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAY----VVSRSMTQ 244
            ++   I + + +  L AN +   L     FF+   +G +++R  +D Y    ++ R+ +Q
Sbjct: 1015 WVFCTIHASKYLHNLMANSV---LRAPMAFFETTPIGRILNRFSNDIYKVDALLGRTFSQ 1071

Query: 245  KVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
               + VK +      + ++C+ + Q     +F   P+      + +    TS++L+    
Sbjct: 1072 FFVNAVKVIFT----ITVICATTWQF----IFIIIPLGVCYIYYQQYYLRTSRELRR-LD 1122

Query: 305  QLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVGXXXXXXXXXXXXXX 358
             +TR       +E L G+ TV+ + ++    S  N   I +                   
Sbjct: 1123 SITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRL 1181

Query: 359  SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
             L+G +  L       + + Q  L+ G     + Y       +  +     E+     + 
Sbjct: 1182 ELIGSIIILGAATLSVFRLKQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSV 1241

Query: 419  SRLFELTDRKPSISPTV-GH---KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAP 473
             R+ E  D K     T+ GH   K  P +G I+F + S  Y  RP +  + K++N  I P
Sbjct: 1242 ERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKP 1299

Query: 474  GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVL 533
               + IVG +G GKS++ L L R    + G I ID   I+++    LR  + I+ Q+  +
Sbjct: 1300 NEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQV 1359

Query: 534  MSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQ 592
              G++R+NI     Y  T E I R++       + ++   +  D  +   G  LS GQ+Q
Sbjct: 1360 FEGSLRENIDPTNQY--TDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQ 1417

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS 652
             + +ARA++    ILILDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S
Sbjct: 1418 LLCLARAMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDS 1475

Query: 653  ENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            + +IVL  +G+V E     +L +N  S    L  E
Sbjct: 1476 DRIIVLD-NGTVAEFDSPSQLLSNSESLFHSLCAE 1509

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 117/242 (48%), Gaps = 22/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   C+VG  G GK+ +   +L       G  T+ 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVH 691

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                          +  V Q P +M+GT+ +NI +G  Y    E      K C     +
Sbjct: 692 GS-------------VAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTIDL 736

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  +++V +L  +G +++ G + E+  +  S L +LL
Sbjct: 797 LGPNGLLHTKTRLLAT--NKVSALSIADSVALLD-NGEIIQKGTYDEITKDADSPLWKLL 853

Query: 686 NE 687
           N+
Sbjct: 854 ND 855

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 99/317 (31%), Positives = 160/317 (50%), Gaps = 29/317 (9%)

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGH---- 437
            LS G +   M Y     N +  +     ++     +  R+ E  D  P   P +      
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 438  KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K  P +G+I FK+ S  Y  R ++  + ++L+ +I P   + IVG +G GKST++L L R
Sbjct: 1281 KNWPSQGLIRFKNYSTRY--RANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFR 1338

Query: 497  YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
               P+ GTI ID  DISK+  K LR ++ I+ Q+     GT+R N+     Y  + EEI 
Sbjct: 1339 ILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIW 1396

Query: 557  SVAKQCFCHNFITKFP----------NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTI 606
               +       I K            +   T I  +G+ LS GQ+Q + ++RAL+ +  I
Sbjct: 1397 KALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRI 1456

Query: 607  LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
            L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL       +
Sbjct: 1457 LVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-------D 1507

Query: 667  MGKFKELYANPTSALSQ 683
             G+ KE + +P++ L+Q
Sbjct: 1508 KGEVKE-FDSPSNLLAQ 1523

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 134/274 (48%), Gaps = 44/274 (16%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYY-----NPTTGTITIDNQDISKLNC 517
            KN++ F++  G  VC+VG  G GKST    LL        +P+  + T+  +  S    
Sbjct: 643 LKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLPCISNSPSHASPTVHFRANS---- 698

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFP 572
                 + +  Q+  +M+ +++DN+ +G      TY  T E  + V         +    
Sbjct: 699 ------VALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILA 745

Query: 573 NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES-----EGAINYT 627
           +  +T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D E      E  ++  
Sbjct: 746 DGDETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKK 805

Query: 628 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY-ANPTSALSQLL- 685
            G L+K+K  T++   + +S ++ S+++  L  DG +VE G F ++   + +S L +L+ 
Sbjct: 806 TG-LLKNK--TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIV 861

Query: 686 -----NEKAAPGPSDQQLQIEKVIEKEDLNESKE 714
                N KA   P D +++    +E  + N  +E
Sbjct: 862 ECESENTKAKIEPVDSEIKAPVNLEDVECNAMEE 895

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  136 bits (342), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 146/562 (25%), Positives = 247/562 (43%), Gaps = 92/562 (16%)

Query: 163  FSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
            F + LY F  F         FT+   IG  A+                +L  + +++ LH
Sbjct: 918  FYMGLYSFFVFGGYIFMTSQFTIVCFIGVNAS---------------KKLNLSAVRRILH 962

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSI 272
                F D   +G +++R   D   +   +T+ V   + A    ++GV +MC +  P  +I
Sbjct: 963  TPMAFLDTTPLGRILNRFTKDTDSLDNELTENVR-LMLAQFANIIGVCVMCIIYLPWFAI 1021

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++  ++++  EA  +  +     E L G+ T++ + +E  
Sbjct: 1022 AI----PFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEER 1077

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----S 383
             +++ +  I  + + G               ++  + F  ++A    L +  Q      S
Sbjct: 1078 FMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIA-VCFALIIAL---LCVTRQFHISASS 1133

Query: 384  IGDLTAFMLY--------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
            +G L  ++L               TE   N+V  L ++ +E+   A           RKP
Sbjct: 1134 VGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---------RKP 1184

Query: 430  SISPTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
              SP       P  G I+F++VSF+Y P  P+V   KNL+  I  G  + I G +G GKS
Sbjct: 1185 ESSPDPSW---PQEGKIDFEEVSFAYRPGLPAV--LKNLSMSINGGEKIGICGRTGAGKS 1239

Query: 489  TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGLT 547
            TI   L R     +G I ID  +IS +    LRR + I+ Q+PVL  GTIR N+  +G  
Sbjct: 1240 TIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGER 1299

Query: 548  Y------------TPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGPHGTLLSGGQKQR 593
                         +  KE +  V  Q    N   +  + +  D  +   G+  S G++Q 
Sbjct: 1300 SDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQL 1359

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS-MTIVSIAHRLSTIRRS 652
            +A+ARAL++   +LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI   
Sbjct: 1360 LALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNY 1416

Query: 653  ENVIVLGHDGSVVEMGKFKELY 674
            + ++VL   G + E      LY
Sbjct: 1417 DRILVL-EKGEIAEFDSPYNLY 1437

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 103/211 (48%), Gaps = 20/211 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           FK++N +I  G  + I GP G GK+++   +      T G++ I+ +             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
             ++   P + + T+RDNI +G  +  +K  +  V K C     +   P    T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-NYTFGQLMKSKSMTIVSI 642
             LSGGQK RI +AR + K   I + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            H+LS +  +  VIVLG+DGS V++G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 145/520 (27%), Positives = 231/520 (44%), Gaps = 80/520 (15%)

Query: 206  NVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 265
            N++   LH    FFD   +G +++R   D   V + +T  +   +  LI     + ++  
Sbjct: 1083 NMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITI 1142

Query: 266  LSPQLSI------LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKT 319
            ++P   I      +L +F      +AS   K+I + +K        + +   E L G+ T
Sbjct: 1143 ITPHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITK------SPIFQHFSETLVGVCT 1196

Query: 320  VQSFVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            +++F  E       L + +   R  F +               + +       VLA GS+
Sbjct: 1197 IRAFGDEKRFILENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFI-------VLASGSF 1249

Query: 376  LVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT----- 425
            +++      S L+   LT  +L+T+        L   YS       +  RL E +     
Sbjct: 1250 ILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQE 1305

Query: 426  ---DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCIVG 481
               D        +     P+ G IE  ++S  Y +  P V   KN++F I P S V IVG
Sbjct: 1306 NYFDYNKDHIQELQQSSWPEHGQIEVDNLSLRYASNLPPV--IKNVSFTIEPQSKVGIVG 1363

Query: 482  PSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN 541
             +G GKSTI   L R   P TG I ID  DIS+++  +LRR I I+ Q+P+L +GTI+ N
Sbjct: 1364 RTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSN 1423

Query: 542  ITYGLTYTPTKEEIRSVAKQCFCHNFIT-------------------KFPNTYDTVIGPH 582
            +     Y   K  I  V  Q    N I+                   KF N   T I   
Sbjct: 1424 VDPCDEYDNKK--IFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFVNL-QTEITEG 1477

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF-GQLMKSKSMTIVS 641
            G  +S G++Q + IAR+L+++P I++LDEATS++D ES+  I      +  KS   TI++
Sbjct: 1478 GQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS---TILT 1534

Query: 642  IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            IAHRL ++   + V+V+       + G+ KE Y +P + L
Sbjct: 1535 IAHRLRSVIDYDRVLVM-------DAGEIKE-YDHPYNLL 1566

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 128/519 (24%), Positives = 221/519 (42%), Gaps = 63/519 (12%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  ++      V+A+I  ++ VG++      S    +SI+L+ F
Sbjct: 446 NLGTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIILMMF 504

Query: 278 TPPVLFS-ASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGIKTVQSFVAEGNELSR 332
             P+ F  A + GK         Q++  Q T  R+A+  E L  I+ V+ F  E N +S+
Sbjct: 505 --PLNFRLAELLGK--------FQKSALQCTDKRIAKLNECLQNIRIVKYFAWENN-ISK 553

Query: 333 YNVAIRD-----IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              +IR      +FQ                +L+  ++F  +  +  +  L + L+   L
Sbjct: 554 DIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTL 612

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK-----PD 442
           + F L        +  LS   S + Q   +  R+ +  +   +       KY      PD
Sbjct: 613 SLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFINEDDT------EKYNQLTVSPD 662

Query: 443 RGVIEFKDVSFSY-PTRPSVQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
              IEFK+ + ++        IFK   LN     G    I+G +G GKS + + LL   +
Sbjct: 663 ENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELH 722

Query: 500 PTTGTITIDN----QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
             +G+IT+       D+   +   L        Q   L++ T+++NI +   Y   +   
Sbjct: 723 LISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--Y 779

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           + V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD+  SA
Sbjct: 780 KEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSA 839

Query: 616 LDVESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
           +D  +   I  N   G +M+++  T + + H +S   R     V+  +G V   G  K+L
Sbjct: 840 VDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILENGKVKNQGTIKQL 897

Query: 674 YANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNES 712
               T    + + + +  G   ++     V E  DL ES
Sbjct: 898 --EKTGIFKEEIAQMSYKGDRTEK----SVNETSDLQES 930

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 147/556 (26%), Positives = 236/556 (42%), Gaps = 64/556 (11%)

Query: 156  FDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQD 215
            F  K   F + +Y F  FF   +         +F L+  +      RL    +++ LH  
Sbjct: 935  FKHKKTPFYMGMYTFFVFFNYFVTTS------QFSLICYIGLSAAKRLNLKAVQRLLHTP 988

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLL 275
              F D   +G +++R   D   V   +T+ V   V  L   +VGV +MC       I L 
Sbjct: 989  MSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQL-SNIVGVIVMCI------IYLP 1041

Query: 276  FFTPPVLFSASVF---GKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGN 328
            +F   V F   VF       +++S++++     Q + V     E L G+ T++++  E  
Sbjct: 1042 WFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L++ +     + + G               ++  ++F  ++   + L +  Q  I   +
Sbjct: 1102 FLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIA-MAFALIV---TLLCVTRQFHISAAS 1157

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGH 437
              +L T Y       L+     + QG     +  RL         E   R+P +SP    
Sbjct: 1158 VGVLLT-YVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEW 1216

Query: 438  KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
               P  G IEF  VS +Y  RP +  + K++   +A G  + I G +G GKSTI   L R
Sbjct: 1217 ---PTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYR 1271

Query: 497  YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK---- 552
                  G+ITID  DIS L    LR  + I+ Q+PV+  G +R N+      T  +    
Sbjct: 1272 MCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHA 1331

Query: 553  ---------EEIRSVAKQCFCHNFITKFPNTY----DTVIGPHGTLLSGGQKQRIAIARA 599
                     E + +V  Q   H       N +       +   GT  S G++Q +A+ RA
Sbjct: 1332 LVRGGAIPAESLATVRAQ--THENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRA 1389

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659
            L+++  ILILDEATS++D E++  I     +     + TI+ IAHRL+TI   + ++VL 
Sbjct: 1390 LVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNCTILCIAHRLNTILDYDRILVLD 1447

Query: 660  HDGSVVEMGKFKELYA 675
              G V E      LYA
Sbjct: 1448 Q-GRVCEFDTPAALYA 1462

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 98/212 (46%), Gaps = 22/212 (10%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F NLN +I  G  V + G  G GKS++   L  +   T G I    +D + L C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIY---KDGTMLLCGY---- 655

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T+RDNI +G  Y   +     + + C     +   P    T IG  G
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSKSMTIVS 641
             LSGGQK RI +ARA+ KK  I + D+  SA+D      I      G+L  S   T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRVL 763

Query: 642 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
             H+LS I R+  VI +  DGS V++G  +EL
Sbjct: 764 ATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 128/490 (26%), Positives = 226/490 (46%), Gaps = 54/490 (11%)

Query: 205  ANVIKKTL-----HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 259
            AN+I K L     +    FFDN  +G +++R   D  V+   +   +       I  V  
Sbjct: 1132 ANLIFKKLLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTA 1191

Query: 260  VGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLS 315
            + ++  ++P+  I+ +F    ++ S+   G      S++L+  E++ +  + +   E LS
Sbjct: 1192 LMLIVFITPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLS 1247

Query: 316  GIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            G+ T+++F   GNE+      +  I +                  +  L  +TV   G++
Sbjct: 1248 GLVTIRAF---GNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAF 1304

Query: 376  LVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP- 429
            ++L +      L+   LT  + +TE+       +  FYS +     +  RL E  + +  
Sbjct: 1305 ILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEE 1360

Query: 430  ------SISPTVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGP 482
                  +I+P+   +  P +G I F + S  Y P  P V   K LN KI  GS + +VG 
Sbjct: 1361 ALADPGAITPS---ENWPVQGAITFANYSLRYAPKLPDV--LKQLNLKIDGGSKIGVVGR 1415

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ + ++G I ID+ DIS++N + LR  + I+ Q+P L  GTIR N+
Sbjct: 1416 TGAGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNL 1475

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITKF-----------PNTY---DTVIGPHGTLLSG 588
                 Y         V       +++               N +   D+ I   G  LS 
Sbjct: 1476 DPNEEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQ 1535

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 648
            GQ+Q I +AR+++    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ +
Sbjct: 1536 GQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKS 1593

Query: 649  IRRSENVIVL 658
            +   + ++VL
Sbjct: 1594 VIDYDKILVL 1603

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 121/474 (25%), Positives = 212/474 (44%), Gaps = 60/474 (12%)

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL----LLFFTPP 280
           G +I+ + +DA  V   +   +   ++ALI  VV V ++  +    + +    ++FF P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIPF 554

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
            +F   +  +  R T       T Q  +   E    I+ ++SF  E N + +    I  +
Sbjct: 555 NVFLTKLIARFQRET----LTFTDQRIQNLNETFQSIRIIKSFGWENNIIQK----ILGL 606

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                             +L+  LS   +T L++  Y+++  Q    DLT       +T 
Sbjct: 607 RNKEISVLKRNSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTT---PVAFTA 659

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVS------ 452
            A+F L    + + Q +   + L   T  K S+      K+   +   +F+++S      
Sbjct: 660 LALFNL--LKAPLDQLSNTINFL---TQSKVSLDRI--EKFLSVKETTKFENLSVDSSQN 712

Query: 453 ---FSYPT------RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
              FS  T      + S Q+ +N+N +   G    ++GP+G GK+++ + LL   +  +G
Sbjct: 713 RLAFSGATLGWCGNKKSFQL-RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSG 771

Query: 504 TITIDNQDISKLNC----KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
            + + N + SK N      +L   I    Q P + + TIR+NI + + Y   K+   +V 
Sbjct: 772 KVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVV 828

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             C              T++G  G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  
Sbjct: 829 IACGLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSH 888

Query: 620 SEGAINYTF---GQLMKSKSMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMGK 669
           S   I Y     G LM+ ++  +VS  H +S TI+++  V ++  +G +V  G+
Sbjct: 889 SAKWI-YNVCITGPLMQGRTCILVS--HNVSLTIKKASKVFMI-ENGYIVASGR 938

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 134/504 (26%), Positives = 227/504 (45%), Gaps = 54/504 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            V+ K LH    FFD    G +++RL  D   V + +         A++  +  + ++  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +PQ  I+ +F    + F  ++ G     TS++L+         + +   E L GI ++++
Sbjct: 1174 TPQFLIMAIF----IGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRA 1229

Query: 323  FVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYL 376
            +  E       LSR +   R  F +                LLG L   F  +  Y +  
Sbjct: 1230 YGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFRV----DLLGALVTFFSGLFIYLNIG 1285

Query: 377  VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPSISP 433
             L + L+   LT  + +TE            YS +     +  RL    E+     + + 
Sbjct: 1286 KLDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNENA 1341

Query: 434  TVGHKYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
             +     P  G I+  D+S  Y P  P  ++ KN+NF + P   V IVG +G GKSTI  
Sbjct: 1342 QLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTIIT 1399

Query: 493  LLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
             + R+ +P TG + IDN DI+ +    LR+ I I+ Q+P L +GT++  +     Y+  +
Sbjct: 1400 AMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQ 1459

Query: 553  --EEIRSV-------------AKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIA 597
              E ++ V                      I KF +  + V    G  LS GQ+Q + +A
Sbjct: 1460 IYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEVT-EGGANLSQGQRQLVCLA 1518

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 657
            R+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   + V+V
Sbjct: 1519 RSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLV 1576

Query: 658  LGHDGSVVEMGKFKELYANPTSAL 681
            +       + G+ KE Y +P S L
Sbjct: 1577 M-------DAGEVKE-YDHPYSLL 1592

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 106/229 (46%), Gaps = 9/229 (3%)

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + F++ + ++   PS    +N++ +   G      GP+G GKS++ L LL       G I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 506 ---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
              ++D ++   +    L   I    Q   L++ T R NI +   Y   ++    V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEAC 789

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                         T IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 623 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            I  N   G LM+ ++  +VS  H ++   R+ + +V+  +G V   G+
Sbjct: 850 LIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 143/547 (26%), Positives = 242/547 (44%), Gaps = 64/547 (11%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  ++             L ++++   L     FF+   +G +++R  +D
Sbjct: 1018 TVVLWVFCTIHGSKY-------------LHSSMVSSILRAPMTFFETTPIGRILNRFSND 1064

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    V+ RS +Q   + VK     +V    +C  + Q  +L++    P+      + +
Sbjct: 1065 VYKIDEVLGRSFSQFFVNAVKVSFTILV----ICWNTWQFILLVI----PMGVLYLYYQQ 1116

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++     G E  +  + I    +V   
Sbjct: 1117 YYLRTSRELRRLDSITKSPIYAHFQESLGGLATIR-----GYEQQKRFIHINQA-RVDNN 1170

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L FL +++ +G+  +   +L  G LTA M+     Y      +
Sbjct: 1171 MSAYYPSINSNRWLAYRLEFLGSLIIFGAASLSILKLRDGTLTAGMIGLSLSYALQVTQS 1230

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRGVIEFKDVSFSY 455
            +  +     E+     +  R+ E  + K S +P +  + +P     +RG I+F++ S  Y
Sbjct: 1231 LNWIVRMTVEVETNIVSVERIKEYAELK-SEAPLIIEEKRPSENWPERGAIKFENYSTRY 1289

Query: 456  PTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
              RP +  + KN++  I P   V IVG +G GKS++ L L R      G+I +D  +IS+
Sbjct: 1290 --RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNISE 1347

Query: 515  LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            +    LR  + I+ Q+  +  GTIR+NI     Y  T E+I +  +       I +    
Sbjct: 1348 IGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIY--TDEQIWNALELSHLKQHILRMNEE 1405

Query: 572  ------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
                   N   T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I 
Sbjct: 1406 SVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSLIQ 1465

Query: 626  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
             T     K +  TI++IAHRL+TI  S+ ++VL   G V E    + L  N  S    L 
Sbjct: 1466 ETIRTAFKDR--TILTIAHRLNTIMDSDKIVVLD-KGEVAEFDTPQNLLKNTESLFYSLC 1522

Query: 686  NEKAAPG 692
             +    G
Sbjct: 1523 EQSGLNG 1529

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 100/397 (25%), Positives = 177/397 (44%), Gaps = 42/397 (10%)

Query: 307 TRVAEEQLSGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
           TRV  E L+ IK+++ +  E       E  R    ++++ ++G               L+
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLV 544

Query: 362 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 421
              +F  V  Y     L + L    LT F L T      +  L    +  ++ + + SRL
Sbjct: 545 SCSTF-AVFVYIEDKPLTTDLVFPALTLFNLLTF----PLAALPIVITAFIEASVSMSRL 599

Query: 422 FEL-------TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAP 473
           F         TD    + P    K + D  V    + +F +  +P  ++  KN+ F+   
Sbjct: 600 FSFMTNEELQTDAIQRLPPV---KKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKK 656

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVL 533
           G   CIVG  G GKS     +L       G  TI               ++  V Q P +
Sbjct: 657 GELACIVGKVGSGKSAFIQSILGDLFRVKGFATIHG-------------NVAYVSQLPWI 703

Query: 534 MSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQR 593
           M+GT++DNI +G  Y   +E      + C     ++  P+   T++G  G  LSGGQK R
Sbjct: 704 MNGTVKDNILFGHKYN--QEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKAR 761

Query: 594 IAIARALIKKPTILILDEATSALDVE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTIR 650
           +++ARA+  +  + +LD+  +A+D   S+  I +  G   L+ +K+  + +  +++S + 
Sbjct: 762 LSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLAT--NKISVLS 819

Query: 651 RSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            ++N+ +L  DG +V+ G + E+  N  S L +L++E
Sbjct: 820 IADNITLLD-DGEIVQQGTYNEVTDNINSPLCKLISE 855

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 131/516 (25%), Positives = 236/516 (45%), Gaps = 75/516 (14%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ + LH    FFD+  +G +++R   D      S+ Q++   ++++    + V      
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFA---- 1180

Query: 267  SPQLSILLLFFTPPVLFSA--------SVFGKQIRNTSKDLQE----ATGQLTRVAEEQL 314
                ++LL+ +  P  F          S+ G     TS++L+     +   + +   E L
Sbjct: 1181 ----TLLLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETL 1236

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T+++F  +     + N+++ D  Q                  +  +  L + + G 
Sbjct: 1237 VGVTTIRAF-GDEQRFIKENLSMID--QNSMPFFYLWVVNRWLSFRIDLIGALVIFSSGV 1293

Query: 375  YLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DR 427
            +++L      + L+   LT  + +TE    A   L   YSE+     +  R+ E    ++
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 428  KPSISPTVGH----KYKPDRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            +P I+            PD G +E  ++S  Y P  P V   K++ F I P   V IVG 
Sbjct: 1350 EPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLPYV--IKDVTFTIEPLEKVGIVGR 1407

Query: 483  SGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+    TG+I +D  +I+ ++ K LRR I I+ Q+P L +G+IR N+
Sbjct: 1408 TGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL 1467

Query: 543  TYGLTYTPTKEEIRSVAK-----------------QCFCHNFITKFPNTYDTVIGPHGTL 585
                 Y  + EEI +  K                 Q      + KF N  ++ I   G+ 
Sbjct: 1468 DPYDEY--SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIAEGGSN 1524

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
             S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q  +  + T+++IAHR
Sbjct: 1525 FSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHR 1582

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
            L +I   + ++V+       + G+ KE + +P S L
Sbjct: 1583 LRSIVDYDKILVM-------DAGEVKE-FDHPYSLL 1610

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 110/235 (46%), Gaps = 9/235 (3%)

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + F++V+  + +     + +NL+ +   G    IVG +G GK++I + LL     + G I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 506 TIDN---QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            + +   +   +     +   I    Q   L++ T+R+NI +   +   + +  +V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                         T IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 623 AI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
            I      G LM+ +  T + + H ++   ++ + +V+  DG V E G   EL A
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 147/545 (26%), Positives = 248/545 (45%), Gaps = 46/545 (8%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLI 228
            F  V  LIG A+    N    ++L   S R   +L  ++ K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRII 1079

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  SD   V  ++    S   K+++  +V V ++    P   +  +F     ++  + +
Sbjct: 1080 NRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFY 1139

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQ 342
                R   + +  +   +  +  E L+G   +      + F+    E  +YNV     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFR 1199

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 401
                             +L       +LA  + +  + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLAT----AILALAT-MNTKRQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 402  FGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYKPDRGVIEFKDVSFSYPT 457
            + + T  + I     +  R+ E  +  P   SI+P     +  P +G IEFK+ S  Y  
Sbjct: 1255 WIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY-- 1311

Query: 458  RPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516
            R ++  +  N+N KI P   V IVG +G GKST++L L R   PT G I ID  DIS + 
Sbjct: 1312 RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIG 1371

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-- 574
               LR H+ I+ Q+     GT++ N+     Y  +++E++   +Q      + K  ++  
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKRAVEQAHLKPHLEKMLHSKP 1429

Query: 575  ---------------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                            D  I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E
Sbjct: 1430 RGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDME 1489

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            ++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   GSV E     +L ++ TS
Sbjct: 1490 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDQ-GSVREFDSPSKLLSDKTS 1546

Query: 680  ALSQL 684
                L
Sbjct: 1547 IFYSL 1551

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 127/251 (50%), Gaps = 15/251 (5%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            KN++ F+   G  VC+VG  G GKST    +L      +G+    +    KL  +S   
Sbjct: 654 LKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGS---RDSIPPKLIIRS--S 708

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
            +    QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G  
Sbjct: 709 SVAYCSQESWIMNASVRENILFGHKFDQDYYDL--TIKACQLLPDLKILPDGDETLVGEK 766

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMTIV 640
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   G+    K+ TI+
Sbjct: 767 GISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTII 826

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY--ANPTSALSQLLNEKAAP--GPSDQ 696
              + +S ++ S+ +  L  +G +VE G ++++    N TS L +LL E  +P    ++ 
Sbjct: 827 LTTNTVSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNES 885

Query: 697 QLQIEKVIEKE 707
            +Q E   E E
Sbjct: 886 DVQTEHRSESE 896

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 134/522 (25%), Positives = 230/522 (44%), Gaps = 45/522 (8%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
            L++F+  + + L I  AA  N    I+L   S R    L   +    L     FF++  +
Sbjct: 1025 LWKFVGIYAL-LGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPI 1083

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V R++    +   K ++   V + ++    P      L F   +L  
Sbjct: 1084 GRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMP----WFLVFNAGLLVV 1139

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFV-AEGNELSRYNVAIRD 339
               +       S++L+     A   +  +  E L G   + +F  +E      +N   + 
Sbjct: 1140 YVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLNFN---KT 1196

Query: 340  IFQVGXXXXXXXXXXXXXXSLL---GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
             FQ+                L    G +  +T L   + +  + Q++ G +   M Y   
Sbjct: 1197 QFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQ 1256

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR-----GVIEFKDV 451
              N++  +    + I     +  R++E   + PS +P +    +P++     G I FKD 
Sbjct: 1257 VTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEKSWPSMGEIIFKDY 1315

Query: 452  SFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            S  Y  RP +  + K +N  I P   + +VG +G GKS+++L L R    T G+I ID  
Sbjct: 1316 STKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGV 1373

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITK 570
            DISK+    LR H+ I+ Q+     GT+R N+     Y+   +EI    +       I K
Sbjct: 1374 DISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSV--QEIWKAVELAHLKPHIIK 1431

Query: 571  F-----PN---------TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                  P+           D  I  +G  +S GQ+Q + ++RAL+ K  +L+LDEAT+A+
Sbjct: 1432 MMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAV 1491

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVL 658
            D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL
Sbjct: 1492 DMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL 1531

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 117/237 (49%), Gaps = 17/237 (7%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIV 527
           +F+   G+  C+VG  G GKST+   +L      +G     + +I         R +   
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEI-----LVRARSVAYC 715

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
            Q P +M+ +I+DNI +G  Y  T   +    K C     +       +T++G  G  LS
Sbjct: 716 PQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLS 773

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSMTIVSIA 643
           GGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K  TI+   
Sbjct: 774 GGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTT 831

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYA-NPTSALSQLLNE--KAAPGPSDQQ 697
           + +S ++ S N+I     G +VE G +++  +    S L +L+ E    A  PSD++
Sbjct: 832 NAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDKK 887

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 140/530 (26%), Positives = 241/530 (45%), Gaps = 37/530 (6%)

Query: 177  ALLIGCA-ANFGRFILLRILSERVVARLRANVIKKT-LHQDAEFFDNHKVGDLISRLGSD 234
            AL IG A A   + I+L +      ++   N++  + L     FF+   +G +++R  +D
Sbjct: 997  ALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSND 1056

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    ++ R+ +Q   + VK        + ++C+ + Q     +F   P+      + +
Sbjct: 1057 IYKVDALLGRTFSQFFVNAVKVTFT----ITVICATTWQF----IFIIIPLSVFYIYYQQ 1108

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVG 344
                TS++L+     +TR       +E L G+ TV+ + ++    S  N   I +     
Sbjct: 1109 YYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNMSAF 1166

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                           L+G +  L       + + Q  L+ G +   + Y       +  +
Sbjct: 1167 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWI 1226

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRP 459
                 E+     +  R+ E  D K S +P +  GH   K  P +G I+F + S  Y  RP
Sbjct: 1227 VRMTVEVETNIVSVERIKEYADLK-SEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RP 1283

Query: 460  SVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
             +  + K++N  I P   V IVG +G GKS++ L L R    + G I IDN  I+++   
Sbjct: 1284 ELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLY 1343

Query: 519  SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDT 577
             LR  + I+ Q+  +  GT+R+NI     Y  T E I R++       + ++   +  D 
Sbjct: 1344 DLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALELSHLKEHVLSMSNDGLDA 1401

Query: 578  VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
             +   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE++  +  T     K +  
Sbjct: 1402 QLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR-- 1459

Query: 638  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            TI++IAHRL+TI  S+ +IVL  +G V E     +L ++  S    L  E
Sbjct: 1460 TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 122/253 (48%), Gaps = 24/253 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G+  CIVG  G GK+ +   +L       G  T+ 
Sbjct: 631 DATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVH 690

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                          +  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 691 GS-------------VAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTIDL 735

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 736 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHV 795

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  ++++ +L  +G + + G + E+  +  S L +LL
Sbjct: 796 LGPNGLLHTKTKVLAT--NKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKLL 852

Query: 686 NE--KAAPGPSDQ 696
           N   K   G S++
Sbjct: 853 NNYGKKNNGKSNE 865

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 140/554 (25%), Positives = 245/554 (44%), Gaps = 71/554 (12%)

Query: 168  YEFLSFFTVALL---IGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
            Y    +F + LL   +G A     +      S ++  +L    + K LH    FFD+  +
Sbjct: 1096 YYLTIYFCIGLLQSIVGAAKTLISYYFGINASRKIFRKL----LDKVLHAKLRFFDSTPI 1151

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFT 278
            G +++R   D   + + +         + I  +  + ++  ++PQ LS+     +L +  
Sbjct: 1152 GRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFITPQFLSVAIIVGMLYYMI 1211

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
                 + S   K++ + +K        + +   E L G+ T+++F  E   L    + I 
Sbjct: 1212 GYFYLTGSRELKRLDSITK------SPIYQHFSETLVGVTTIRAFGDESRFLRENLLKID 1265

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-------LTAFM 391
            +  +                 ++G L     + +GS + + + ++  D       LT  +
Sbjct: 1266 ENNRPFFYLWVANRWLSFRIDVIGAL-----VVFGSGIFILTNINTIDSGMAGISLTYAI 1320

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP----SISPTVGHKYKPDRGV 445
             +TE        L  FYSE+     +  R+ E    +++P     +S +      P+ G 
Sbjct: 1321 SFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPADWPEEGR 1376

Query: 446  IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
            IE  D+S  Y      ++ KN+ F + P + V +VG +G GKSTI   L R+    TG I
Sbjct: 1377 IEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKSTIITALFRFLEAETGYI 1435

Query: 506  TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TK 552
             ID  DI+ +N   LRR I I+ Q+P L SGTI+ N+     Y               T+
Sbjct: 1436 KIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRVNLVTE 1495

Query: 553  EEIRSVAKQ-----CFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
            EE+ S  +            I +F +  ++ I   GT  S GQ+Q I +AR+L++ P IL
Sbjct: 1496 EELSSRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQGQRQLICLARSLLRSPKIL 1554

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            +LDEAT+++D +S+  +  T     +    TI++IAHRL ++   + ++V+G        
Sbjct: 1555 LLDEATASIDYDSDAKVQETIRT--EFSESTILTIAHRLRSVIDYDKILVMG-------A 1605

Query: 668  GKFKELYANPTSAL 681
            G+ KE Y +P S L
Sbjct: 1606 GEVKE-YDHPYSLL 1618

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 11/233 (4%)

Query: 442 DRGVIEFKDVSFSYP-TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           ++  I FK+ + ++  +R S ++ +NLN     G    I+GP+G GK+++ + LL   N 
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKL-RNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNL 755

Query: 501 TTGTITIDNQDISK---LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
             G I +   +      +        I    Q   L++ T+R+NI +   Y  T+    +
Sbjct: 756 LEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHN 813

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           V + C              T IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D
Sbjct: 814 VVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVD 873

Query: 618 VESEGAI--NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             +   +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 874 AHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  132 bits (332), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 138/547 (25%), Positives = 247/547 (45%), Gaps = 51/547 (9%)

Query: 167 LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
           ++ F+  +++ L +G AA  N    I+L   S R   +L  N+ K  +     FF+   V
Sbjct: 446 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
           G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 564

Query: 285 ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
            + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 565 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 620

Query: 345 XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY-----LVLQSQLSIGDLTAFMLYT-EYTG 398
                         S+       T++   +      +  ++QLS G +   M Y+ E T 
Sbjct: 621 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 680

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYKPDRGVIEFKDVSFS 454
           +  + + T    I     +  R+ E  +  P   SI+P     +  P  G IEFK+ S  
Sbjct: 681 SLTWIVRTTVM-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTK 739

Query: 455 YPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS 513
           Y  R ++  + K++N  I P   + IVG +G GKST++L L R   P+ G I ID+ +IS
Sbjct: 740 Y--RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNIS 797

Query: 514 KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-- 571
           +L    LR ++ I+ Q+     GT+R N+     Y  +++E++   +     + + K   
Sbjct: 798 ELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLG 855

Query: 572 ----------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
                            +  D  I  +G+ LS GQ+Q + +ARAL+    IL+LDEAT++
Sbjct: 856 NEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATAS 915

Query: 616 LDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYA 675
           +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL       + G  KE + 
Sbjct: 916 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FD 965

Query: 676 NPTSALS 682
           +P+  LS
Sbjct: 966 SPSKLLS 972

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 117/235 (49%), Gaps = 17/235 (7%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            KN+ +F+   G  +C+VG  G GKST    +L       G +   +     L  K + R
Sbjct: 83  LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIR 135

Query: 523 --HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              +    QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G
Sbjct: 136 ASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVG 193

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMT 638
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ T
Sbjct: 194 EKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKT 253

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY--ANPTSALSQLLNEKAAP 691
           I+   + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P
Sbjct: 254 IILTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 307

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 136/546 (24%), Positives = 246/546 (45%), Gaps = 49/546 (8%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
            ++ F+  +++ L +G AA  N    I+L   S R   +L  N+ K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ-- 342
             + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 1136 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 1191

Query: 343  ---VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
               V               ++   +   T L   + +  ++QLS G +   M Y+    +
Sbjct: 1192 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 1251

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTVG-HKYKPDRGVIEFKDVSFSY 455
            ++  +      I     +  R+ E  +  P   SI+P     +  P  G IEFK+ S  Y
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY 1311

Query: 456  PTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
              R ++  + K++N  I P   + IVG +G GKST++L L R   P+ G I ID+ +IS+
Sbjct: 1312 --RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 1369

Query: 515  LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            L    LR ++ I+ Q+     GT+R N+     Y  +++E++   +     + + K    
Sbjct: 1370 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGN 1427

Query: 572  ---------------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                            +  D  I  +G+ LS GQ+Q + +ARAL+    IL+LDEAT+++
Sbjct: 1428 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 1487

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL       + G  KE + +
Sbjct: 1488 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDS 1537

Query: 677  PTSALS 682
            P+  LS
Sbjct: 1538 PSKLLS 1543

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 117/235 (49%), Gaps = 17/235 (7%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            KN+ +F+   G  +C+VG  G GKST    +L       G +   +     L  K + R
Sbjct: 654 LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIR 706

Query: 523 --HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              +    QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G
Sbjct: 707 ASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVG 764

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GQLMKSKSMT 638
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    K+ T
Sbjct: 765 EKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKT 824

Query: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY--ANPTSALSQLLNEKAAP 691
           I+   + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P
Sbjct: 825 IILTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 878

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 135/540 (25%), Positives = 236/540 (43%), Gaps = 62/540 (11%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            F + LY F  FF         A   +F +L  +       L    +K+ LH    F D  
Sbjct: 927  FYMGLYTFFVFFNYF------ATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTT 980

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++++ V+  +     +VGV +MC +  P  +I +    
Sbjct: 981  PIGRVLNRFTKD----TDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAV---- 1032

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGNELSRYN 334
            P +L   +      +++S++++     Q + V     E LSG+ T++++  E   L++ +
Sbjct: 1033 PFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSD 1092

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
              I  + + G               ++  ++F  ++   + L +  Q SI   +  +L T
Sbjct: 1093 FLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVGVLLT 1148

Query: 395  EYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTVGHKYKPDR 443
             Y       L+T    + QG     +A RL         E   R+P  SP    +  P  
Sbjct: 1149 -YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPP---ESWPSE 1204

Query: 444  GVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G I+F  VS +Y  RP +  +  +++  +  G  + I G +G GKSTI   L R      
Sbjct: 1205 GAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHD 1262

Query: 503  GTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNIT--------------YGLTY 548
            G+ITID  DI++L    LR  + I+ Q+PVL  G +R N+                    
Sbjct: 1263 GSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGA 1322

Query: 549  TPTKEEIRSVAKQCFCHNFITKFPNTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
              T++E  + A        +T     + +  +   G+  S G++Q +A+ RAL++   IL
Sbjct: 1323 IATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRIL 1382

Query: 608  ILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I             T++ IAHRL+TI   + ++VL   G V E 
Sbjct: 1383 ILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVLDQ-GRVCEF 1439

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 120/274 (43%), Gaps = 44/274 (16%)

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
           D S S   + + + FKNLN +IA G  V + G  G GKS++   +  +    +G I    
Sbjct: 580 DTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIY--- 636

Query: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT--KEEIRSVAKQCFCHNF 567
           ++ S L C             P + + T++DNI +G  +     KE IR     C     
Sbjct: 637 KNGSLLLCGY-----------PWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQAD 681

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--N 625
           +   P    T IG  G  LSGGQK RI +AR++ KK  I + D+  SA+D      I   
Sbjct: 682 LDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDE 741

Query: 626 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL------------ 673
              G L      T V   H+LS I R+  VI +  DG+ V+ G   EL            
Sbjct: 742 CMMGAL---DGKTRVLATHQLSLIARASKVIFIDLDGT-VDSGTLDELKSRHAGFVKLME 797

Query: 674 YANPTSALS------QLLNEKAAPGPSDQQLQIE 701
           Y+N TS         ++ +E+  PGP   Q +IE
Sbjct: 798 YSNHTSTDEEEGQDGEVEHEENRPGPHRSQSEIE 831

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 147/569 (25%), Positives = 239/569 (42%), Gaps = 86/569 (15%)

Query: 154  DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLH 213
            D F  + P F + LY F  F +   +       G++ LL  +       L    + K LH
Sbjct: 933  DKFHNRSPSFYMGLYSFFVFGSYIFM------NGQYTLLCYMGVVASKTLNLQALHKILH 986

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSI 272
                F D + +G +++R   D   +   +T+ +   +   I  ++GVG MC +  P  +I
Sbjct: 987  TPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCIIYLPWFAI 1045

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++T ++++  EA  +  +     E L+G+ T++++ A+  
Sbjct: 1046 AI----PFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL-------QSQ 381
              ++    I  + +                       FL ++A    L++       Q  
Sbjct: 1102 FATKSEFLIDKMNEAAYISIAVQRWAGI---------FLDLVAVAFALIITLLCVTRQFH 1152

Query: 382  LSIGDLTAFMLY-----------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            +S  D    + Y                 TE   N+   L ++ +++ Q         E 
Sbjct: 1153 ISGADTGVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EA 1203

Query: 425  TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPS 483
              RKP  SP +     P  G I F++++F+Y  RP + I  KN N  I P   + I G +
Sbjct: 1204 QYRKPECSPPIDW---PQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRT 1258

Query: 484  GRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN-- 541
            G GKSTI   L R    TTG I ID+ DIS L    LR  + I+ Q+PVL  G IR N  
Sbjct: 1259 GAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLD 1318

Query: 542  --------------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLS 587
                          +  G   +   E ++S  K     N + KF    +  +   G   S
Sbjct: 1319 PFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFS 1375

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLS 647
             G++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+ IAHRL 
Sbjct: 1376 LGERQVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLK 1433

Query: 648  TIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            TI   + ++VL   G V E      L+ N
Sbjct: 1434 TILNYDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 101/214 (47%), Gaps = 21/214 (9%)

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
           +  N+NF I  G  V + GP G GK+++   L       +G +   N     L C     
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEM---NHSGDLLLC----- 675

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
             GI    P + + TIRDNI +G  Y PT    + V   C   + +   P    T +G  
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVS 641
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 642 IAHRLSTIRRSENVIVL--GHDGSVVEMGKFKEL 673
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/540 (24%), Positives = 234/540 (43%), Gaps = 36/540 (6%)

Query: 170  FLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLIS 229
            ++  + + +L   A  F +FI + +L       L    +++ LH    F D   +G +++
Sbjct: 911  YMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMN 970

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGV----GMMCSLSPQLSILLLFFTPPVLFSA 285
            R   D    + ++  ++++ V+ LI  +  +     +     P  +I + F     +F A
Sbjct: 971  RFTKD----TDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVA 1026

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E L G+ T++++ +E   L + +  I  + + G 
Sbjct: 1027 DHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGY 1086

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                          +L  + F  ++A    +  Q  +S G +   + Y       +  L 
Sbjct: 1087 LVTSIQRWVAISLDMLA-VIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALL 1144

Query: 406  TFYSEIMQGAGAASRLFELT-----DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPS 460
               ++      +A RL         + K  I  T   +  P  G I+F++VS +Y  RP 
Sbjct: 1145 RSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPE 1202

Query: 461  VQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKS 519
            + +  KN++  I     + I G +G GKSTI   L R     TG ITID+ DIS L    
Sbjct: 1203 LPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYE 1262

Query: 520  LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT-------------KEEIRSVAKQCFCHN 566
            LR  + I+ Q+PVL  G IR N+      T               ++++ S+  Q    N
Sbjct: 1263 LRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDAN 1322

Query: 567  FIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             ++   F    D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D  ++  I
Sbjct: 1323 GLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKI 1382

Query: 625  NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
                 +  +  + TI+ IAHRL TI     ++VL   G VVE    K+LY +  S  +++
Sbjct: 1383 QSRIVE--EFSNCTILCIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 119/258 (46%), Gaps = 27/258 (10%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           F  LNF +     + I GP G GKS++   L  +   ++G++TI       L C      
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGD---LLLCGY---- 644

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
                  P + + T++DNI +G  +   K + + V + C     +   P    T IG  G
Sbjct: 645 -------PWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSI 642
             LSGGQK RIA+AR++ K   I + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT--SALSQLLNEKAAPGPSD----- 695
            H+LS I ++  VI LG DGS  ++G   EL    T  S L Q  N   A    D     
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTKA 812

Query: 696 QQLQIEKVIEKEDLNESK 713
           Q ++I  +  + D+++ +
Sbjct: 813 QNMEITAISSQTDISKKQ 830

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  124 bits (310), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 150/290 (51%), Gaps = 41/290 (14%)

Query: 417 AASRLFELTDRKPS-----ISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKI 471
           +  R+ E TD  PS     ISP       P  G +E K++S  Y    S +   N++FK+
Sbjct: 3   SVERIKEYTD-IPSESNGYISPPANW---PQTGDVELKNLSLRYSPHSS-KALDNVSFKV 57

Query: 472 APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEP 531
             G+ V IVG +G GKS+I   + R  +   GTITIDN+DI  +  + LR  I  + Q+P
Sbjct: 58  KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDP 117

Query: 532 VLMSGTIRDNITYGLTYTPTKEEIRSV------AKQC--FCHNFITKFPN---------- 573
            L  GT+R N+     Y+    +I  V       ++C   C  F  + PN          
Sbjct: 118 TLFDGTVRSNLDPFDRYSDV--QIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF 175

Query: 574 -TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632
              +TV+   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T  + M
Sbjct: 176 IDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM 235

Query: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
             K+ TI++IAHRL ++   + ++V+       EMG+ KE Y +P + +S
Sbjct: 236 --KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE-YDHPYTLIS 275

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 141/537 (26%), Positives = 244/537 (45%), Gaps = 43/537 (8%)

Query: 177  ALLIGCA-ANFGRFILLRILSERVVARLRANVIKKT-LHQDAEFFDNHKVGDLISRLGSD 234
            AL IG A A   + I+L +      ++   N++  + L     FF+   +G +++R  +D
Sbjct: 998  ALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSND 1057

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    ++ R+ +Q   + VK        + ++C+ + Q     +F   P+      + +
Sbjct: 1058 IYKVDALLGRTFSQFFVNAVKV----TFTITVICATTWQF----IFIIIPLGVFYIYYQQ 1109

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVG 344
                TS++L+     +TR       +E L G+ TV+ + ++    S  N   I +     
Sbjct: 1110 YYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNMSAF 1167

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                           L+G +  L       + + Q  L+ G +   + Y       +  +
Sbjct: 1168 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWI 1227

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRP 459
                 E+     +  R+ E  D K S +P +  GH   K  P +G I F + S  Y  RP
Sbjct: 1228 VRMTVEVETNIVSVERIKEYADLK-SEAPLIIEGHRPPKQWPAQGDIRFNNYSTRY--RP 1284

Query: 460  SVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
             +  + K +N  I P   V IVG +G GKS++ L L R    + G I ID   I+++   
Sbjct: 1285 ELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLY 1344

Query: 519  SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTYDT 577
             LR  + I+ Q+  +  GT+R+NI     Y  + E I R++       + ++   +  D 
Sbjct: 1345 DLRHKLSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRALELSHLKEHVLSMSNDGLDA 1402

Query: 578  VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
             +   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+DVE++  +  T     K +  
Sbjct: 1403 QLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR-- 1460

Query: 638  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS------ALSQLLNEK 688
            TI++IAHRL+TI  S+ +IVL  +G V E     +L +N  S      A + L+NE+
Sbjct: 1461 TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDTPGQLLSNSKSLFYSQCAEAGLVNEE 1516

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 122/251 (48%), Gaps = 22/251 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN++F+   G+  CIVG  G GK+ +   +L       G  T+ 
Sbjct: 632 DATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVH 691

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                   C      I  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 692 G-------C------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  +  S L +LL
Sbjct: 797 LGPNGLLHTKTRILAT--NKVSALSIADSIALLD-NGEIIQQGAYSDITKDADSPLWKLL 853

Query: 686 NEKAAPGPSDQ 696
           N+      + Q
Sbjct: 854 NDYGKKNNNKQ 864

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 138/529 (26%), Positives = 238/529 (44%), Gaps = 35/529 (6%)

Query: 177  ALLIGCA-ANFGRFILLRILSERVVARLRANVIKKT-LHQDAEFFDNHKVGDLISRLGSD 234
            AL IG A A   + I+L +      ++   N++  + L     FF+   +G +++R  +D
Sbjct: 998  ALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSND 1057

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    ++ R+ +Q   + VK        + ++C  + Q     +F   P+      + +
Sbjct: 1058 IYKVDALLGRTFSQFFVNAVKVTFT----ITVICVTTWQF----IFIIVPLGVFYIYYQQ 1109

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYN-VAIRDIFQVG 344
                TS++L+     +TR       +E L G+ TV+ + ++    S  N   I +     
Sbjct: 1110 YYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCRIDNNMSAF 1167

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                           L+G +  L       + + Q  L+ G +   + Y       +  +
Sbjct: 1168 YPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWI 1227

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTV--GH---KYKPDRGVIEFKDVSFSYPTRP 459
                 E+     +  R+ E  D K S +P V  GH   K  P +G I+F   S  Y  RP
Sbjct: 1228 VRMTVEVETNIVSVERIKEYADIK-SEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RP 1284

Query: 460  SVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
             +  + K ++  I P   + IVG +G GKS++ L L R    + G I ID   I+++   
Sbjct: 1285 ELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLY 1344

Query: 519  SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578
             LR  + I+ Q+  +  GT+R+NI     YT  +   R++       + ++   +  D+ 
Sbjct: 1345 DLRHKLSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELSHLKEHILSMSNDGLDSQ 1403

Query: 579  IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
            +   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE++  I  T     K +  T
Sbjct: 1404 LTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--T 1461

Query: 639  IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            I++IAHRL+TI  S+ +IVL  +G V E     +L  N  S    L  E
Sbjct: 1462 ILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLTNTKSLFYSLCAE 1509

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 123/243 (50%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   C+VG  G GK+  ALL     + T G     
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLG----- 679

Query: 509 NQDISKLN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 680 --DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTID 735

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   + +
Sbjct: 736 LAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEH 795

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             G   L+ +K+  + +  +++S +  ++++ +L  +G +++ G + ++  +  S L +L
Sbjct: 796 VLGSNGLLHTKTKLLAT--NKVSALSVADSIALLD-NGEIIQQGTYDDITKDADSPLWKL 852

Query: 685 LNE 687
           + +
Sbjct: 853 IKD 855

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 133/541 (24%), Positives = 234/541 (43%), Gaps = 31/541 (5%)

Query: 167  LYEFLSFFTVALLIGCAAN-FGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVG 225
            +++F++ + +  L   A N F   I+L   S R    L  ++ K  +    +FF+   +G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    S   ++++  ++ V ++    P   +          +  
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWFLLFNALIMIIYFYYE 1120

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRD 339
             ++  Q R   +    A   +  +  E L G   + +      F     E  +YN+ +  
Sbjct: 1121 KLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAYNHSKMFKFMNIERVQYNLNVLF 1180

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
             F+                S+   +   T L   + L   S +  G +   M Y     +
Sbjct: 1181 TFR-----STNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTS 1235

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVG----HKYKPDRGVIEFKDVSFSY 455
            A+  +     +I     +  R+ E     P     +      +  P RG IEFK+ + +Y
Sbjct: 1236 ALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTY 1295

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKL 515
                S  + KN++  I P   V IVG +G GKST++L L R      GTI ID  DIS++
Sbjct: 1296 RANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRI 1354

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT- 574
                LR ++ I+ Q+     GT+R N+     +T    E+ +V +       + +     
Sbjct: 1355 GLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPHVLRMAEDD 1412

Query: 575  --------YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                     D  I  +G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+DVE++  I  
Sbjct: 1413 NLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQE 1472

Query: 627  TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLN 686
            T     K +  TI++IAHRL TI  ++ ++VL   G V E    K L ++ ++   QL +
Sbjct: 1473 TIRTQFKDR--TILTIAHRLDTIMDNDKILVLDA-GGVKEFDSPKNLLSDESTLFYQLCD 1529

Query: 687  E 687
            +
Sbjct: 1530 K 1530

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 113/223 (50%), Gaps = 19/223 (8%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS-KLNCKSLR 521
            KN++ F  +P S  C++G  G GK+T+   +L      +G+     + IS KL+ +   
Sbjct: 641 LKNIDHFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG-- 694

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
             I    QE  +M+ TI++NI +G  +  T   +   A +      I   P+   T++G 
Sbjct: 695 ESIAYCPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGE 752

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGQLMKSKS 636
            G  LSGGQK R+++ARA+  +  I +LD+  SA+D        E  ++   G L+++K 
Sbjct: 753 KGISLSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK- 810

Query: 637 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            T++   + +S ++ S+ +  L  +G +VE G + ++  +  S
Sbjct: 811 -TVILSTNTVSVLKHSQLIYAL-ENGIIVERGNYNDIIESANS 851

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 125/486 (25%), Positives = 214/486 (44%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK     +V    +CS + Q    
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIV----ICSSTWQF--- 1072

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  +G 
Sbjct: 1073 -VFVIIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGR 1130

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L      + +                     +G +  L       + + Q  L+ G + 
Sbjct: 1131 FLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMIG 1190

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DR 443
              + Y      ++  +     E+     +  R+ E  +  P  +P V    +P       
Sbjct: 1191 LSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPE-APAVIESNRPAEDWPTH 1249

Query: 444  GVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 502
            G I+F++ S  Y  RP + +  +N+N  I P   + IVG +G GKS++ L L R      
Sbjct: 1250 GAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAE 1307

Query: 503  GTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            G I ID      +  + LR H+ I+ Q+  +  GT+R+NI     Y  T EEI    +  
Sbjct: 1308 GRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY--TDEEIWHALELA 1365

Query: 563  FCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
               + I     +  ++++   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++
Sbjct: 1366 HLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETD 1425

Query: 622  GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSAL 681
              I  T     K++  TI++IAHR++TI  S+ ++VL   G + E    + L  N  S  
Sbjct: 1426 QVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRESLF 1482

Query: 682  SQLLNE 687
              L  E
Sbjct: 1483 YSLCQE 1488

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 132/255 (51%), Gaps = 27/255 (10%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL------------- 662

Query: 509 NQDISKLN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   I  V Q P +M+GT+++NI +G  Y     +  +  + C     
Sbjct: 663 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDADFYD--TTLRACALAVD 719

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P   +T++G  G  LSGGQK RI++ARA+  +    +LD+  +A+D   ++  I +
Sbjct: 720 LSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEH 779

Query: 627 TFGQ--LMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             G   L+ SK   + +  +++S +  ++++ +L  +G +++ G ++E+ ++ +SALS++
Sbjct: 780 VLGSQGLLSSKVKVLAT--NKISVLSIADHISLL-ENGEIIQQGSYEEVTSDKSSALSKI 836

Query: 685 L---NEKAAPGPSDQ 696
           +    +K   G  D+
Sbjct: 837 IANYGKKQTKGKGDE 851

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 132/249 (53%), Gaps = 9/249 (3%)

Query: 441  PDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P +G I+F++ S  Y  RP +++  K++N  I P   + IVG +G GKS++ L L R   
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 500  PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              +G I ID   I  +  + LR H+ I+ Q+  L  GTIR+NI     Y  T E+I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY--TDEQIWRAL 1368

Query: 560  KQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +     + +        D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT 678
            E++  I  T     K++  TI++IAHR++TI  S+ ++VL   G V E      L  NP 
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1486 SLFYSLCYE 1494

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 124/242 (51%), Gaps = 24/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF    G   C+VG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 509 NQDISKLN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   I  V Q P +M+GT++DNI +G  Y  +   +    K C     
Sbjct: 668 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVD 724

Query: 568 ITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P    T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +
Sbjct: 725 LAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEH 784

Query: 627 TFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
             G   L+ SK+  + +  ++++ +  ++++ +L  +G +++ G + ++ +  +SALS++
Sbjct: 785 VLGPNGLLASKTKVLAT--NKITVLSIADHIALL-ENGEIIQQGSYDDVTSAKSSALSKI 841

Query: 685 LN 686
           ++
Sbjct: 842 IS 843

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 126/489 (25%), Positives = 215/489 (43%), Gaps = 39/489 (7%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q + + VK +   +V    +C  + Q    
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIV----ICWTTWQF--- 1097

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ +    N
Sbjct: 1098 -IFIIGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY----N 1151

Query: 329  ELSRYN----VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSI 384
            +  R++      I +                     +G +  L       Y + Q  L+ 
Sbjct: 1152 QQRRFDHINHCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTA 1211

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHK----YK 440
            G +   + Y       +  +     E+     +  R+ E ++ K      +  K    + 
Sbjct: 1212 GMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHW 1271

Query: 441  PDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            PD G I F   S  Y  RP +  + +++N  I P   + IVG +G GKS++ L L R   
Sbjct: 1272 PDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVE 1329

Query: 500  PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
             ++G I ID   I ++    LR ++ I+ Q+  +  GTIR+N+    TY  T +EI  V 
Sbjct: 1330 ASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWRVL 1387

Query: 560  KQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +    +  +    P      +   G+ LS GQ+Q + +ARAL+    ILILDEAT+A+DV
Sbjct: 1388 ELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDV 1447

Query: 619  ESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT 678
            E++  I  T     + +  TI++IAHR++TI  S+ ++VL   G V E      L  N  
Sbjct: 1448 ETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVLD-GGRVTEFDTPTNLLRNEG 1504

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1505 SQFHSLCQE 1513

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 103/442 (23%), Positives = 188/442 (42%), Gaps = 66/442 (14%)

Query: 272 ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN--- 328
           ++LL  TP   F A +  K+++ +    ++   + T V  E L+ IK+++ +  E     
Sbjct: 452 VILLVMTPLNTFLAKI-QKRLQKSQMGFKD---ERTSVISEILNNIKSLKLYAWEEPYKK 507

Query: 329 --ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E  R +  ++++ ++G               L+   +F  V  Y     L   L    
Sbjct: 508 KLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVYTEDRALTVDLVFPA 566

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL----------TDRKPSISPTVG 436
           LT F L +      +F +    +  ++ + + +RLF              R P ++  VG
Sbjct: 567 LTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVT-NVG 621

Query: 437 HKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
                D  V    D +F +  +P  ++  KN+NF+   G   C+VG  G GKS +   L 
Sbjct: 622 -----DVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSLS 676

Query: 496 RYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
                  G  T+                +  V Q   +M+GT+++NI +G  Y P  E  
Sbjct: 677 GDLFRVKGFATVHGS-------------VAYVSQVAWIMNGTVKENILFGHRYDP--EFY 721

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
               K C     +    +  +T++G  G  LSGGQK R+++ARA+  +    +LD+  +A
Sbjct: 722 DKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAA 781

Query: 616 LDVE-SEGAINYTFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +D    +  + +  G         +++ +  ++++SIA R          I L  +G +V
Sbjct: 782 VDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR----------IALLENGEIV 831

Query: 666 EMGKFKELYANPTSALSQLLNE 687
           E G + E+ A+  SALS+L+ +
Sbjct: 832 EQGSYDEVTADGDSALSKLIRD 853

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 155/553 (28%), Positives = 240/553 (43%), Gaps = 93/553 (16%)

Query: 206  NVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 265
            N++   LH +  FFD   VG +++R   D             +GV   +   + V + C 
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDI------------EGVDQELIPYLEVTIFC- 1124

Query: 266  LSPQLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE-----------E 312
            L   LSI+ L    TP  L  A V         K    A  +L R+             E
Sbjct: 1125 LIQCLSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSE 1184

Query: 313  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVL 370
             L+G+ T+++F   G+E  R+ +   D                   +   D+  +F+ VL
Sbjct: 1185 TLAGVCTIRAF---GDE-KRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFI-VL 1239

Query: 371  AYGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
              GS+++L      S L+   LT  +L+T+        L   YS       +  RL E +
Sbjct: 1240 GSGSFILLNIGDIDSSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYS 1295

Query: 426  -----DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCI 479
                 +   +    + +   P+ G IE  ++S  Y +  P V   KN++F + P + + I
Sbjct: 1296 GIEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLPPV--IKNVSFTVDPQTKIGI 1353

Query: 480  VGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIR 539
            VG +G GKSTI   L R   P TG I ID  DISK++  +LRR I I+ Q+P+L +GTI+
Sbjct: 1354 VGRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIK 1413

Query: 540  DNITYGLTYTPTKE-EIRSVAKQCFCHNFIT------------KFPNTYD------TVIG 580
             N+       P  E + R + K     N I+             F   ++      T I 
Sbjct: 1414 SNL------DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIV 1467

Query: 581  PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAINYTFGQLMKSKS 636
              G  LS G+KQ + IAR+L+++P I++LDEATS++D +S    +G I   F +      
Sbjct: 1468 EGGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------ 1521

Query: 637  MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQ 696
             TI++IAHRL ++   + V+V+   G V E     EL  N  S    +  +         
Sbjct: 1522 STILTIAHRLRSVIDYDKVLVMDA-GEVKEYDHPYELLKNERSIFYSMCRDSG------- 1573

Query: 697  QLQIEKVIEKEDL 709
             LQ+ K I K  L
Sbjct: 1574 DLQLLKQIAKSSL 1586

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 114/246 (46%), Gaps = 22/246 (8%)

Query: 441 PDRGVIEFKDVSFSYPTRPS-VQIFK----NLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
           PD+  I+FK  +  +    + +  F+    N+NF+I  G    I+G +G GKS + + LL
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGLL 714

Query: 496 RYYNPTTGTITIDNQD-----ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
                 +G+I +   +     I  LN   L        Q   L++GT+R+NI +   Y  
Sbjct: 715 GELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE 772

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            +   ++V   C     +   P    T IG  G  LSGGQKQRI++ARA+      ++LD
Sbjct: 773 NR--YKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 611 EATSALDVESEGAINYTF---GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
           +  SA+D  +   I Y     G LMK++  T + + H +S   R     V+  +G V   
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 668 GKFKEL 673
           G   EL
Sbjct: 888 GTITEL 893

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 132/528 (25%), Positives = 229/528 (43%), Gaps = 44/528 (8%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  R+             L   +    L     FF+   +G +++R  +D
Sbjct: 995  TVVLWVFCTIHGSRY-------------LHDAMASSVLRAPMSFFETTPIGRILNRFSND 1041

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    ++ R+ +Q   + VK     VV    +C+ + Q  +++L    P+      + +
Sbjct: 1042 IYKVDELLGRTFSQFFVNVVKVTFTIVV----ICTSTWQFILVVL----PLSVLYIYYQQ 1093

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYNVA-IRDIFQVG 344
                TS++L+     +TR       +E L G+ T++ +  +    +  N A I +     
Sbjct: 1094 YYLRTSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHINQARIDNNMSAF 1151

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                            LG +  L       + + Q  L+ G +   + Y      ++  +
Sbjct: 1152 YPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYALQITQSLNWI 1211

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPT---RPSV 461
                 E+     +  R+ E  + KP  +P +    +P +G     D+ F + +   RP +
Sbjct: 1212 VRMTVEVETNIVSVERIKEYAELKPE-APAIIESSRPPKGWPSQGDIRFEHYSTRYRPEL 1270

Query: 462  Q-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSL 520
            Q I +++N  I     V IVG +G GKS++ L L R      G I ID      +    L
Sbjct: 1271 QLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADL 1330

Query: 521  RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVI 579
            R  + I+ Q+  + +GT+R+N+    T   T EEI    +       +    N    T++
Sbjct: 1331 RHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTML 1388

Query: 580  GPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTI 639
               G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     K++  TI
Sbjct: 1389 TECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--TI 1446

Query: 640  VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
            ++IAHR++TI  S+ +IVL ++G V E    + L   P S    L  E
Sbjct: 1447 LTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 130/263 (49%), Gaps = 24/263 (9%)

Query: 427 RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGR 485
           R+PS++       K D  V    D +F +  +P  ++  KN+NF+   G   CIVG  G 
Sbjct: 606 REPSVTS------KGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGS 659

Query: 486 GKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           GKS +   +L       G  TI                +  V Q P +M+GT+++NI +G
Sbjct: 660 GKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENILFG 706

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPT 605
             Y P+  E     K C  +  ++  P    T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 707 HKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 764

Query: 606 ILILDEATSALDVE-SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
             +LD+  +A+D   ++  ++   G      S T V   ++++ +  ++++ +L  +G +
Sbjct: 765 TYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALL-ENGEI 823

Query: 665 VEMGKFKELYANPTSALSQLLNE 687
           V+ G + E+  +  SALS+L++E
Sbjct: 824 VQQGSYDEVVRDDGSALSKLIHE 846

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 132/559 (23%), Positives = 239/559 (42%), Gaps = 49/559 (8%)

Query: 169  EFLSFFTVALLIGCAA----NFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKV 224
            +FL F T+  +IG  +    N    I+L   S R   +L   +    +     FF+   +
Sbjct: 1019 DFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +++R  SD   +   +    S   ++++  VV + ++    P    L         + 
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYY 1138

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
             + +    R   +    +   +  +  E L G   + +F    +  SR+N    +  Q  
Sbjct: 1139 QAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYN 1194

Query: 345  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG--SYLVL--QSQLSIGDLTAFMLYTEYTGN 399
                          S+ L  +  L +LA G  S+  L  + QLS G +   M Y+    +
Sbjct: 1195 IDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTS 1254

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD----RGVIEFKDVSFSY 455
            ++  +     +I     +  R  E  + KP     + +   P+     G IEF + +  Y
Sbjct: 1255 SLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY 1314

Query: 456  PTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISK 514
              R ++  + K++N  I P   + IVG +G GKST+ L L R    T G+I+ID  DISK
Sbjct: 1315 --RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISK 1372

Query: 515  LNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            +  + LR ++ I+ Q+     GTIR N+     +  + EE+    +       I +    
Sbjct: 1373 IGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQH--SDEELWRAVELSHLKQHILRMNEE 1430

Query: 572  ---------------PNTYD------TVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
                           P++++      T I  +G+ +S GQ+Q + ++RAL+    +LILD
Sbjct: 1431 ANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILD 1490

Query: 611  EATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + ++VL   G V E    
Sbjct: 1491 EATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVLDK-GEVAEFDTV 1547

Query: 671  KELYANPTSALSQLLNEKA 689
              L ++  +   +L  + A
Sbjct: 1548 SNLLSDKNTMFYKLCEQGA 1566

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 117/231 (50%), Gaps = 17/231 (7%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
            KN+ NF +  GS  CIVG  G GKSTI   +L      +    +D     K+  ++   
Sbjct: 645 LKNIDNFTVKKGSLTCIVGKVGSGKSTILHAILGQLPCISA---LDQTRAPKVTIRA--T 699

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPH 582
            I    QE  +M+ ++++NI +G  +      +  V + C   + ++  P+  +T++G  
Sbjct: 700 SIAYCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEK 757

Query: 583 GTLLSGG-QKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSM 637
           G  L GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y   +   L+++K  
Sbjct: 758 GISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK-- 815

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYANPTSALSQLLNE 687
           TI+   + ++ ++ S+ +  +   G +VE   ++  + ++  S + +L+ E
Sbjct: 816 TIILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 131/245 (53%), Gaps = 11/245 (4%)

Query: 446  IEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
            I F  V   Y P  P V   KN++F + P S V IVG +G GKST+ + L R    T GT
Sbjct: 1238 ISFDHVYVRYAPHLPDV--LKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGT 1295

Query: 505  ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC-- 562
            I I   DI+ LN ++LRR + ++ Q+P L SGTI+ NI     Y  + +E+   A++   
Sbjct: 1296 IRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRY--SDQELTHFARRIGL 1353

Query: 563  FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
            F      +  N+  +++   G  +S GQ+Q + +ARAL++K  ILILDEAT+++D E++ 
Sbjct: 1354 FSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDA 1413

Query: 623  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
             I         S    ++++AHR+STI   + VIVL  D  +V+      L      A  
Sbjct: 1414 TIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFH 1469

Query: 683  QLLNE 687
            Q+  E
Sbjct: 1470 QMCKE 1474

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 145/320 (45%), Gaps = 31/320 (9%)

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT-----GNAVFGLSTFYSEIMQGAGAAS 419
           + +T   +G+ + LQ Q     +T    YT  T      N +  L+T    I+Q   +  
Sbjct: 556 TLVTAATFGASIYLQKQ----KITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQ 611

Query: 420 RLFELTDRKPSISPTVGHKYKPDRGV-IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           R+ +  +R    S T  H+   D    + F++ S ++    +  + KNL           
Sbjct: 612 RIEKFLNR----SNTKKHEILKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNV 667

Query: 479 IVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTI 538
           I+GPSG GKS++ L LL   +   G+I +    +    C           Q P + + T+
Sbjct: 668 IIGPSGSGKSSVLLALLGELDLIEGSIRVPRGYMHDDRCS-----FAFCSQTPWITNATV 722

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIAR 598
           ++NI +   +   + +   V   C     I +     +TV+G  G  LSGGQ+QR+A+AR
Sbjct: 723 KENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALAR 780

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTF-----GQLMKSKSMTIVSIAHRLSTIRRSE 653
           A+      L+LD+  SA+D    G   + F     G LMK K  T +   H ++ +++  
Sbjct: 781 AVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHA 835

Query: 654 NVIVLGHDGSVVEMGKFKEL 673
           ++I+L  +G V ++GK ++ 
Sbjct: 836 DMIILLDNGRVSKIGKARDF 855

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 136/539 (25%), Positives = 237/539 (43%), Gaps = 49/539 (9%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  ++             L A +          FF+   +G +++R  +D
Sbjct: 1017 TVVLWVYCTIHGSKY-------------LHAGMANSVFRAPMRFFETTPIGRILNRFSND 1063

Query: 235  AYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRN 294
             + V   + +  S  V  +I     + ++C  + Q ++    F  P+      + +    
Sbjct: 1064 IFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFTL----FVIPLGILYVYYQQYYLR 1119

Query: 295  TSKDLQ--EATGQLTRVA--EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXX 350
            TS++L+  ++T +    A  +E L G+ T++ +    N+  R+ + I    ++       
Sbjct: 1120 TSRELRRLDSTTRSPIYAHFQESLGGLSTIRGY----NQQRRF-IHINQS-RMDNNMSAY 1173

Query: 351  XXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNAVFGL 404
                     L   L F+ T++ +G+  +   +L  G LT  M+     Y      ++  +
Sbjct: 1174 YPSVNANRWLAYRLEFIGTIIIFGASSLSILRLKSGSLTPGMIGLSLSYALQITQSLNWI 1233

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD-----RGVIEFKDVSFSYPTRP 459
                 E+     +  R+ E ++  PS +P +    +P       G I+F+  S  Y  RP
Sbjct: 1234 VRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSPNWPTDGAIQFQHYSTRY--RP 1290

Query: 460  SVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518
             +  I K++N  I P   + IVG +G GKS++ L L R      G I ID   I ++   
Sbjct: 1291 GLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLY 1350

Query: 519  SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDT 577
             LR  + I+ Q+  +  G++R+NI     Y  + EEI  V       N +    N    T
Sbjct: 1351 DLRHKLSIIPQDSQVFEGSVRENIDPTEQY--SDEEIWRVLDLSHLKNHVLNMGNDGLLT 1408

Query: 578  VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
             +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T       +  
Sbjct: 1409 QLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR-- 1466

Query: 638  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKA-APGPSD 695
            TI++IAHRL+TI  S+ ++VL   G V E    + L  NP +    L  +    P PS+
Sbjct: 1467 TILTIAHRLNTIMDSDRILVLD-AGRVAEFDTPENLLKNPGTMFYGLCQDAGFVPRPSN 1524

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 122/242 (50%), Gaps = 22/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           + +F +  +P  ++  KN+NF+   G   C+VG  G GKS +   LL       G  T+ 
Sbjct: 635 NATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLLGDLFRVKGFATVH 694

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                         +I  V Q   +M+GT++DNI +G  Y P  E      K C     +
Sbjct: 695 G-------------NIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTIKACALTIDL 739

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
              P+   T++G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S   I++ 
Sbjct: 740 AILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHV 799

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+K+K+  + +  +++S +  +++V +L  +G +++ G F E+     S LS+L+
Sbjct: 800 LGPNGLLKTKTKILAT--NKISALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKLI 856

Query: 686 NE 687
            E
Sbjct: 857 KE 858

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 130/475 (27%), Positives = 220/475 (46%), Gaps = 51/475 (10%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+  Q  ++ VK     VV    +C  + Q    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVV----ICMATWQ---- 1094

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ + ++ N
Sbjct: 1095 FIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGLTTIRGY-SQQN 1152

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDL 387
                 N       +V                L   L F+ +V+   + ++   +L  G L
Sbjct: 1153 RFVHINQT-----RVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGNGTL 1207

Query: 388  TA--------FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKY 439
            TA        F L    + N +  ++    E+     +  R+ E  + K S +P +   +
Sbjct: 1208 TAGMIGLSLSFALQITQSLNWIVRMTV---EVETNIVSVERIKEYAELK-SEAPYIIKDH 1263

Query: 440  K-----PDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALL 493
            +     P+ G I+F  V++S   RP ++ I K+++  I P   + IVG +G GKS++ L 
Sbjct: 1264 RPPASWPESGEIKF--VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLA 1321

Query: 494  LLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE 553
            L R     +G I ID   I  +    LR  + I+ Q+  +  GT+R+NI     Y  T E
Sbjct: 1322 LFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRY--TDE 1379

Query: 554  EIRSVAKQCFCHNFITKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            EI +        + I     N  +T++   G+ LS GQ+Q + +ARAL+    ILILDEA
Sbjct: 1380 EIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEA 1439

Query: 613  TSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
            T+A+DVE++  I  T     K +  TI++IAHR++TI  S+ +IVL   G V E 
Sbjct: 1440 TAAVDVETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVLD-KGRVTEF 1491

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 138/288 (47%), Gaps = 42/288 (14%)

Query: 442 DRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           D GV +  D +F +  +P  ++  KN+NF    G   CIVG  G GKS +   LL     
Sbjct: 621 DEGV-KVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLLGDLIR 679

Query: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             G  T+ + D++             V Q P +M+GT++DNI +G  Y P  E  +   K
Sbjct: 680 VKGFATV-HGDVAN------------VSQVPWIMNGTVKDNILFGHKYDP--EFYQLTIK 724

Query: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE- 619
            C     ++  P+   T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   
Sbjct: 725 ACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHV 784

Query: 620 SEGAINYTFG---------QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
           ++  I +  G         +++ +  +T++SIA          + I L  +G +++ G +
Sbjct: 785 AKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGSY 834

Query: 671 KELYANPTSALSQLLNE---KAAPGPSDQQLQIEKVIEK--EDLNESK 713
            ++  +  S LS+L+ E   K  P PS     + K+  +  E  ++SK
Sbjct: 835 DQVNESTNSPLSKLIAEFGKKGKPTPSQSTTSLAKLASEGIESYSDSK 882

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 142/581 (24%), Positives = 241/581 (41%), Gaps = 57/581 (9%)

Query: 139  VIGIVLDTLKTSSGSDFF-DLKIPIFSLPLYEFL-SFFTVALLIGCAANFGRFILLRILS 196
            VIG    +L +S    F+ + K P  S   Y  L SFF      G     G++ L+  + 
Sbjct: 895  VIGTTFLSLFSSVWLSFWTEQKFPNRSTSFYMGLYSFFVFG---GYLFMNGQYTLICYMG 951

Query: 197  ERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
                  L    +++ LH    + D   +G +++R   D   +   +T+ +   +      
Sbjct: 952  VTASKVLNLKAVERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLRLFMTQF-AN 1010

Query: 257  VVGVGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLS 315
            ++GV +MC +  P  +I + F     +  A  +    R   +        +     E L 
Sbjct: 1011 IIGVCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEVLG 1070

Query: 316  GIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            G+ T++++ ++   L + +  I  + + G               ++  ++F  ++   S 
Sbjct: 1071 GMDTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIA-VAFALII---SL 1126

Query: 376  LVLQSQL-----SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG----AASRL-FELT 425
            L +  Q      S+G L  ++L      N +    T     M  A      A+ L  E  
Sbjct: 1127 LCVTRQFHISPASVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPLEAD 1186

Query: 426  DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSG 484
             ++P ++P    +  P +G I F+DVSF+Y  RP + +  K ++  I     + I G +G
Sbjct: 1187 YKRPELAPP---ESWPSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTG 1241

Query: 485  RGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
             GKSTI   L R    + G I ID+ DI ++    LR+ + I+ Q+PVL  GTIR N+  
Sbjct: 1242 AGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDP 1301

Query: 545  GLTY-------------TPTKEEIRSVAKQ--------CFCHNFITKFPNTYDTVIGPHG 583
               +               + EE+  V  Q           H F        D  +   G
Sbjct: 1302 FQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVEEEG 1355

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
               S G++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+ IA
Sbjct: 1356 ANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIA 1413

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684
            HRL TI   + ++VL   G + E    + LY        Q+
Sbjct: 1414 HRLKTILTYDRILVL-EQGEIEEFDTPRSLYEKKDGIFRQM 1453

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNC 517
           + S   FKNLN  I  G  V I GP G GKS++   +  +   T+GT+ +D      L C
Sbjct: 590 KKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG---DLLMC 646

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   KE    V + C     I   P    T
Sbjct: 647 GY-----------PWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELT 693

Query: 578 VIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMKSK 635
            IG  G  LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L   K
Sbjct: 694 EIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---K 750

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
             T +   H+LS I ++  VIVLG DGS  E GK ++L
Sbjct: 751 GKTRILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 136/557 (24%), Positives = 237/557 (42%), Gaps = 80/557 (14%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNH 222
            F + +Y F  F ++  L G      +F LL  +  R    L    + + +H    F ++ 
Sbjct: 839  FYMGMYSFFVFGSIVFLTG------QFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMEST 892

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++ D ++ ++   C +VG+ ++C +  P  +I +    
Sbjct: 893  PMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLG 948

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE------------ 326
              +  + S +    R   +        +     + L G+ T++++ AE            
Sbjct: 949  LILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLID 1008

Query: 327  -GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
              NE S    A++    +               SLL       +    + +VL   L I 
Sbjct: 1009 KTNEASYLYTAVQR--WINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIP 1066

Query: 386  DLT----AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP 441
            DL       +  TE   N+V  L T+ +E+ Q A     +       PS       K  P
Sbjct: 1067 DLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEV-------PS-------KTWP 1112

Query: 442  DRGVIEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            + G I+F++V +++    P+V        KIA G  V I G +G GKST+   L R    
Sbjct: 1113 ENGEIKFENVRYTHRDGLPAV--LDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREV 1170

Query: 501  TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +G + ID+ D+SKLN  +LR  + I+ Q+PVL  G++R N+       P  E    V K
Sbjct: 1171 ESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLK 1224

Query: 561  QCFCHNFITKFPNT---------------------YDTVIGPHGTLLSGGQKQRIAIARA 599
                   + KF  T                      D  +  +G   S G++Q +A+ARA
Sbjct: 1225 NALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARA 1284

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLG 659
            LI+  +IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + ++VL 
Sbjct: 1285 LIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL- 1341

Query: 660  HDGSVVEMGKFKELYAN 676
             +G ++ +   K L  N
Sbjct: 1342 ENGKIIGLDTPKSLLDN 1358

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 131/257 (50%), Gaps = 34/257 (13%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKST----IALLLLRYYNPTTGTITIDNQDISKLNCKS 519
           F +LNF+I  G  + IVGP G GK++    I  L+ +Y N   G + +D   +S   C  
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVDGSLVS---CGY 585

Query: 520 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TV 578
                      P + + T+RDNI +G  Y  +K   + V + C     + K  + YD T 
Sbjct: 586 -----------PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKL-SAYDMTE 631

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQLMKSKSM 637
           IG  G  LSGGQK RI +AR+L K+  I + D+  SA+D    +  +     + +K+K+ 
Sbjct: 632 IGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTR 691

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQ 697
            + +  H+LS I +++ +IVLG+DG   +MG++++L     +    L+N        ++ 
Sbjct: 692 VLAT--HQLSLIGKADQLIVLGNDGK-FDMGRYEDLIKTNET----LINLMQYAKLQEEI 744

Query: 698 LQIEKVIEKEDLNESKE 714
            + E+VI  +D NE  E
Sbjct: 745 QEKEEVI--KDKNEKTE 759

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  122 bits (307), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 130/520 (25%), Positives = 234/520 (45%), Gaps = 47/520 (9%)

Query: 173  FFTVALLIGCAANFGRFILLRIL----SERVVARLRANVIKKTLHQDAEFFDNHKVGDLI 228
            +  V  + G  A+    I   IL    S      L  +++   L     FF+   +G ++
Sbjct: 969  YLGVYFMFGLGASLSTLIQSAILWIYCSIHASVYLHESMLAAVLRAPMSFFETTPIGRIL 1028

Query: 229  SRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            +R  +D Y    +++R+ +Q  ++  +     +V    +C  + Q +    FF  P+   
Sbjct: 1029 NRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV----ICVTTWQFT----FFVIPLAML 1080

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
               + +    TS++L+         +    +E L+G+ +++ +     +L R+ + I   
Sbjct: 1081 YIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRGY----GQLDRF-IHINQA 1135

Query: 341  FQVGXXXXXXXXXXXXXXSLLGDLSFL--TVLAYGSYLVLQSQLSIGDLTAFML-----Y 393
             ++                L   L F+   ++ + + L +  +L+ G LT+ M+     Y
Sbjct: 1136 -RINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATLSV-FRLASGSLTSGMVGLSLSY 1193

Query: 394  TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFK 449
                  ++  +     E+     +  R+ E  + +P     I+ +V     P  G I+F+
Sbjct: 1194 ALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWPKDGEIKFE 1253

Query: 450  DVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
            + S  Y  RP +  I + +N  I P   V IVG +G GKS++AL L R      G I+ID
Sbjct: 1254 NYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEAAEGHISID 1311

Query: 509  NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
               I  +    LR+ + I+ Q+  +  GT+RDNI     Y  T E+I    +     + +
Sbjct: 1312 GVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNIDPTKQY--TDEQIWKALELSHLADHV 1369

Query: 569  TKF-PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
                 +  DT +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T
Sbjct: 1370 KGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVETDKVIQDT 1429

Query: 628  FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 667
                   +  TI++IAHR++TI  S+ ++VL   G+V E 
Sbjct: 1430 IRSSFNDR--TILTIAHRINTIMDSDKIVVLD-KGTVAEF 1466

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 109/496 (21%), Positives = 222/496 (44%), Gaps = 44/496 (8%)

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK---VSDGVKALICGVVGVGMM 263
           + KK LH   E       GD+++ +  DA  + R +TQ    +  G   L   +  +  +
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLHRL 424

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSF 323
                 + ++LL FT P+    S   + ++   K+  +   + TR+  E L+ IK+++ +
Sbjct: 425 LGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLKLY 481

Query: 324 VAE-----GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL 378
             E       +  R    ++ + ++G               L+   +F   +       L
Sbjct: 482 AWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGRPL 541

Query: 379 QSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD----RKPSISPT 434
            + L    LT F L +         +++F    ++ + A  RL         ++ +I+  
Sbjct: 542 TTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGRLTNFLTAEELQRDAITRE 597

Query: 435 VGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALL 493
              K      V    + +F +  +P  ++  KN+NF+       CI+G  G GKS +   
Sbjct: 598 PAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKVGSGKSALIQA 657

Query: 494 LLRYYNPTTGTITIDNQDISKLNCKSL-RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
           +L               D+ ++N  ++ R ++  V Q   +M+GT+RDNI +G  Y    
Sbjct: 658 ML--------------GDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNILFGHKYDA-- 701

Query: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEA 612
           +  +   K C     ++  P+  +T +G  G  LSGGQK R+++ARA+  +    +LD+ 
Sbjct: 702 KFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARADTYLLDDP 761

Query: 613 TSALDVE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            +A+D   ++  +   FG   L+KSK+  + +  ++++ +  ++++++L  +G +V+ G 
Sbjct: 762 LAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVLL-ENGEIVQQGT 818

Query: 670 FKELYANPTSALSQLL 685
           F E+ ++  SA+S+L+
Sbjct: 819 FSEVISDEDSAISKLV 834

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 134/529 (25%), Positives = 238/529 (44%), Gaps = 61/529 (11%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            T+ L + C     R+ L  I++  V   LRA ++         FF+   +G +++R  +D
Sbjct: 1012 TIILWVFCTIRGSRY-LHSIMAASV---LRAPMV---------FFETTPIGRILNRFSND 1058

Query: 235  AYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y V     R+  Q   +  K     +V    +C  + Q   L+L    P++     + +
Sbjct: 1059 IYKVDELLGRTFAQFFVNVTKVSFTIIV----ICVTTWQFIFLIL----PMIVLYVYYQQ 1110

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++ +  + +  +  N +     ++   
Sbjct: 1111 YYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY-DQQDRFTHINQS-----RIDNN 1164

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L F+ T++ +G+  +   +L  G LT  M+     Y      +
Sbjct: 1165 MSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYALQITQS 1224

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKP-----DRGVIEFKDVSFSY 455
            +  +     E+     +  R+ E ++ K S +P V   ++P      +G I+F+  S  Y
Sbjct: 1225 LNWIVRMTVEVETNIVSVERIKEYSEIK-SEAPLVIEDHRPPADWPSKGDIKFEHYSTRY 1283

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKL 515
                ++ + K++N  + P   + IVG +G GKS++ L L R      G I ID   I+++
Sbjct: 1284 RENMNL-VLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEI 1342

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-PNT 574
                LR  + I+ Q+  +  GT+R+NI     Y  + EEI  V +     N +     + 
Sbjct: 1343 GLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVLELSHLKNHVLSMSKDG 1400

Query: 575  YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
              T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T     K 
Sbjct: 1401 LMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRTAFKD 1460

Query: 635  KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQ 683
            +  TI++IAHRL+TI  S+ ++VL       + G+ +E +  P + L Q
Sbjct: 1461 R--TILTIAHRLNTIMDSDRILVL-------DAGEVRE-FDTPENLLKQ 1499

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 115/509 (22%), Positives = 215/509 (42%), Gaps = 59/509 (11%)

Query: 203 LRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV----SDGVKALICGVV 258
           L + + KK L    E  D    GD+++ +  D   + + +TQ      S   + L+C +V
Sbjct: 386 LTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRL-QDLTQYCHLIWSGPFQILLC-LV 443

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
            +  +   S  + +++L    P+    S+  +  +   K   +   + +R+  E L+ IK
Sbjct: 444 SLYKLLGRSMWIGVIILVIMMPL---NSMLMRIQKKLQKVQMKNKDERSRLISEILNNIK 500

Query: 319 TVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           +++ +  E       E  R +  ++++ ++G               L+   +F  V  Y 
Sbjct: 501 SLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVSCSTF-AVFVYT 559

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
               L + L    L  F L +         L+ F    ++ + + +RL+     +     
Sbjct: 560 EKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSFLTNEELQKD 615

Query: 434 TVGHKYKPDR-GVIEFK---DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKS 488
            V H  K  + G +  K   D +F +  +P  Q+  KN+N ++  G   C+VG  G GKS
Sbjct: 616 AVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKS 675

Query: 489 TIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
            +   LL       G   +                   V Q P +M+GT++DNI +G  Y
Sbjct: 676 ALVQSLLGDLYRVKGYAAVHGS-------------TAYVSQVPWIMNGTVKDNILFGHKY 722

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI 608
            P   ++    K C     +   P+   T++G  G  LSGGQK R+++ARA   +    +
Sbjct: 723 DPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYL 780

Query: 609 LDEATSALDVE-SEGAINYTFG--QLMKSKS-------MTIVSIAHRLSTIRRSENVIVL 658
           LD+  +A+D   ++  I +  G   L+KSK+       +T++SIA  +S +         
Sbjct: 781 LDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE-------- 832

Query: 659 GHDGSVVEMGKFKELYANPTSALSQLLNE 687
              G +++ G ++++  +  S LS L+ E
Sbjct: 833 --GGEIIQHGSYEDISKDLDSPLSNLVKE 859

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 132/540 (24%), Positives = 231/540 (42%), Gaps = 43/540 (7%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTL-HQDAEFFDNHKVG 225
            ++++++ + +  +   A    R I++ +      ++L  N +  ++      FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +++R  SD   +       +S   ++++  ++ + ++    P     LLF T  +L   
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWF---LLFNT--ILLGI 1144

Query: 286  SVFGKQIRNT-SKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA---- 336
              + + +    S++L+  T      +  +  E L G   + ++    N  + YN      
Sbjct: 1145 YYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY-KHANIFNYYNFENIQT 1203

Query: 337  -IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTE 395
             I  IF                 +++  ++ L  LA    L   + +S G +   M Y  
Sbjct: 1204 NINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS---LGTSNPISAGLIGLLMSYAL 1260

Query: 396  YTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTVGHKYKPDRGVIEFKDV 451
               +++  +      I     +  R+ E  D KP     I  +   K  P RG I F+  
Sbjct: 1261 QVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHY 1320

Query: 452  SFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQ 510
            +  Y  R ++  + K+++ +I     + +VG +G GKST+ L L R   P  G ITID  
Sbjct: 1321 TTKY--RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGI 1378

Query: 511  DISKLNCKSLRRHIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVA 559
            DIS L    LRR + I+ Q+     GT+R N           I   L  +  K  I  + 
Sbjct: 1379 DISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIV 1438

Query: 560  KQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             +        K  +  DT I  +G  LS GQ+Q + ++RAL+    ILILDEAT+A+D E
Sbjct: 1439 SELPDDE--NKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRE 1496

Query: 620  SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTS 679
            ++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E      L  N  S
Sbjct: 1497 TDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVLDK-GEVKEFDTPDNLLKNKES 1553

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 118/244 (48%), Gaps = 24/244 (9%)

Query: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-TIDNQDISKLNC 517
           P V +    NF        CIVG  G GKST    +L       G +  + +   S +  
Sbjct: 638 PGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKP 690

Query: 518 KSLRR--HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
           K + R  ++    Q+P +M+ +++DNI +G  Y   +   +   K C     +   P+  
Sbjct: 691 KVVIRADNLAYCPQQPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGD 748

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---L 631
            T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L
Sbjct: 749 QTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGL 808

Query: 632 MKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN-----PTSALSQLLN 686
           +K+K  T++   + ++ +  S+ +I L  +G +VE   ++E+ +        S+L +++ 
Sbjct: 809 LKNK--TVILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEVMSKDRNNGEKSSLREIIE 865

Query: 687 EKAA 690
           E A+
Sbjct: 866 EFAS 869

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 139/550 (25%), Positives = 231/550 (42%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRANVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  N+    ++    FF+   +G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  +V V ++    P   +  +F      +  
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1132

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1133 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1184

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1185 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1244

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFEL----TDRKPSISPTVGHKYKPDRGVIEFKDVS 452
              N++  +     +I     +  R+ E      +    I  T   K  P  G I+F D S
Sbjct: 1245 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1304

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I ID  D
Sbjct: 1305 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1362

Query: 512  ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT--------------PTKEEI-- 555
            IS L    LR ++ I+ Q+     GTIR N+     ++              P  E I  
Sbjct: 1363 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1422

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1423 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1482

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1483 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1539

Query: 675  ANPTSALSQL 684
             N  S    L
Sbjct: 1540 ENKNSIFYNL 1549

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 118/231 (51%), Gaps = 18/231 (7%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS-KLNCKSLR 521
           FKN+N F++  GS  CIVG  G GK+T    LLR        I+   + I  KL  +   
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTT----LLRAVLGQLPCISGAQESIPPKLIIRG-- 697

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
             I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G 
Sbjct: 698 NSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 755

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSM 637
            G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  
Sbjct: 756 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 813

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYANPTSALSQLLNE 687
           TI+   + +S ++ S+ +  L  +  ++E G + + + ++  S L  L+NE
Sbjct: 814 TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINE 863

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 139/550 (25%), Positives = 231/550 (42%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRANVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  N+    ++    FF+   +G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  +V V ++    P   +  +F      +  
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1160

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1161 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1212

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1213 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1272

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFEL----TDRKPSISPTVGHKYKPDRGVIEFKDVS 452
              N++  +     +I     +  R+ E      +    I  T   K  P  G I+F D S
Sbjct: 1273 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1332

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    T G I ID  D
Sbjct: 1333 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1390

Query: 512  ISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT--------------PTKEEI-- 555
            IS L    LR ++ I+ Q+     GTIR N+     ++              P  E I  
Sbjct: 1391 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1450

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1451 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1510

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELY 674
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1511 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1567

Query: 675  ANPTSALSQL 684
             N  S    L
Sbjct: 1568 ENKNSIFYNL 1577

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 118/231 (51%), Gaps = 18/231 (7%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDIS-KLNCKSLR 521
           FKN+N F++  GS  CIVG  G GK+T    LLR        I+   + I  KL  +   
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTT----LLRAVLGQLPCISGAQESIPPKLIIRG-- 725

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGP 581
             I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G 
Sbjct: 726 NSIAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 783

Query: 582 HGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGQ---LMKSKSM 637
            G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  
Sbjct: 784 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 841

Query: 638 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE-LYANPTSALSQLLNE 687
           TI+   + +S ++ S+ +  L  +  ++E G + + + ++  S L  L+NE
Sbjct: 842 TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINE 891

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 141/257 (54%), Gaps = 27/257 (10%)

Query: 441  PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            P  G IEFK++S  Y    S +   N++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 1301 PQTGEIEFKNLSLRYSPHSS-KALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDW 1359

Query: 501  TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +GTI IDN+DI  ++ + LR  I  + Q P L  GTIR N+     Y+  K+   ++AK
Sbjct: 1360 ESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSD-KQVFDALAK 1418

Query: 561  -------QCFC----HNFITKF-PNTY---DTVIGPHGTLLSGGQKQRIAIARALIKKPT 605
                   +  C        + F PN +   ++V+   G+ LS GQ+Q + +AR+++    
Sbjct: 1419 VGLIERNEVLCLVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGSRK 1478

Query: 606  ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
            I+++DEAT+++D  S+  I  T  + M++   TI++IAHRL ++     ++V+       
Sbjct: 1479 IMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM------- 1529

Query: 666  EMGKFKELYANPTSALS 682
            +MG+ KE Y +P + +S
Sbjct: 1530 DMGRVKE-YDHPYNLIS 1545

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 126/258 (48%), Gaps = 14/258 (5%)

Query: 446 IEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI 505
           + FKD +  +    +    KN++ +    S   I+GP+G GKS++ L LL   N  +G I
Sbjct: 664 VGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQI 723

Query: 506 ---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
              ++D++D  ++    +   +    Q P L+SGTI DNI +G    P +    +V K C
Sbjct: 724 YVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKAC 781

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D E+  
Sbjct: 782 CLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPET-- 839

Query: 623 AINYT----FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPT 678
           A+N       G +MK ++  I S  H +S I +    +V+  +G V   GK  +L A   
Sbjct: 840 ALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL-AESN 896

Query: 679 SALSQLLNEKAAPGPSDQ 696
           + L + +N   A    +Q
Sbjct: 897 NFLKESMNNGLADESGNQ 914

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 131/549 (23%), Positives = 224/549 (40%), Gaps = 73/549 (13%)

Query: 203  LRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVV 258
            L + ++   L     FF+   +G +++R  +D Y V     R+ +Q  S+ VK     VV
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 259  GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQ 313
                +C  + Q     +FF  P+ F    + +    TS++L+     +TR       +E 
Sbjct: 1069 ----ICVSTWQF----IFFIVPMSFLYIYYQQYYMRTSRELRRL-DSVTRSPTISHFQET 1119

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            L GI T++ +  E   +      + +                     LG +  L     G
Sbjct: 1120 LGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLG 1179

Query: 374  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
             Y + Q  ++ G +   + Y      ++  +     E+     +  R+ E ++   S +P
Sbjct: 1180 IYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEL-ASEAP 1238

Query: 434  TVGHKYKPDRGVIEFKDVSFS-YPTRPSVQ---IFKNLNFKIAPGSSVCIVGPSGRGKST 489
            ++    +PD    +   V F+ Y TR       + K++   I P   + IVG +G GKS+
Sbjct: 1239 SIVEDKRPDVNWPQDGAVKFNHYYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKSS 1298

Query: 490  IALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            + L L R    + G I +D  +  ++    LR  + I+ Q+  +  GT+RDNI     Y 
Sbjct: 1299 LTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQY- 1357

Query: 550  PTKEEIRSVAKQCFCHNFITKF-------------------------------------- 571
             T EEI    +     + I                                         
Sbjct: 1358 -TDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTSS 1416

Query: 572  ------PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
                   N  +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I 
Sbjct: 1417 GLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQ 1476

Query: 626  YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
             T     K++  TI++IAHRL+TI  S+ ++VL   G + E    + L  +  S    L 
Sbjct: 1477 ETIRSAFKNR--TILTIAHRLNTIMDSDRILVLD-KGEIKEFDSPQTLLGDKDSLFYSLC 1533

Query: 686  NEKAAPGPS 694
             E+A   P+
Sbjct: 1534 -EQAGLTPA 1541

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 123/262 (46%), Gaps = 22/262 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L       G  T+ 
Sbjct: 615 DATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSILGDLFRVKGFATVH 674

Query: 509 NQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                          +  V Q P +M+GT+++NI +G  +   K+      K C     +
Sbjct: 675 GD-------------VAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKACALTIDL 719

Query: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
           +  P+   T++G  G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I + 
Sbjct: 720 SILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHV 779

Query: 628 FG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLL 685
            G   L+ SK+     +A    T+    + I L  +G +++ GK++E+ ++P S L +L+
Sbjct: 780 LGPNGLLHSKTKV---LATNKITVLNIADYITLLDNGEIIQRGKYEEVTSDPGSPLCKLI 836

Query: 686 NEKAAPGPSDQQLQIEKVIEKE 707
           NE      S     +   + KE
Sbjct: 837 NEYGKKHESTPGTMVSSSMSKE 858

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 127/491 (25%), Positives = 224/491 (45%), Gaps = 43/491 (8%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK L      +G++   + Q    
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFT----IGVIAYTTWQF--- 1114

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ +  +  
Sbjct: 1115 -VFVIVPLGIFYIYYQQYYLRTSRELRRLES-VTRSPIFSHFQETLGGLATIRGY-GQQK 1171

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDL 387
                 N       +V                L   L F+ +V+  G+  +   +L  G +
Sbjct: 1172 RFEHINEC-----RVDNNMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRAGTM 1226

Query: 388  TAFML-----YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD 442
            TA M+     Y       +  +     E+     +  R+ E ++ K S +P V    +P 
Sbjct: 1227 TAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELK-SEAPLVIESNRPP 1285

Query: 443  R-----GVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            +     G I+F+     Y  R  +  + K++N +I P   + IVG +G GKS++ L L R
Sbjct: 1286 KEWPVAGEIKFEHYYTRY--REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFR 1343

Query: 497  YYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
                T+G I ID   I+++    LR H+ I+ Q+  +  GTIR+NI     +T   +  R
Sbjct: 1344 IIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA-DIWR 1402

Query: 557  SVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            ++       + +    +   T++   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+
Sbjct: 1403 ALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAV 1462

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676
            DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL   G VVE    + L  N
Sbjct: 1463 DVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVLD-KGKVVEFDTPEALLKN 1519

Query: 677  PTSALSQLLNE 687
              S    L  E
Sbjct: 1520 TNSIFYSLSKE 1530

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 117/506 (23%), Positives = 221/506 (43%), Gaps = 45/506 (8%)

Query: 199 VVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV----SDGVKALI 254
           V + L + + +K L    E  +    GD+++ +  D   + + +TQ +    S  ++ ++
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 255 CGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
           C ++ +  +   S  + +L+L    PV    S   K  +N  K   +   + TRV  E L
Sbjct: 455 C-LISLYKLLGHSMWVGVLILTIMIPV---NSFLMKIQKNLQKSQMKFKDERTRVISEIL 510

Query: 315 SGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
           + +K+++ +  E       E  R    ++++ ++G               L+   +F  V
Sbjct: 511 NNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-AV 569

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTD-- 426
             Y     L + L    LT F L +      +  +    + I++ + + SRLF  LT+  
Sbjct: 570 FVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEE 625

Query: 427 -RKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSG 484
            +K ++      K   D  V    + +F +  +P  ++  KN+N++   G   CIVG  G
Sbjct: 626 LQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVG 685

Query: 485 RGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKS     LL       G  TI                +  V Q   +M+GT+RDN+ +
Sbjct: 686 SGKSAFLQSLLGDLFRVKGFATIHGS-------------VAYVSQVAWIMNGTVRDNVLF 732

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKP 604
           G  Y P  E      K C     +    +   T++G  G  LSGGQK R+++ARA+  + 
Sbjct: 733 GHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARA 790

Query: 605 TILILDEATSALDVE-SEGAINYTFG--QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
              +LD+  +A+D   S   + +  G   L+ SK+  + +  +++S +  ++++ +L  +
Sbjct: 791 DTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSAADSITLL-EN 847

Query: 662 GSVVEMGKFKELYANPTSALSQLLNE 687
           G + + G + +   +  SAL +LL E
Sbjct: 848 GEITQQGTYADCRKDEESALGKLLKE 873

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 142/287 (49%), Gaps = 33/287 (11%)

Query: 417  AASRLFELTDRKPSISPTVGH----KYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKI 471
            +  R+ E  +  P     +      K  P RG I F++ S  Y  R ++  + K++  +I
Sbjct: 1264 SVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY--RENLDPVLKDITVEI 1321

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEP 531
             P   + IVG +G GKST++L L R   P+ G+I ID  DI+KL    LR ++ I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 532  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-----Y 575
                GTI+ N           I   L  +  K  I  +A +    N  T    T      
Sbjct: 1382 QAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
               I  +G  LS GQ+Q + ++RAL+    IL+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
              TI++IAHR+ T+  S+ ++VL       + G+ KE +  PT+ L+
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDTPTNLLA 1538

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 127/256 (49%), Gaps = 18/256 (7%)

Query: 439 YKPDRGVIEFKDVSFSYPTRPSVQIFKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
           +K  +G+ E ++         +    KN+ +F+   G   CIVG  G GKST    +L  
Sbjct: 620 WKSTKGLKEDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKSTFLQAILGQ 679

Query: 498 YNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
               +G   +D     KL  ++  + I    Q+P +M+ +++DN+ +G  +   ++  ++
Sbjct: 680 LPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWIMNASLKDNVIFG--HRLNEDYYKA 732

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             ++C     +   P+   T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D
Sbjct: 733 TIRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDILSAVD 792

Query: 618 VE-----SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 672
            E      E  +N   G L   K+ T++   + +S ++ S+N+  L  DG +VE   + +
Sbjct: 793 AEVSKNIVEQVLNRGTGIL---KNKTVILTTNAVSVLKHSQNIYAL-LDGEIVENKSYAD 848

Query: 673 -LYANPTSALSQLLNE 687
            +  + +S L  L+ E
Sbjct: 849 AMSCDDSSILKTLIQE 864

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 115/540 (21%), Positives = 234/540 (43%), Gaps = 46/540 (8%)

Query: 170  FLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLIS 229
            FLS +T+   I      G+  +  +       ++ A ++         F D   VG +++
Sbjct: 1041 FLSTYTIIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMN 1100

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFG 289
            R   D  ++ + +         +++  +  + ++  ++P+     L F  P+     + G
Sbjct: 1101 RFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRF----LLFAIPLCALYYIVG 1156

Query: 290  KQIRNTSKDLQEA----TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD----IF 341
                  S++L+         + ++  E + G+ T+++   E   +++  VAI       F
Sbjct: 1157 SLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSNAPFF 1216

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL-VLQSQLSIGDLTAFMLYTEYTGNA 400
             +               +L+   S L ++    YL    + + + +  +F    ++    
Sbjct: 1217 YLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQWIIKV 1276

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPS 460
              G+    S + +         E ++     +P       P  G IEF++++  Y    S
Sbjct: 1277 FSGVELLMSSVERIKEYVDVPLESSESNNYATPLANW---PQTGDIEFENLTLRYSPHSS 1333

Query: 461  VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSL 520
             +    ++FK+  G+ V IVG +G GKS+I   + R  +   GTI IDN+DI  +  + L
Sbjct: 1334 -KALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECL 1392

Query: 521  RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVA----KQCFC---------- 564
            R  I  + Q P L  GTIR N+     Y+  +  E +  V      +  C          
Sbjct: 1393 RNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQKLSYP 1452

Query: 565  --HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              H    +F +  +TV+   G+ +S GQ+Q + +AR+++    I+++DEAT+++D  S+ 
Sbjct: 1453 SNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDA 1511

Query: 623  AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
             I  T  + M++   T+++IAHRL ++   + ++V+       +MG+ +E Y +P + +S
Sbjct: 1512 KIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-------DMGRVEE-YDHPYNLIS 1561

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 121/254 (47%), Gaps = 14/254 (5%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-- 505
           F++ +  +    +    KN++      +   I+GP+G GKS++ L LL   N  +G I  
Sbjct: 667 FENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINV 726

Query: 506 -TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
            T+ ++D  ++    +   +    Q P L+SGTI+DNI +G  +   +++   V K C  
Sbjct: 727 PTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFN--QQKFDDVIKCCCL 784

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D E+   I
Sbjct: 785 EKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHI 844

Query: 625 --NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALS 682
                 G +MK ++  + S  H +S I +    +V+  +G V   GK  +L  +     S
Sbjct: 845 YEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDNGEVKAQGKPSDLIES-----S 897

Query: 683 QLLNEKAAPGPSDQ 696
           + L E     P D+
Sbjct: 898 KFLKESINNDPGDK 911

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 118/505 (23%), Positives = 214/505 (42%), Gaps = 54/505 (10%)

Query: 202  RLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            RL  +  K+ L+    F D   +G +++R   D  V+   +T      V  +   VVGV 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDSTRMFVFQM-ANVVGVF 956

Query: 262  MM-------CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
            ++        +++  +S+LLL F      SA    K++    +        +     E L
Sbjct: 957  ILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSF------VYNNLGEVL 1010

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++++ A+   L + +  +    + G              +L  DL  + +    +
Sbjct: 1011 DGLDTIRAYNAQSRFLRKSDYFLNRTNEAGYLVIGARCWV----ALTTDLVAIAIALIVT 1066

Query: 375  YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQG-------AGAASRLFELTDR 427
             L +   + I   +A +L T      V  +  +++ +++G         +  R+      
Sbjct: 1067 LLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATA 1121

Query: 428  KPSISP-----TVGHKYKPDRGVIEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVG 481
             P  +P            P  G I F++VSF+Y  RP + +    ++F +  G  + I G
Sbjct: 1122 LPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICG 1179

Query: 482  PSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDN 541
             +G GK+++   L R     +G+I ID  DI+ L    LR  + I+ Q+P+L  GT+R N
Sbjct: 1180 RTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKN 1239

Query: 542  ITYGLTYTPTKEEIRSVAKQCFCHNFITK---FPNTY----DTVIGPHGTLLSGGQKQRI 594
            +       P  E            + +      P ++    D  +   G   S G++Q +
Sbjct: 1240 L------DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLL 1293

Query: 595  AIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSEN 654
            A+ARAL++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + 
Sbjct: 1294 ALARALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDR 1351

Query: 655  VIVLGHDGSVVEMGKFKELYANPTS 679
            ++VL   G V E      L+A   S
Sbjct: 1352 ILVLDQ-GRVAEFDTPYRLFARKDS 1375

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 105/215 (48%), Gaps = 19/215 (8%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRH 523
             +L F I  G  + ++G  G GK+++   +  Y   TTG++ ++    S L C      
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC------ 601

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHG 583
            G+    P + + TIRDNI +G ++  T+ +   V   C        FP    T +G  G
Sbjct: 602 -GV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERG 654

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIA 643
             LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T +   
Sbjct: 655 ITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILAT 713

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKELYA-NP 677
           H+L+ ++ +  VI LG DGS  +MG   EL+  NP
Sbjct: 714 HQLALVQEASRVIFLGQDGS-FDMGTPAELHEKNP 747

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 124/266 (46%), Gaps = 34/266 (12%)

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLN 516
           ++ S   F +L+F++  G  + I G  G GK+++   L  + + T G I  + +    L 
Sbjct: 583 SKTSFSGFSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLF 639

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTY 575
           C +           P + + TIRDNIT+G   +P  E + R V + C     ++  P   
Sbjct: 640 CGA-----------PWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGD 685

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGQLMK 633
            T +G  G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   G+L  
Sbjct: 686 KTEVGERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL-- 743

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL------YANPTSALSQLLNE 687
               T +   H++S   ++  VI LG DGS  ++G   EL      +AN     SQ  +E
Sbjct: 744 -GDKTRILATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESE 801

Query: 688 KAAPGPS----DQQLQIEKVIEKEDL 709
                 S    D++ Q+ ++ + +DL
Sbjct: 802 SKDDNISSEKFDREDQLRQLQQLDDL 827

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 159/376 (42%), Gaps = 40/376 (10%)

Query: 188  RFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ--K 245
            +F L+  L  R    +    + + LH    F D   +G +++R   D  ++   +T+  +
Sbjct: 939  QFSLVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLR 998

Query: 246  VSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 305
            +      +I GV+             I+ + + P    +  +        S   Q +  +
Sbjct: 999  MFSYQFTVIWGVI-------------IMSIIYLPWFAVAVPLLVVVFILVSDHYQCSARE 1045

Query: 306  LTRVA-----------EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            + R+             E +SG+ T++++ AE   L + ++ I  + ++           
Sbjct: 1046 IKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKSDILIDRMNEMTFPLYASQRWV 1105

Query: 355  XXXXSLLGDLSFL--TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                 ++  L  L  ++L    +  + S  S G L  ++L      N +    T   ++ 
Sbjct: 1106 SILIGMIAVLFALIISILCVTGWFNI-SPASTGVLLTYVLQLPNLFNTLLRAMT---QLE 1161

Query: 413  QGAGAASRLFELTDRKPSISP-----TVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKN 466
                +A R+    +  P  +P         K  P+RG I F +V+ +Y  RP +  + ++
Sbjct: 1162 NDMNSAERVLSYANSLPKEAPYRIPEMAPPKAWPERGAITFDNVALAY--RPGLPLVLQD 1219

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGI 526
            ++F I+ G  + I G +G GKSTI   L R    + G++TID  DI+ +   +LR  + I
Sbjct: 1220 VSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSI 1279

Query: 527  VQQEPVLMSGTIRDNI 542
            + Q+P+L  GTIR N+
Sbjct: 1280 IPQDPLLFRGTIRKNL 1295

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 576  DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
            D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 636  SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKA 689
              TI+ +AHRL TI   + ++V+   G V E      LY    S    + ++ +
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGSIFRSMCDQSS 1528

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 113/227 (49%), Gaps = 9/227 (3%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI-- 505
           F+D S  +    +    KN++      S   I+GP+G GKS++ L LL   N  +G I  
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 506 -TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
            T++++D  ++    +   +    Q P L+SGTI+DN+ +G  +   K++   V K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN--KQKFDDVMKSCCL 770

Query: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 625 --NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
                 G +MK ++  I S  H +S + +  + +V+   G V   GK
Sbjct: 831 YEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGK 875

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTITIDNQDISKLNCKSLRRHIGIV 527
           + PGSS+ I+GP+  GKS+I  +L      YN T G ++I  +  S L C        I 
Sbjct: 595 LGPGSSLLILGPNSCGKSSIQRILAEIWPIYNKT-GLVSIPAE--SDLMC--------IA 643

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN-TYDTVIG 580
           Q+   +  GT RD I Y ++     E      E+  + K+      + +    +Y   + 
Sbjct: 644 QRPYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVA 703

Query: 581 PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV 640
               +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    +
Sbjct: 704 DWKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFI 759

Query: 641 SIAHRLSTIRRSENVI 656
           SI+ R S I+  + ++
Sbjct: 760 SISQRPSLIKYHDYLL 775

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 121/258 (46%), Gaps = 39/258 (15%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTITIDNQDISKLNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G ++I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              I     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE-------- 687
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE        
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNEIEELERKL 850

Query: 688 KAAPGPSDQQLQIEKVIE 705
           +   G  D++ ++ + +E
Sbjct: 851 ERVKGWEDERTKLREKLE 868

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 48/237 (20%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y       + K++N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 531 IIQLQDVSFGYEENSP--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 VS-----------RNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 666
            LD     A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 102/206 (49%), Gaps = 27/206 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTITIDNQDISKLNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G ++I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ +A+    +        TY
Sbjct: 679 IFCIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHD 661
               +SI+ R + I+  E ++ +G +
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGEN 820

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTITIDNQDISKLNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN   G ++I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 95/412 (23%), Positives = 175/412 (42%), Gaps = 47/412 (11%)

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQE---ATGQLTRVAEEQLSGIKTVQSFVAE 326
           L +LLL F P  +F A       R+TS+   E    T +  +   E  S IK ++ F  E
Sbjct: 522 LCVLLLIF-PLNVFLA-------RSTSRFQHEGLLVTDKRIQNLNELFSSIKIIKCFTWE 573

Query: 327 GNELSRY----NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
            N ++      +  +R +  +               +L+  +SF       +Y +   + 
Sbjct: 574 DNFINHILRTRDSEVRKMKLISVIWSCNAIIWYLTPTLITSISF-------AYFIFCERA 626

Query: 383 SIGDLTAFMLYTEYTGNAVFGL--------STFYSEIMQGAGAASRLFELTDRKPSISPT 434
           ++    AF      T  ++FGL        S+  + I+Q   +  R+    D +P +   
Sbjct: 627 TLTAPIAF------TALSLFGLLKMPLDQLSSTINYIVQSVISLRRIQSFLD-EPDMDKQ 679

Query: 435 VGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL 494
                  D     F   +  +       I +NLN K        + GP+G GKS + + L
Sbjct: 680 KNLLLSKDGTYFMFSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSL 739

Query: 495 LRYYNPTTGTI---TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
           L   +   G I   ++ ++    ++   L   I    Q P +++ +I++NI +G  +   
Sbjct: 740 LGETHLFKGEIHVPSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFGSEFNLK 799

Query: 552 KEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDE 611
           +     V + C   N +    +  ++++G  G  LSGGQ+QR+++ARA+  K   +ILD+
Sbjct: 800 RYN--DVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDD 857

Query: 612 ATSALDVESEGAINYTF---GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660
             SA+D +    I Y     G LMK ++  +VS    L  I+++  +++L +
Sbjct: 858 CLSAVDSKCAKDI-YDLCLTGPLMKGRTCILVSHNVEL-VIKKAAYLLILDN 907

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 103/210 (49%), Gaps = 20/210 (9%)

Query: 461 VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSL 520
           + + + L FK  PGSS+ I+GP+G GK++I  ++   +        I N++   L+  + 
Sbjct: 589 INLSQKLMFK-GPGSSMLILGPNGSGKTSIQRIIAEIW-------PIYNKN-GLLSVPAE 639

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT 574
           R  I I Q+   +  GT R+ I Y ++           +E+  V K+      + +    
Sbjct: 640 RELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGW 699

Query: 575 -YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
            Y   +     +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K
Sbjct: 700 RYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLK 755

Query: 634 SKSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
                 ++I+ R S I+  +  + +G D S
Sbjct: 756 RYRFNFITISQRPSLIKYHDLALEIGADES 785

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 110/232 (47%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPTTGTITIDNQDISKLNCKSLRRH 523
           L F    GSS+ I+GP+  GKS+I  ++      YN   G ++I +++           +
Sbjct: 631 LPFLQGSGSSLLILGPNSCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFCIPQKPYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRY 794

Query: 636 SMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNE 687
               +SI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 99/200 (49%), Gaps = 27/200 (13%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTITIDNQDISKLNCKSLRRHI 524
           N  + PGSS+ I+GP+  GKS+I  ++      YN T G ++I ++  S + C       
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKT-GLLSIPSE--SDMMC------- 641

Query: 525 GIVQQEPVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN--TYD 576
            I Q+   +  GT RD I Y +      E      E+  V K+    +++ K  +   Y 
Sbjct: 642 -IAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYL 699

Query: 577 TVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKS 636
             +     +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K + 
Sbjct: 700 DHVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR- 755

Query: 637 MTIVSIAHRLSTIRRSENVI 656
              +SI+ R S I+  + ++
Sbjct: 756 FNFISISQRPSLIKYHDYLL 775

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/249 (26%), Positives = 119/249 (47%), Gaps = 31/249 (12%)

Query: 444 GVIEFKDVSFSYPT----RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRY 497
             + F+++S++ P+         I KN++  + PG  + I+G SG GK+T+   L   R 
Sbjct: 431 AALSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRK 490

Query: 498 YNPTTGTITIDNQDISKLNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGL 546
               +G I I+ +++S+   + + + IG V Q           E VL S  +R  +   +
Sbjct: 491 SGHVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSM 545

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPT 605
           T+   ++ +  V ++        +  N  D +IG      +SGG+K+R++IA  L+  P 
Sbjct: 546 TFYQKQQRVFQVLEE-------LRIYNIKDRLIGDDFERGISGGEKRRVSIACELVTSPL 598

Query: 606 ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR-LSTIRRSENVIVLGHDGSV 664
           IL LDE TS LD  +   +     +L K+ + T+V   H+  S I    + +VL   G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 665 VEMGKFKEL 673
           V  G+ + +
Sbjct: 659 VYSGEIRRV 667

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 99/209 (47%), Gaps = 24/209 (11%)

Query: 466 NLNFKIA---PGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRR 522
           N+N K+A   PGSS+ I+GP+G GK++I  ++   +        +     S L C     
Sbjct: 589 NINKKLAFQGPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC----- 643

Query: 523 HIGIVQQEPVLMSG-TIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT- 574
               V Q+P  + G T R+ I Y ++           +E+  +  +      + +     
Sbjct: 644 ----VPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWR 699

Query: 575 YDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKS 634
           Y   +     +LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K 
Sbjct: 700 YLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKR 755

Query: 635 KSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
                ++I+ R S I+  +  + +  DG+
Sbjct: 756 YRFNFITISQRPSLIKYHDLALDISTDGT 784

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 92/207 (44%), Gaps = 38/207 (18%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y   P   + K++N  +   S + +VG +G GK+T+  +++    PT G 
Sbjct: 534 IIQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGF 591

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVAKQC 562
           ++           ++ R  IG   Q  V      +  + +  T  P K  EE R      
Sbjct: 592 VS-----------RNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYR------ 634

Query: 563 FCHNFITKFPNTYDTVIGPHG----TLLSGGQKQRIAIARALIKKPTILILDE-----AT 613
                +  F      + G  G     LLSGGQK R+A A   +  P IL+LDE      T
Sbjct: 635 ---RHLGSF-----GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 686

Query: 614 SALDVESEGAINYTFGQLMKSKSMTIV 640
           S LD   +   N++ G LM S  ++I+
Sbjct: 687 SGLDALEDSLKNFSGGVLMVSHDISII 713

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSHD 426

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 427 RAFLNEVATDIIYQHN 442

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 93/212 (43%), Gaps = 46/212 (21%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y   P   + K++N  I   S + +VG +G GK+T+  ++L    P +G 
Sbjct: 531 IIQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 VS-----------RNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVS 641
            LD     A+     N+T G LM S  +++++
Sbjct: 680 HLDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 104/241 (43%), Gaps = 48/241 (19%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y    S  + K++N  +   S + +VG +G GK+T+  +++    P TG 
Sbjct: 532 IIQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGH 589

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  IG   Q  +       D++           ++ + A     
Sbjct: 590 VS-----------RNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMS 620

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 621 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSN 680

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+     N++ G LM S  ++++        I  SE+  V   DG++ +  K
Sbjct: 681 HLDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKK 738

Query: 670 F 670
           +
Sbjct: 739 Y 739

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 646 LSTIRRSENVIVLGHD 661
            S +      I+  H+
Sbjct: 425 RSFLNEVATDIIYQHN 440

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 122/271 (45%), Gaps = 36/271 (13%)

Query: 444 GVIEFKDVSFSYPT-RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYNP 500
             + F++++++  + +    I K ++  I PG  + ++G SG GK+T+   L + R    
Sbjct: 375 AALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQ 434

Query: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTYT 549
            TG+I ++  DI +   K   + IG V Q           E VL S  +R  +    ++ 
Sbjct: 435 VTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLR--LPRSFSFA 489

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
             +  +  V ++        +  +  D VIG      +SGG+K+R++IA  L+  P IL 
Sbjct: 490 AKQTRVYQVLEE-------LRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPLILF 542

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEM 667
           LDE TS LD  +   +     +L K+ + T+V SI    S I +  + +VL  +G +V  
Sbjct: 543 LDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMV-- 600

Query: 668 GKFKELYANPTSALSQLLNEKAAPGPSDQQL 698
                 Y+     + + L       PSD  +
Sbjct: 601 ------YSGDAIRVGEFLRNNGYRCPSDYNI 625

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 55/239 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    + K++N  +   S + +VG +G GK+T+  +++    PT+G 
Sbjct: 531 IIQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 VS-----------RNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             +  K    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 680 HLDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON} 
          Length = 1531

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 119/270 (44%), Gaps = 19/270 (7%)

Query: 443  RGVIEFKDVSFSYPTRPSV-QIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
              +  ++++ +  P +  +  I  N++  + PG+   ++G SG GK+T+   L +    T
Sbjct: 864  EAIFHWRNLCYEIPIKKEIRHILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQ--RVT 921

Query: 502  TGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             GTIT D      L  +S  R IG  QQ+ + L + T+R+++ +   Y     ++    K
Sbjct: 922  VGTITGDVFVNGCLRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPFDVPVEEK 980

Query: 561  QCFCHNFITKFP-NTY-DTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I      TY D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 981  NKYVEEIIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1040

Query: 618  VESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKFKE 672
             ++  A      QLMK        I+   H+ S I  +  + ++ L   G  V  G    
Sbjct: 1041 SQTAWAT----CQLMKKLAQNGQAILCTIHQPSAILMQNFDRLLFLQKGGETVYFGDLGS 1096

Query: 673  LYANPTSALSQLLNEKAAP--GPSDQQLQI 700
                      +   EK  P   P++  LQI
Sbjct: 1097 GCQTMIDYFEKEGAEKCPPEANPAEWMLQI 1126

 Score = 38.5 bits (88), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 116/271 (42%), Gaps = 34/271 (12%)

Query: 448 FKDVSFSY----PTRP--SVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
           +K +++ Y    PTR   + QI K+++  + PG  + ++G  G G +T    LL+  +  
Sbjct: 149 WKIITYVYRKVTPTREIDTFQILKSMDGILNPGELLVVLGRPGSGCTT----LLKSISSN 204

Query: 502 TGTITIDNQDISKLNC---KSLRRH-----IGIVQQEPVLMSGTIRDN-ITYGLTYTPTK 552
           T    I    I   N    K +RRH     +   + +  L   T+    +T     TP+ 
Sbjct: 205 THGFDISKDSIISYNGLTPKDIRRHYRGEVVYNAESDIHLPHLTVYQTLLTVARLKTPSN 264

Query: 553 EEIRSVAKQCFCHNFITKFPNTY------DTVIGPHGTL-LSGGQKQRIAIARALIKKPT 605
             I+ V ++ + ++       TY      DT +G      +SGG+++R++IA   I    
Sbjct: 265 -RIKDVTREDYANHLTQVTMATYGLLHTRDTKVGDDLVKGVSGGERKRVSIAEVSICGSK 323

Query: 606 ILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVV 665
           +   D AT  LD     A    F + +K+++ TI++    ++  + S++   L     V+
Sbjct: 324 VQCWDNATRGLD----SATALEFIRALKTQA-TILNTTATVAIYQCSQDTYDLFDKVCVL 378

Query: 666 EMGKFKELYANPTSALSQLLNEKAAPGPSDQ 696
           + G   +LY  P+    +   +     P  Q
Sbjct: 379 DDG--YQLYYGPSDRAKKYFQDMGYVCPPRQ 407

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 114/242 (47%), Gaps = 31/242 (12%)

Query: 446 IEFKDVSFSYP----TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           + F+++S+  P    ++   ++  ++   + PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 500 PTTGTITIDNQDISKLNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTY 548
              GTI ++   I  LN K   + IG V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSI--LN-KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTIL 607
           T  ++ +  V ++        +  +  D +IG      +SGG+K+R++IA  L+  P IL
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 608 ILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVE 666
            LDE TS LD  +   +     +L K+ + T+V SI    S I    + +VL  DG ++ 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 667 MG 668
            G
Sbjct: 624 SG 625

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 54/242 (22%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F ++SF+Y   P   +++NLNF +   S + +VGP+G GKST+  ++     P  G 
Sbjct: 392 VLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGR 451

Query: 505 I--------------TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +              + D  D++K   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
            K ++                           GT LS GQ+ R+  A   ++ P IL+LD
Sbjct: 509 QKAQM---------------------------GT-LSEGQRSRVVFALLALQAPNILLLD 540

Query: 611 EATSALDVES----EGAIN-YTFGQLMKSKSMTIVS-IAHRLSTIRRSENVIVLGHDGSV 664
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTAYRWDGSI 597

Query: 665 VE 666
           +E
Sbjct: 598 LE 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 137/286 (47%), Gaps = 26/286 (9%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN-- 499
            +GV  +KDV +  P + S + +   ++  + PG +  ++G SG GK+T+  +L +  +  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFG 857

Query: 500  -PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTK 552
              ++G I +D + + +      +R +G VQQ+ +     T+R+++ +          P  
Sbjct: 858  IVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDA 913

Query: 553  EEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDE 611
            E++  V K       +    +  D V+G  G  L+  Q+++++I   L+ KPT+L+ LDE
Sbjct: 914  EKMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 612  ATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRS-ENVIVLGHDGSVVEMGKF 670
             TS LD +S  AI     +L ++    + +I    +T+  S + +++L   GSVV  G  
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGNI 1029

Query: 671  KELYANPTSALSQLLNEKAAPGPSDQQLQIEKV-----IEKEDLNE 711
             +   + T+   +    + +   +  +  +E +     + K+D  E
Sbjct: 1030 GDHSKDVTNYFKKYGARECSDTENPAEYMLEVIGAGSSVAKDDWGE 1075

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 113/235 (48%), Gaps = 17/235 (7%)

Query: 445  VIEFKDVSFSYP-TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTG 503
            V+ ++D+ +     R S +I  N++  + PG+   ++G SG GK+T+   L      TTG
Sbjct: 852  VVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTTG 909

Query: 504  TITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEIRS 557
             IT       KL  +S  R IG  QQ+ + L + T+R+++ +          P  E+ + 
Sbjct: 910  VITGGIFVDGKLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKY 969

Query: 558  VAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSAL 616
            V +     N +   P   D ++G  G  L+  Q++R+ I   L+ KP +LI LDE TS L
Sbjct: 970  VEEVI---NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGL 1025

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLST--IRRSENVIVLGHDGSVVEMGK 669
            D ++  +I     +L  ++   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1026 DSQTAWSICQLIRKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/328 (20%), Positives = 137/328 (41%), Gaps = 65/328 (19%)

Query: 363 DLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAG 416
           D+    + AYG    SY+  +S+L    +  +    E   +       +  Y+ +++ A 
Sbjct: 294 DMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAK 353

Query: 417 AASRLFELTDRKPSISPTVGHKYKPDR---------GVIEFKDVSFSYPTRPSVQIFKNL 467
           +  ++ +  +    + P V  +    R          V+ F ++SFSY  +P   +++NL
Sbjct: 354 SRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENL 413

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTI--------------TIDNQDIS 513
           NF +   S V +VGP+G GKST+  ++     P  G +              + D  D++
Sbjct: 414 NFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLT 473

Query: 514 KLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           K   + +R   G + ++     G +     YGLT      ++                  
Sbjct: 474 KSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGEGQTVQM------------------ 512

Query: 574 TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMK 633
                    GT LS GQ+ R+  A   + +P +L+LDE T+ LD+ +  ++     + + 
Sbjct: 513 ---------GT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDIPTIDSL----AEAID 558

Query: 634 SKSMTIVSIAHRLSTIRR-SENVIVLGH 660
           + +  +V ++H    + R ++++ V+ H
Sbjct: 559 AFNGGVVVVSHDFRLLDRIAKDIYVVEH 586

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 33/209 (15%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTITIDNQDISKLNCKSLRRH 523
           L F   PGSS+ I+GP+  GKS+I  ++      YN   G ++I  +D  +L C      
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED--ELMC------ 726

Query: 524 IGIVQQEPVL-MSGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKFP 572
              + Q P     GT RD I Y          GL      + +  V  +        K  
Sbjct: 727 ---IPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKR--DKGW 781

Query: 573 NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632
           + +D V      +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F +++
Sbjct: 782 SYFDAVF-DWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KML 836

Query: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHD 661
           K      +SI+ R S ++  + ++ +  D
Sbjct: 837 KKYRFNFISISQRPSLVKYHDLLLEISED 865

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 101/239 (42%), Gaps = 55/239 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    + K++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYDEKNL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 VS-----------RNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 680 HLDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 117/255 (45%), Gaps = 30/255 (11%)

Query: 433 PTVGHKYKPD-RGVIEFKDVSFSYPTR--PSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
           P+  +  K D   V+ FKD+ +  P     S  +   ++  + PG  + ++G SG GK+T
Sbjct: 382 PSDANFLKTDVEAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTT 441

Query: 490 I--ALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQ-----------EPVLMSG 536
           +   L + +     +G I ++ + ISK   K   + IG V Q           E VL S 
Sbjct: 442 LLDILAMKKKAGKVSGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSA 498

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIA 595
            +R  +   L +   +  +  V ++        +  +  D +IG      +SGG+K+R++
Sbjct: 499 LLR--LPRALPFEAKRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVS 549

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSEN 654
           IA  L+  P IL LDE TS LD  +   +     +L ++   T+V SI    S I +  +
Sbjct: 550 IACELVTSPLILFLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFD 609

Query: 655 VIVLGHDGSVVEMGK 669
            +VL  +G +V  G+
Sbjct: 610 KLVLLSNGEMVYSGE 624

>CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}
          Length = 1542

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 133/317 (41%), Gaps = 51/317 (16%)

Query: 432  SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
            SP VG        +  ++++ +  P +  V+ I  N++  + PG+   ++G SG GK+T+
Sbjct: 873  SPQVG--LSKSEAIFHWQNLCYDVPIKTEVRRILNNVDGWVKPGTLTALMGASGAGKTTL 930

Query: 491  ALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITY----- 544
               L      T G IT D     +    S  R IG  QQ+ + L + T+R+++ +     
Sbjct: 931  LDCLAE--RTTMGVITGDVMVNGRPRDTSFSRSIGYCQQQDLHLKTATVRESLRFSAYLR 988

Query: 545  ---GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALI 601
                ++     E + +V K       I +     D V+G  G  L+  Q++R+ I   L 
Sbjct: 989  QPSSVSIEEKNEYVEAVIK-------ILEMETYADAVVGVPGEGLNVEQRKRLTIGVELA 1041

Query: 602  KKPTILI-LDEATSALDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NV 655
             KP +L+ LDE TS LD ++  A      QLMK   +    I+   H+ S +   E   +
Sbjct: 1042 AKPKLLVFLDEPTSGLDSQTAWAT----CQLMKKLANHGQAILCTIHQPSAMLMQEFDRL 1097

Query: 656  IVLGHDGSVVEMG----------KFKELY--------ANPTSALSQLLNEKAAPGPSDQQ 697
            + L   G  V  G          K+ E +        ANP   + +++   AAPG    Q
Sbjct: 1098 LFLQKGGQTVYFGDLGKGCKTMIKYFEDHGAHKCPPDANPAEWMLEVVG--AAPGSHANQ 1155

Query: 698  LQIEKVIEKEDLNESKE 714
               E     E   + K+
Sbjct: 1156 DYHEVWRNSEQFKQVKQ 1172

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 99/211 (46%), Gaps = 33/211 (15%)

Query: 460 SVQIFKNLN------FKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPTTGTITIDNQ 510
           S Q FK +N      F    GSS+ I+GP+  GK++I  ++      YN   G +++ +Q
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQ 703

Query: 511 DISKLNCKSLRRHIGIVQQEPVLMS-GTIRDNITYGLTYTPTKEE------IRSVAKQCF 563
           +           +I  + Q P   S GT+RD I Y ++     +       +  + K+  
Sbjct: 704 E-----------NIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVN 752

Query: 564 CHNFITKFPN-TYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
               + +    TY   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E 
Sbjct: 753 LKYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME- 811

Query: 623 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSE 653
             +Y F  ++K      ++I+ R S I+  +
Sbjct: 812 --DYLFN-ILKKYRFNFITISQRPSLIKYHD 839

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 106/232 (45%), Gaps = 19/232 (8%)

Query: 450  DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
            DV     TR   +I  N++  + PG+   ++G SG GK+T+   L      T G IT D 
Sbjct: 901  DVQIKTETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVITGDV 955

Query: 510  QDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  + I
Sbjct: 956  FIDGKPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDII 1014

Query: 569  T--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAIN 625
               +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI 
Sbjct: 1015 KILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI- 1073

Query: 626  YTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
                QLM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1074 ---CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 82/188 (43%), Gaps = 45/188 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  +++NLNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +              + D  D++K   + +R     V Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 112/248 (45%), Gaps = 17/248 (6%)

Query: 432  SPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
            S T G +    + V  ++++ +  P +   + +  N++  + PG+   ++G SG GK+T+
Sbjct: 837  SSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

Query: 491  ALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYT 549
               L      T G IT D     +   +S  R IG  QQ+ + L + T+R+++ +   Y 
Sbjct: 897  LDCLAE--RVTMGVITGDVLVDGRPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYL 953

Query: 550  PTKEEIRSVAKQCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTIL 607
                E+    K  +    I   +     D V+G  G  L+  Q++R+ I   L  KP +L
Sbjct: 954  RQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLL 1013

Query: 608  I-LDEATSALDVESEGAINYTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHD 661
            + LDE TS LD ++  +I     QLM+   S    I+   H+ S I   E   ++ L   
Sbjct: 1014 VFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQDG 1069

Query: 662  GSVVEMGK 669
            G     G+
Sbjct: 1070 GQTTYFGE 1077

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 131/280 (46%), Gaps = 44/280 (15%)

Query: 440 KPD-RGVIEFKDVSFSYPTR--PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
           KPD +  + F+++++   +    S Q+  +++  + PG  + I+G SG GK+T+ L +L 
Sbjct: 363 KPDVKATLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTTL-LDILA 421

Query: 497 YYNPT---TGTITIDNQDISKLNCKSLRRHIGIVQQEP-----------VLMSGTIRDNI 542
             N T   TG+I ++  +++K N     + +G V QE            VL S  +R  +
Sbjct: 422 MKNKTGKVTGSIRLNGTEVTKQN---YSKIVGFVDQEDFLLPTLTVYETVLNSALLR--L 476

Query: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG---PHGTLLSGGQKQRIAIARA 599
              +++   ++ +  V ++        +     + VIG     G  +SGG+K+R++IA  
Sbjct: 477 PRSMSFAAKQKRVYQVLEE-------LRIFEIRNRVIGNDLERG--ISGGEKRRVSIACE 527

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT-IVSIAHRLSTIRRSENVIVL 658
           L+  P IL LDE TS LD  +   +     +L    + T I+SI    S I +  + +VL
Sbjct: 528 LVTSPLILFLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFDKLVL 587

Query: 659 GHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQL 698
             +G +V        Y+     +S+ L  +    PSD  +
Sbjct: 588 LSEGELV--------YSGEAVRVSEFLRNQGFTCPSDYNI 619

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 106/232 (45%), Gaps = 19/232 (8%)

Query: 450  DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
            DV     TR   +I  N++  + PG+   ++G SG GK+T+   L      T G IT D 
Sbjct: 959  DVQIKKETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVTMGVITGDV 1013

Query: 510  QDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  + I
Sbjct: 1014 FIDGKPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDII 1072

Query: 569  T--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAIN 625
               +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI 
Sbjct: 1073 KILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI- 1131

Query: 626  YTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
                QLM+   ++   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1132 ---CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 109/234 (46%), Gaps = 21/234 (8%)

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI---------ALLLLRYYNPTTGTI 505
           +  + + QI +++N    PG    I+GPSG GKS++         + LL++++  +TG+I
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSI 736

Query: 506 TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT---YTPTKEEIRSVAKQC 562
            ++   ISK   KS+  ++     + +L S T+R+   +      +  T ++ RS   + 
Sbjct: 737 LLNTNSISKEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEI 795

Query: 563 FCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                +T   NT   VIG      +SGG+K+R+ I   L+    IL+LDE TS LD  + 
Sbjct: 796 LLALGLTHCENT---VIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTS 852

Query: 622 GAINYTFGQLMKSKSMTIVSIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            AI      L      T++   H  R    ++  +V++L   G     G   E+
Sbjct: 853 AAILEILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEM 906

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH- 644
           LSGG+K+R+++A  L+  P+ + LDE T+ LD  S   +  +  +L +    + +   H 
Sbjct: 164 LSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARDGQKSFIMSVHQ 223

Query: 645 -RLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            R   +   ++V +L   G+VV  GK  E+
Sbjct: 224 PRSDIMFLLDSVCILS-KGNVVYCGKTTEM 252

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 118/244 (48%), Gaps = 25/244 (10%)

Query: 443  RGVIEFKDVSFSYPTRPSVQIF-KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP- 500
            +GV  ++DV +  P + + +I   N+   +APG+   ++G SG GK+T+   L +  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 501  -TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKE 553
              TG ++I+ + +      S  R  G VQQ+ + ++  T+R+++ +          P  E
Sbjct: 926  IVTGDMSINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 554  EI---RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-L 609
            ++    +V K       +       D ++G  G  L+  Q+++++I   L+ KP +L+ L
Sbjct: 982  KVADAETVMK-------LLDMEEYGDALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFL 1034

Query: 610  DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
            DE TS LD +S  AI     ++ K+    + +I    +T+  + + +++L   G  V  G
Sbjct: 1035 DEPTSGLDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1094

Query: 669  KFKE 672
               E
Sbjct: 1095 DIGE 1098

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 101/237 (42%), Gaps = 40/237 (16%)

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKS----TIALLLLRYYNPTTGTITIDN--QDISKL 515
           +I +N+N    PG  + ++G  G G S    T A +  ++     G I  D   Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 516 NCKS-------LRRHIGIVQQEPVLMSGTIRDNITYGLT-YTPT--------KEEIRSVA 559
           N KS       L  H       P L   T++  + + +   TP         KE IR+  
Sbjct: 238 NYKSDVIYNPELDVHF------PFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATR 288

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                +  I    +TYDT +G      +SGG+++R++IA AL  + T+   D AT  LD 
Sbjct: 289 D---LYATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTVYSWDNATRGLDA 345

Query: 619 ESEGAINYTFG-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 672
            +  A+ Y    ++M +  +S   V+I      I  + + + + H G  +  G  K+
Sbjct: 346 ST--ALEYAQAIRIMTNLLRSTAFVTIYQASENIYETFDKVTVLHSGRQIYYGSTKD 400

>KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1020

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 121/265 (45%), Gaps = 22/265 (8%)

Query: 443 RGVIEFKDVSFSYPT-RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           R  + F+D+S+S  + +  + +   ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 364 RSTLTFEDISYSITSNKKEINLLNGISGSVRPGEIMALMGGSGAGKTTLLDILAMKEKAG 423

Query: 500 PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 557
             +G I ++ + ++K N   L   IG V QE  L+ + T+ + +    L   P K  +  
Sbjct: 424 KVSGLIKVNGKGVTKQN---LAEIIGFVDQEDFLLPTLTVYETVLNSALLRLPRK--MSF 478

Query: 558 VAKQCFCHNFITKFPNTYDTVIGPHGTL---LSGGQKQRIAIARALIKKPTILILDEATS 614
            AKQ   +  + +                  +SGG+K+R++IA  L+  P+IL LDE TS
Sbjct: 479 TAKQKRVYQVLEELRIIDIKDRIIGDDFDRGISGGEKRRVSIACELVTSPSILFLDEPTS 538

Query: 615 ALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 673
            LD  +   +     +L    + T+V SI    S I +S + +VL   G +V        
Sbjct: 539 GLDSNNANNVIECLVRLALHYNRTLVLSIHQPRSNIFKSFDKLVLLSQGEMV-------- 590

Query: 674 YANPTSALSQLLNEKAAPGPSDQQL 698
           ++   + +S+ L       PSD  +
Sbjct: 591 FSGAATDVSEFLRNNNYNCPSDYNI 615

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 100/241 (41%), Gaps = 48/241 (19%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF +   PS  + K++N  +   S + IVG +G GK+T+  +L+    P  G 
Sbjct: 531 IIQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++                      + P L        + Y   +     ++ + A     
Sbjct: 589 VS----------------------RNPRL-------RVAYFTQHHVDSMDLNASAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
           + F  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 NTFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+      +T G LM S  ++++      + I  SEN  V   +G++ +   
Sbjct: 680 HLDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKN 737

Query: 670 F 670
           +
Sbjct: 738 Y 738

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+V ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 108/236 (45%), Gaps = 17/236 (7%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
              +  ++D+ +  P +  V+ I  N++  + PG+   ++G SG GK+T+   L      T
Sbjct: 875  EAIFHWRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAE--RVT 932

Query: 502  TGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             GTIT +     +L  +S  R IG  QQ+ + L + T+R+++ +   Y      +    K
Sbjct: 933  MGTITGNIYVDGRLRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAAVSIEEK 991

Query: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I   +     D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 992  NKYVEEVIRILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1051

Query: 618  VESEGAINYTFGQLMK---SKSMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMG 668
             ++  A      QLM+        I+   H+ S I  +  + ++ L   G  V  G
Sbjct: 1052 SQTAWAT----CQLMRKLAENGQAILCTIHQPSAILMQDFDRLLFLQKGGQTVYFG 1103

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 107/237 (45%), Gaps = 11/237 (4%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPT 501
              +  ++D+ +    +   + I  N++  + PG+   ++G SG GK+T+   L      T
Sbjct: 866  EAIFHWRDLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVT 923

Query: 502  TGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             G IT D         +S  R IG  QQ+ + L + T+R+++ +   Y    +E+    K
Sbjct: 924  MGVITGDIFVDGLPRNESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVEEK 982

Query: 561  QCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +    I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD
Sbjct: 983  NAYVEEIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD 1042

Query: 618  VESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
             ++  AI     +L K     + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1043 SQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 112/235 (47%), Gaps = 18/235 (7%)

Query: 444  GVIEFKDVSFSYPTRPSV-QIFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPT 501
            GV  +K+V+F+ P + S  ++  N++   APGS   ++G SG GK+T +  L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 502  TGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 555
            TG + ++ + I      S  R  G VQQ+ V +   T+R++  +          P  E++
Sbjct: 903  TGDMLVNGKPID----ASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKL 958

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
              V K       I    +  + +IG  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 959  AYVEKII----EILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1014

Query: 615  ALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
             LD +S  AI     +L ++    + +I    +T+    + +++L   G  V  G
Sbjct: 1015 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 102/249 (40%), Gaps = 34/249 (13%)

Query: 443 RGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYN 499
           RGV E K+       R +  I +N +    PG  V ++G  G G S+    +    R + 
Sbjct: 153 RGVREVKN-------RGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFE 205

Query: 500 PTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              G+I+ D     ++  K     I   + +      T++  + + L+ T  +  +   +
Sbjct: 206 EVRGSISYDGIPQEEMMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGAS 265

Query: 560 KQCFCHNFITKFPNTYDTVIGPHGTL-----------LSGGQKQRIAIARALIKKPTILI 608
           +      +IT     Y T+ G   T            +SGG+++R++IA AL  + +I  
Sbjct: 266 RS----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYC 321

Query: 609 LDEATSALDVESEGAINYTFGQLMKS-----KSMTIVSIAHRLSTIRRSENVIVLGHDGS 663
            D AT  LD  +       F Q +++     KS+ +V+I      I    + + + +DG 
Sbjct: 322 WDNATRGLDASTA----LEFAQAIRTMTNLQKSIALVTIYQASENIYECFDKVTVLYDGR 377

Query: 664 VVEMGKFKE 672
            +  G  ++
Sbjct: 378 QIFFGAIEQ 386

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVL 533
           GSS+ I+GP+  GKS+I  +L   +        +       L C         V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFC---------VPQRPYF 665

Query: 534 MSG-TIRDNITYGLTYTPTKEE----------IRSVAKQCFCHNFITKFPNTYDTVIGPH 582
           + G T RD I Y +TY    E           +R V           +  N +D  I   
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKR--DRGLNYFDA-IADW 722

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSI 642
             +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  + +T   ++K      +SI
Sbjct: 723 KDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISI 778

Query: 643 AHRLSTIRRSENVIVL--GHDGSVVEMG 668
           + R S I+  + ++ L  G D S+  +G
Sbjct: 779 SQRPSLIKYHDYLLELTNGTDWSLQALG 806

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 105/242 (43%), Gaps = 54/242 (22%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +              + D  D++K   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDVES----EGAIN-YTFGQLMKSKSMTIVS-IAHRLSTIRRSENVIVLGHDGSV 664
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSI 597

Query: 665 VE 666
           ++
Sbjct: 598 LQ 599

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 105/232 (45%), Gaps = 19/232 (8%)

Query: 450  DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
            DV     TR   +I  N++  + PG+   ++G SG GK+T+   L      T G IT D 
Sbjct: 861  DVQIKDETR---RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVTMGVITGDV 915

Query: 510  QDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                +   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +    I
Sbjct: 916  LVDGRPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKDAYVEEVI 974

Query: 569  T--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAIN 625
               +     D V+G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I 
Sbjct: 975  KILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI- 1033

Query: 626  YTFGQLMK---SKSMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
                QLM+   S    I+   H+ S I   E   ++ L   G  V  G+  E
Sbjct: 1034 ---CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 128/271 (47%), Gaps = 39/271 (14%)

Query: 446 IEFKDVSFS-YPTRPS-VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN---P 500
           + F+++ +  +P+R S V+I  +++  ++PG  + ++G SG GK T  L +L   N    
Sbjct: 364 LTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGK-TCLLDILGMKNKAGE 422

Query: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTYT 549
            +GT+ I+   I+K    ++ + +G V Q           E VL S  +R  +   +++ 
Sbjct: 423 VSGTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFA 477

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILI 608
             ++ +  V ++        +  +  D +IG      +SGG+K+R++IA  L+  P IL 
Sbjct: 478 AKQKRVYQVLEE-------LRIFDIRDRLIGNDFERGISGGEKRRVSIACELVTSPLILF 530

Query: 609 LDEATSALDVESEGAINYTFGQLMKSKSMTIV-SIAHRLSTIRRSENVIVLGHDGSVVEM 667
           LDE TS LD  +   +     +L      T+V SI    S I R  + +VL ++G +V  
Sbjct: 531 LDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMV-- 588

Query: 668 GKFKELYANPTSALSQLLNEKAAPGPSDQQL 698
                 Y+ P + ++  L       PSD  +
Sbjct: 589 ------YSGPITRVNDFLRNTGFNCPSDYNI 613

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 106/225 (47%), Gaps = 38/225 (16%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SFSY   P   +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 390 VLAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGR 449

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP---TKEEIRSVAKQ 561
           ++           +     +G+  Q         +D +   LT +P    +++  ++++ 
Sbjct: 450 VS-----------RHTHVKLGVYSQHS-------QDQLD--LTKSPLEFVRDKYPNISQD 489

Query: 562 C-FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
             +    + ++  T +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+ +
Sbjct: 490 FQYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPT 548

Query: 621 ----EGAINYTFGQLMKSKSMTIVSIAHRLSTIRR-SENVIVLGH 660
                 AIN   G         +V ++H    + + ++++ V+ H
Sbjct: 549 IDSLADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVEH 585

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 45/188 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +              + D  D++K   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 45/188 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------TIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +              + D  D++K   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 112/236 (47%), Gaps = 18/236 (7%)

Query: 443  RGVIEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 500
            +GV  +KDV F+ P   S + +  N++    PG+   ++G SG GK+T +  L  R    
Sbjct: 850  KGVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGI 909

Query: 501  TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTYT-----PTKEE 554
             TG + ++ + I      S  R  G VQQ+ + ++  T+R+++ +          P  E+
Sbjct: 910  ITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEK 965

Query: 555  IRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEAT 613
            +  V K       +       + ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 966  MEYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1021

Query: 614  SALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
            S LD +S  AI     +L K+    + +I    +T+    + +++L   G  V  G
Sbjct: 1022 SGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1077

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 108/232 (46%), Gaps = 19/232 (8%)

Query: 450  DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509
            DV     TR   +I  N++  + PG+   ++G SG GK+T+   L      T G IT D 
Sbjct: 856  DVQIKSETR---RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAE--RVTMGVITGDI 910

Query: 510  QDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
                KL  +S  R IG  QQ+ + L + T+R+++ +       K  + +  K+ +    I
Sbjct: 911  FVNGKLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPK-SVPASEKRKYVEEVI 969

Query: 569  T--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGAIN 625
               +     D ++G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I 
Sbjct: 970  KILEMEPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSI- 1028

Query: 626  YTFGQLMKSKS---MTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 672
                QLMK  S     I+   H+ S +   E   ++ L   G  V  G+  E
Sbjct: 1029 ---CQLMKKLSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 139/331 (41%), Gaps = 75/331 (22%)

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           Y SY+  +++L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 308 YDSYIKTRTELETNQMKQYNKQQEEIAHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 367

Query: 430 SISPTVGHKY------KPDR---GVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
            I P V  +       + DR    V+ F D+SFSY  +P   ++++LNF +   S + +V
Sbjct: 368 LIQPVVQDRVFSFRFPQVDRLPPPVLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALV 427

Query: 481 GPSGRGKSTIALLLLRYYNPTTGTI--------------TIDNQDISKLNCKSLRRHIGI 526
           GP+G GKST+  ++       +G +              + D  D++K   + +R     
Sbjct: 428 GPNGVGKSTLLKIMTGELMSQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSN 487

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLL 586
           + Q+     G +     YGLT                             TV+   GT L
Sbjct: 488 ISQDFQYWRGQLG---RYGLT-------------------------GEAQTVL--MGT-L 516

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDVES----EGAINYTFGQLMKSKSMTIVSI 642
           S GQ+ R+  A   +++P +L+LDE T+ LD+ +      AIN   G         +V +
Sbjct: 517 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNG--------GVVVV 568

Query: 643 AHRLSTIRR-SENVIVLGH------DGSVVE 666
           +H    + + ++++ V+ H      DGS++E
Sbjct: 569 SHDFRLLDKIAKDIFVVEHKTATRWDGSILE 599

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 94/205 (45%), Gaps = 22/205 (10%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGI 526
           L F     SS+ I+GP+G GKS+I  ++   +        +   D S L C         
Sbjct: 633 LPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSLLC--------- 683

Query: 527 VQQEPVLM-SGTIRDNITYGLTYTPTKEE------IRSVAKQCFCHNFITKFPN-TYDTV 578
           + Q+P     GT RD I Y ++     +       +  +  +      + + P  +Y   
Sbjct: 684 IPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDE 743

Query: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638
           +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  L K +  +
Sbjct: 744 VTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FS 799

Query: 639 IVSIAHRLSTIRRSENVI-VLGHDG 662
            ++I+ R S I+  + ++ +   DG
Sbjct: 800 FITISQRPSLIKYHDMLLEIADRDG 824

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 96/235 (40%), Gaps = 55/235 (23%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DV+F Y    +  + K++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           ++           ++ R  +G   Q  V                     ++ + A +   
Sbjct: 589 VS-----------RNPRLRLGYFAQHHV------------------DAMDLNASAVEWMS 619

Query: 565 HNFITKFPNTYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  +    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 620 KTFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 664
            LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 680 HLDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   TI+ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 32/233 (13%)

Query: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504
           +I+ +DVSF Y  +    +  ++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYNEKN--LLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGY 588

Query: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           ++           ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 VS-----------QNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR------ 631

Query: 563 FCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +  F  T    +     LLSGGQK R+A A   +  P ILILDE ++ LD     
Sbjct: 632 ---RHLGAFGITGSLSLQKM-QLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 623 AI-----NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
           A+      +T G LM S  ++++S  +  + I  SEN  V   DG++ +   +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYDYRDY 738

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 33/242 (13%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPT---TGTITIDNQDISKLNCKSLRRHIGIV 527
           + PG  + I+G SG GK+T+ L +L   N T   TG+I ++  DI K       + IG V
Sbjct: 397 VKPGEMLAIMGGSGAGKTTL-LDILAMKNKTGKVTGSIKVNGVDIDK---DKYSKIIGFV 452

Query: 528 QQEPVLM-SGTIRDNITYG--------LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578
            QE  L+ + T+ + +           L+++  +  +  V ++        +  +  D V
Sbjct: 453 DQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEE-------LRIFDIRDRV 505

Query: 579 IG-PHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSM 637
           IG  +   +SGG+K+R++IA  L+  P +L LDE TS LD  +   +     +L    + 
Sbjct: 506 IGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHYNK 565

Query: 638 TIV-SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQ 696
           T+V SI    S+I +  + +VL  +G +V        Y+     +++ L  +    P D 
Sbjct: 566 TLVLSIHQPRSSIFQLFDKLVLLSNGKMV--------YSGDAHKVNEFLKNEGYACPPDY 617

Query: 697 QL 698
            +
Sbjct: 618 NI 619

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 109/237 (45%), Gaps = 12/237 (5%)

Query: 443  RGVIEFKDVSFSYPTRPSV-QIFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 500
             GV  +KDV ++ P +    Q+  N++   APG+   ++G SG GK+T +  L  R    
Sbjct: 834  EGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGI 893

Query: 501  TTGTITIDNQDISKLNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVA 559
             TG + ++   I      S  R  G VQQ+ + +   T+R+++ +        E I    
Sbjct: 894  ITGDMLVNGSPID----ASFERRTGYVQQQDIHIKEMTVRESLQFSAR-MRRPESIPDSE 948

Query: 560  KQCFCHNFIT--KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILI-LDEATSAL 616
            K  +    I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS L
Sbjct: 949  KMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPTSGL 1008

Query: 617  DVESEGAINYTFGQLMKSKSMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKE 672
            D ++  AI     +L ++    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1009 DSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGE 1065

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 99/223 (44%), Gaps = 21/223 (9%)

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPTTGTITID---NQDISKL 515
           +I + +N    PG  + ++G  G G S+    +   +  +   TG I+ D    +D+ K 
Sbjct: 159 KIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKDMMKK 218

Query: 516 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF------IT 569
               +  +  +    P L   T++  + + L        + + +++ +  +       I 
Sbjct: 219 YKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRKQYIASMRELYATIF 275

Query: 570 KFPNTYDTVIGPHGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
              +TY+T +G      +SGG+++R++IA AL  + +I   D AT  LD  +  A+ Y  
Sbjct: 276 GLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--ALEYAQ 333

Query: 629 G-QLMKS--KSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             ++M +  KS  +V+I      I  + + + + +DG  +  G
Sbjct: 334 AIRIMTNLLKSTALVTIYQASENIYETFDKVTVLYDGRQIYFG 376

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 110/232 (47%), Gaps = 12/232 (5%)

Query: 444  GVIEFKDVSFSYPTR