Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL265W (DIP5)na 1ON60860827310.0
Smik_6.473na 1ON60660625570.0
Skud_16.12na 1ON60760725510.0
Suva_16.40na 1ON60660624660.0
NCAS0D02260na 1ON59760819490.0
NDAI0I02660na 1ON59459819410.0
TPHA0M00130singletonON61157818530.0
Kpol_358.3na 1ON57553718410.0
SAKL0G14916gna 1ON58153518020.0
CAGL0A01199gna 1ON61353618010.0
TBLA0A07060na 1ON62552717970.0
KNAG0L02460singletonON58859017870.0
Kwal_33.15545na 1ON57653517460.0
KAFR0B06430singletonON59353817310.0
KLLA0E16281gna 1ON60553217260.0
KLTH0B01166gna 1ON57753517130.0
Ecym_2480na 1ON58653716850.0
KNAG0L02470singletonON63852316110.0
ACL135Wna 1ON58853815650.0
ZYRO0D17908gna 1ON5185048401e-105
Ecym_80357.44ON5634967907e-97
TDEL0A08030singletonON5144907823e-96
SAKL0C02662g1.83ON5485177792e-95
CAGL0J08184g1.83ON5725147793e-95
Ecym_10871.83ON5705147777e-95
SAKL0B10956g7.44ON5725407742e-94
SAKL0C02640gsingletonON5485177722e-94
NCAS0E022607.44ON5935397743e-94
NCAS0A006001.83ON5445207704e-94
KLLA0C02343g1.83ON5814907716e-94
CAGL0J08162g1.84ON5975147702e-93
Kpol_2000.641.84ON6105187676e-93
YOR348C (PUT4)7.44ON6276147652e-92
TDEL0C061701.84ON5734917584e-92
Kwal_26.69407.44ON5705157584e-92
Smik_5.241.83ON5905167561e-91
NDAI0F041901.84ON5995147544e-91
KNAG0C05920singletonON5995127544e-91
Skud_5.261.83ON5905167525e-91
TBLA0A054601.84ON6085117521e-90
Skud_14.701.83ON5735687491e-90
KNAG0F004801.84ON5975277501e-90
NDAI0A006101.83ON5655087462e-90
Suva_5.41.83ON5905187482e-90
KLTH0F02398g1.83ON5555207443e-90
CAGL0E05632g7.44ON5985197473e-90
Skud_15.5157.44ON6265617494e-90
KAFR0D039401.83ON5975927466e-90
NDAI0F042001.83ON5665167401e-89
TDEL0H040707.44ON5775287412e-89
Smik_15.5327.44ON6315307433e-89
YEL063C (CAN1)1.83ON5905167403e-89
TPHA0B044701.84ON5995867405e-89
TDEL0C061801.83ON5835207385e-89
Skud_14.711.84ON6125147371e-88
NDAI0E038007.44ON6215047381e-88
SAKL0C02728g1.84ON5624857305e-88
TBLA0A054501.83ON6064887301e-87
Smik_14.681.84ON6115117301e-87
KNAG0E003907.44ON5995197282e-87
KLTH0D01474g7.44ON6245317284e-87
YNL268W (LYP1)1.84ON6115147274e-87
Suva_14.751.84ON6115147265e-87
YNL270C (ALP1)1.83ON5735037237e-87
Ecym_10881.84ON5675187229e-87
NCAS0B085701.83ON5325097181e-86
SAKL0C02684gsingletonON5884897221e-86
Kwal_33.134011.83ON5595187192e-86
ZYRO0F16632g1.84ON6075127222e-86
Kwal_23.4026singletonON5344947154e-86
Smik_14.671.83ON5735127166e-86
TPHA0H028507.44ON6015327179e-86
AFR156W7.44ON5585347131e-85
Suva_8.4027.44ON6835307212e-85
ZYRO0F16654g1.83ON5805177123e-85
NCAS0A006101.84ON6075117135e-85
KLTH0F02420g1.84ON6215187111e-84
Suva_14.731.83ON4974847011e-84
Suva_13.517singletonON5475177033e-84
KLLA0C02365g1.84ON5795187036e-84
Kpol_2000.651.83ON5954917048e-84
SAKL0F09790gsingletonON5585336991e-83
TPHA0B044801.83ON6035017031e-83
Kwal_33.134111.84ON5605186982e-83
Kpol_367.77.44ON5845386983e-83
KNAG0C007901.83ON5795156975e-83
Smik_6.482na 2ON5585086947e-83
AFR668W1.83ON5564876948e-83
KAFR0D007001.83ON5745206922e-82
KLLA0F23419g7.44ON5735436853e-81
TBLA0C01240singletonON6295456859e-81
TDEL0E05750singletonON5485016791e-80
Kwal_8.590na 3ON6295016753e-79
AFR667C1.84ON5635196633e-78
KLTH0B00154gna 3ON5565146581e-77
KLTH0A00308gsingletonON5415016404e-75
NDAI0D021605.158ON5875396373e-74
Skud_16.2na 2ON4964576295e-74
CAGL0K05753g1.50ON6605266283e-72
KAFR0E018505.158ON5605186214e-72
SAKL0F16544gsingletonON5675166171e-71
KLTH0F04048gsingletonON5835306145e-71
Ecym_26643.285ON5755306111e-70
Skud_7.5255.158ON6035216122e-70
KLLA0B14685gna 4ON5715076093e-70
CAGL0B03773g5.158ON6055866113e-70
YGR191W (HIP1)5.158ON6035026104e-70
Smik_16.1155.158ON6035156104e-70
SAKL0D02970g3.284ON6015276094e-70
KAFR0C051607.44ON5845336076e-70
ZYRO0C18502g7.44ON5755086041e-69
SAKL0G14014g5.158ON6055376042e-69
KNAG0G009005.158ON6135216043e-69
Suva_7.4855.158ON6036046026e-69
Kpol_2000.921.50ON6375276037e-69
NCAS0I015303.284ON5955275991e-68
Ecym_47895.158ON5885105981e-68
Kwal_23.2817na 4ON5805295972e-68
KAFR0D00510na 5ON6175265992e-68
KNAG0C02140singletonON5985215963e-68
YBR068C (BAP2)3.284ON6095245973e-68
NDAI0B052201.244ON6116085955e-68
TPHA0E036601.50ON6475955976e-68
TBLA0A051801.50ON6765285996e-68
KAFR0A011203.284ON5925335912e-67
Kpol_1010.325.158ON5995205912e-67
CAGL0B01012g1.50ON6235955922e-67
Suva_3.1891.50ON6335285904e-67
Skud_3.381.50ON6335285904e-67
Smik_3.531.50ON6335245905e-67
YCL025C (AGP1)1.50ON6335235896e-67
KLTH0F01606gna 6ON6045365861e-66
YDR508C (GNP1)1.50ON6635275891e-66
Suva_2.6881.50ON6615265891e-66
KAFR0C004003.284ON5825245832e-66
KAFR0D005001.50ON6175235852e-66
SAKL0C01232gsingletonON6135335842e-66
SAKL0D02926g3.285ON5835365822e-66
TDEL0C00930singletonON5955065823e-66
Kpol_543.791.244ON6055195824e-66
Suva_4.3073.284ON6095215824e-66
KAFR0D04120na 6ON6485295836e-66
NDAI0C029505.158ON6095245816e-66
KNAG0C005901.50ON6345105811e-65
TPHA0A002405.158ON6035415791e-65
NCAS0D018705.158ON5955155781e-65
TPHA0B010901.244ON6065265781e-65
KLLA0A11770g5.158ON5815195752e-65
KNAG0H011503.284ON6175225772e-65
TPHA0A047005.158ON5695025734e-65
Smik_4.7901.50ON6635285775e-65
Ecym_60211.244ON6005135737e-65
Smik_2.2013.284ON6095245731e-64
NCAS0A071105.158ON5925045711e-64
Skud_2.1913.284ON6095245711e-64
NCAS0A106803.284ON5935335702e-64
AGR039Cna 7ON5865385692e-64
NDAI0F043901.50ON6675115723e-64
KNAG0J022003.284ON6075335684e-64
KLLA0A06886gsingletonON5875165674e-64
Skud_4.7841.50ON6635255714e-64
AGR040C3.285ON5735285664e-64
Suva_11.2731.244ON6015175675e-64
TBLA0B077605.158ON6585265698e-64
Kpol_1052.163.284ON6135395651e-63
TDEL0D00200singletonON5675515621e-63
CAGL0H08393g3.284ON6125355642e-63
YDR046C (BAP3)3.284ON6045245623e-63
Kpol_1065.133.284ON5965245613e-63
NDAI0A056203.284ON5715235594e-63
KLTH0B02046g5.158ON5895225561e-62
CAGL0L07546g3.284ON6345325582e-62
Skud_4.3003.284ON6045235553e-62
KLTH0E15642g1.244ON5965285543e-62
Smik_4.2843.284ON6045235544e-62
NDAI0A074903.284ON5965275527e-62
KLTH0C05170g3.284ON5985485518e-62
Kpol_1052.143.285ON6025125528e-62
Kpol_526.103.397ON5805065509e-62
Smik_11.3021.244ON5534795481e-61
SAKL0C01650g1.50ON6135285511e-61
ZYRO0D03762g1.244ON6003475492e-61
AFR698C1.50ON6095285492e-61
KAFR0D00520na 6ON5985185482e-61
KAFR0D041401.50ON6375295493e-61
KNAG0F002701.50ON6345345494e-61
SAKL0D02948gna 7ON5945285464e-61
NCAS0B085801.50ON6275305468e-61
Kwal_33.154075.158ON5875195431e-60
ZYRO0G12342g3.284ON6205305441e-60
Kwal_33.132041.50ON6075325431e-60
TPHA0M012003.284ON6075205432e-60
NDAI0A006401.50ON6415085442e-60
KLLA0C01606g1.50ON6205235422e-60
TDEL0C065101.50ON6425275442e-60
TBLA0I020103.285ON6285045432e-60
Suva_2.2033.284ON6045235412e-60
KAFR0D04130na 5ON6445075433e-60
NCAS0A004201.50ON6795325453e-60
Kwal_33.13215na 6ON5985255394e-60
TPHA0B047501.50ON6395245415e-60
AGR319W5.158ON6265265399e-60
TBLA0A05190na 6ON6676005401e-59
Kwal_27.105383.284ON6025215361e-59
AAR038W3.397ON5665045313e-59
ZYRO0F13838g8.342ON8365765416e-59
Smik_2.2023.285ON6175305319e-59
Skud_2.1923.285ON6195045291e-58
Kwal_53.194618.342ON5655445261e-58
Kpol_543.78singletonON6055185292e-58
KNAG0J022103.285ON5815215253e-58
SAKL0D00836gna 8ON6015195263e-58
TBLA0G031203.284ON6735825303e-58
ZYRO0F17446g1.50ON6335245274e-58
Suva_4.3813.397ON5905055229e-58
KLTH0F01584g1.50ON5965245211e-57
Kwal_26.9612singletonON5435235163e-57
CAGL0L03267g1.244ON5975315193e-57
AGR038C3.284ON5805305183e-57
Kpol_2002.441.50ON6275215194e-57
NDAI0G060301.368ON5995385175e-57
TDEL0F02830na 9ON5615235147e-57
NCAS0A089201.368ON5995445167e-57
Smik_2.2723.397ON5975085151e-56
YBR132C (AGP2)3.397ON5964805151e-56
SAKL0C13992gsingletonON5525285093e-56
TBLA0I020003.284ON6645325144e-56
Suva_4.3083.285ON6185425116e-56
YLL061W (MMP1)na 10ON5834825088e-56
NDAI0A075003.285ON6195395091e-55
TDEL0C053403.397ON5755705061e-55
Kwal_33.14276na 8ON5965165071e-55
ZYRO0G07172gna 9ON5675275042e-55
AFR230C1.244ON6045185053e-55
Skud_2.2603.397ON5985065043e-55
Ecym_26623.284ON5895845044e-55
NCAS0B079001.244ON6193345045e-55
SAKL0B08734g3.397ON5585095006e-55
Suva_16.18na 11ON5834795001e-54
TPHA0A039603.284ON6155264992e-54
KNAG0A050408.342ON8345525064e-54
YFL055W (AGP3)na 12ON5585414954e-54
Smik_12.2na 10ON5834824948e-54
YBR069C (TAT1)3.285ON6195044959e-54
Smik_15.1461.368ON5935454941e-53
KLTH0C08052gna 11ON5995204931e-53
TDEL0E05700singletonON5845224921e-53
Ecym_8297na 13ON5695194912e-53
Kwal_26.8097na 14ON5444994892e-53
Ecym_10561.50ON6065284922e-53
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL265W
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...  1056   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   989   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   987   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   954   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              755   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   752   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     718   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   713   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   698   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   698   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   696   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             692   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   677   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   671   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   669   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   664   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   653   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             625   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   607   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   328   e-105
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   308   7e-97
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            305   3e-96
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   304   2e-95
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   304   3e-95
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   303   7e-95
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   302   2e-94
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   301   2e-94
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     302   3e-94
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   301   4e-94
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   301   6e-94
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   301   2e-93
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   300   6e-93
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   299   2e-92
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   296   4e-92
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   296   4e-92
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   295   1e-91
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   295   4e-91
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            295   4e-91
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   294   5e-91
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   294   1e-90
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   293   1e-90
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                293   1e-90
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   291   2e-90
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   292   2e-90
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   291   3e-90
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   292   3e-90
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   293   4e-90
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   291   6e-90
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            289   1e-89
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   290   2e-89
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   290   3e-89
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   289   3e-89
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   289   5e-89
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   288   5e-89
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   288   1e-88
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     288   1e-88
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   285   5e-88
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   285   1e-87
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   285   1e-87
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   285   2e-87
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   285   4e-87
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   284   4e-87
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   284   5e-87
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   283   7e-87
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   282   9e-87
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            281   1e-86
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   282   1e-86
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   281   2e-86
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   282   2e-86
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   280   4e-86
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   280   6e-86
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   280   9e-86
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   279   1e-85
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   282   2e-85
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   278   3e-85
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              279   5e-85
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   278   1e-84
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   274   1e-84
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   275   3e-84
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   275   6e-84
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   275   8e-84
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   273   1e-83
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   275   1e-83
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   273   2e-83
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   273   3e-83
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              273   5e-83
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   271   7e-83
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   271   8e-83
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   271   2e-82
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   268   3e-81
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   268   9e-81
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            266   1e-80
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   264   3e-79
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   259   3e-78
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   258   1e-77
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   251   4e-75
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    249   3e-74
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   246   5e-74
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   246   3e-72
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   243   4e-72
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   242   1e-71
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   241   5e-71
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   239   1e-70
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   240   2e-70
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   239   3e-70
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   239   3e-70
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   239   4e-70
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   239   4e-70
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   239   4e-70
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   238   6e-70
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   237   1e-69
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   237   2e-69
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   237   3e-69
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   236   6e-69
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   236   7e-69
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              235   1e-68
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   234   1e-68
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   234   2e-68
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      235   2e-68
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   234   3e-68
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   234   3e-68
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   233   5e-68
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   234   6e-68
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   235   6e-68
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   232   2e-67
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   232   2e-67
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   232   2e-67
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   231   4e-67
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   231   4e-67
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   231   5e-67
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   231   6e-67
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   230   1e-66
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   231   1e-66
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   231   1e-66
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                229   2e-66
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      229   2e-66
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   229   2e-66
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   228   2e-66
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   228   3e-66
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   228   4e-66
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   228   4e-66
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   229   6e-66
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    228   6e-66
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   228   1e-65
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   227   1e-65
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   227   1e-65
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   227   1e-65
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   226   2e-65
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              226   2e-65
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   225   4e-65
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   226   5e-65
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   225   7e-65
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   225   1e-64
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   224   1e-64
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   224   1e-64
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   224   2e-64
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   223   2e-64
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   224   3e-64
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   223   4e-64
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   223   4e-64
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   224   4e-64
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   222   4e-64
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   223   5e-64
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   223   8e-64
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   222   1e-63
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                221   1e-63
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   221   2e-63
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   221   3e-63
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   220   3e-63
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            219   4e-63
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   218   1e-62
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   219   2e-62
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   218   3e-62
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   218   3e-62
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   218   4e-62
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   217   7e-62
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   216   8e-62
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   217   8e-62
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   216   9e-62
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   215   1e-61
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   216   1e-61
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   216   2e-61
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   216   2e-61
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   215   2e-61
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              216   3e-61
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   216   4e-61
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   214   4e-61
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   214   8e-61
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   213   1e-60
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   214   1e-60
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   213   1e-60
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   213   2e-60
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   214   2e-60
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   213   2e-60
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   214   2e-60
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   213   2e-60
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   213   2e-60
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              213   3e-60
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   214   3e-60
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   212   4e-60
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   213   5e-60
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   212   9e-60
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   212   1e-59
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   211   1e-59
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   209   3e-59
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   213   6e-59
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   209   9e-59
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   208   1e-58
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   207   1e-58
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   208   2e-58
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   206   3e-58
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   207   3e-58
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              208   3e-58
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   207   4e-58
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   205   9e-58
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   205   1e-57
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   203   3e-57
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   204   3e-57
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   204   3e-57
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   204   4e-57
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   203   5e-57
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   202   7e-57
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   203   7e-57
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   202   1e-56
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   202   1e-56
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   200   3e-56
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   202   4e-56
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   201   6e-56
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   200   8e-56
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   200   1e-55
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   199   1e-55
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   199   1e-55
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   198   2e-55
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   199   3e-55
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   198   3e-55
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   198   4e-55
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   198   5e-55
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   197   6e-55
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   197   1e-54
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              196   2e-54
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   199   4e-54
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   195   4e-54
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    194   8e-54
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   195   9e-54
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   194   1e-53
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   194   1e-53
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   194   1e-53
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   193   2e-53
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   192   2e-53
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   194   2e-53
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    192   3e-53
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   192   4e-53
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   192   4e-53
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   192   5e-53
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      191   6e-53
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   192   9e-53
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   191   1e-52
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   194   2e-52
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   194   2e-52
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   191   2e-52
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   190   2e-52
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   194   2e-52
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   190   3e-52
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   190   4e-52
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   189   5e-52
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   189   7e-52
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   189   7e-52
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   188   8e-52
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   188   9e-52
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   189   1e-51
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   188   1e-51
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   188   1e-51
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   188   1e-51
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   188   2e-51
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   191   2e-51
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   187   2e-51
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   187   3e-51
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   186   5e-51
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   185   7e-51
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      186   9e-51
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   186   1e-50
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   186   1e-50
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   185   2e-50
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   184   4e-50
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   184   5e-50
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   183   5e-50
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   183   7e-50
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   183   1e-49
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   181   1e-49
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   183   1e-49
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              182   2e-49
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   181   4e-49
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   179   5e-49
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   184   5e-49
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   179   6e-49
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              180   7e-49
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   181   1e-48
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   180   1e-48
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   180   2e-48
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   180   2e-48
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   179   2e-48
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   179   3e-48
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   177   2e-47
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              176   2e-47
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   177   2e-47
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                176   2e-47
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   176   4e-47
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   175   7e-47
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   174   3e-46
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                173   3e-46
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   173   5e-46
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   172   1e-45
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   171   3e-45
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   171   3e-45
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   170   5e-45
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   169   2e-44
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   171   3e-44
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   169   1e-43
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   168   3e-43
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              165   4e-43
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   166   8e-43
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   166   9e-43
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   166   1e-42
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   165   2e-42
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   165   2e-42
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      162   3e-42
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   164   5e-42
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   161   5e-41
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   155   8e-40
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   153   3e-39
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   155   4e-39
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   149   6e-38
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   149   2e-37
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   140   7e-35
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   139   6e-34
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         122   3e-30
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   112   2e-27
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)      88   5e-18
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)      87   5e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      76   5e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          65   1e-11
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      66   3e-11
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     66   6e-11
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          64   8e-11
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    61   3e-10
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      52   2e-07
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    49   1e-05
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              45   1e-04
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    40   0.009
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    40   0.012
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    40   0.014
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    40   0.022
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...    39   0.031
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...    39   0.044
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...    39   0.049
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...    39   0.052
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    39   0.054
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...    37   0.11 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    37   0.11 
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    37   0.12 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    37   0.17 
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...    37   0.21 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    36   0.25 
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...    36   0.27 
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    36   0.28 
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205     36   0.28 
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    36   0.34 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    35   0.44 
ZYRO0A08844g Chr1 (704383..705783) [1401 bp, 466 aa] {ON} highly...    35   0.44 
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...    35   0.50 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              33   0.64 
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    35   0.65 
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    34   1.0  
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...    34   1.0  
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    34   1.1  
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...    34   1.2  
NCAS0A04090 Chr1 (825742..827172) [1431 bp, 476 aa] {ON} Anc_2.407     33   1.8  
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...    33   2.0  
NDAI0E01810 Chr5 (359926..361353) [1428 bp, 475 aa] {ON} Anc_2.407     33   2.2  
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    33   3.1  
KAFR0F02620 Chr6 complement(511809..513215) [1407 bp, 468 aa] {O...    32   3.7  
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...    32   3.9  
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    32   3.9  
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...    32   4.1  
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...    32   7.4  
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    31   8.5  
Kpol_1023.28 s1023 (59511..60923) [1413 bp, 470 aa] {ON} (59511....    31   9.0  

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/608 (86%), Positives = 528/608 (86%)

Query: 1   MKMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXX 60
           MKMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNV       
Sbjct: 1   MKMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTS 60

Query: 61  XXXXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAM 120
                    FAVPDGKDENTRLRKDLKARHISM                       PVAM
Sbjct: 61  TSPSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAM 120

Query: 121 LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN 180
           LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN
Sbjct: 121 LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN 180

Query: 181 QLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXX 240
           QLTAAALVIQYWISRDRVNPGVWIT                      WLSSFK       
Sbjct: 181 QLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGL 240

Query: 241 XXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI 300
                       PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI
Sbjct: 241 ILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI 300

Query: 301 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA 360
           ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA
Sbjct: 301 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA 360

Query: 361 AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 420
           AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT
Sbjct: 361 AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 420

Query: 421 SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 480
           SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA
Sbjct: 421 SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 480

Query: 481 CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV 540
           CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV
Sbjct: 481 CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV 540

Query: 541 YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600
           YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY
Sbjct: 541 YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600

Query: 601 EKFLGNIF 608
           EKFLGNIF
Sbjct: 601 EKFLGNIF 608

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  989 bits (2557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/606 (82%), Positives = 515/606 (84%)

Query: 3   MPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXX 62
           MPLKKMFTS S RNSSSL++DHDAYYSKQ+ DNFPVKEQEIYNIDLEENNV         
Sbjct: 1   MPLKKMFTSASSRNSSSLENDHDAYYSKQDADNFPVKEQEIYNIDLEENNVSSRSSTSTS 60

Query: 63  XXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 122
                  FA+ DGKDENTRL+K+LKARHISM                       PVAMLI
Sbjct: 61  PSARDDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLI 120

Query: 123 AYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 182
           AYAFVGLLVF+TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL
Sbjct: 121 AYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180

Query: 183 TAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXX 242
           TAAALVIQYWISRDRVNPGVWIT                      WLSSFK         
Sbjct: 181 TAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLIL 240

Query: 243 XXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIEL 302
                     P+HDRLGFRYWRDPGAFKEYSTAITG  GKF SFVAVFVYSLFSYTGIEL
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIEL 300

Query: 303 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 362
           TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA
Sbjct: 301 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 360

Query: 363 SPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSR 422
           SPFVVAIQNSGI+VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS+
Sbjct: 361 SPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420

Query: 423 WGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 482
           WGVPYNALILSVLFC LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR
Sbjct: 421 WGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 480

Query: 483 AQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 542
           AQGIDKSKFAYVAPGQRYGAYFAL FCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI
Sbjct: 481 AQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 540

Query: 543 ISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEK 602
           +SWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGR+KDQE+EERL+ NGKNMEWFYEK
Sbjct: 541 LSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEK 600

Query: 603 FLGNIF 608
           FLG IF
Sbjct: 601 FLGRIF 606

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/607 (80%), Positives = 511/607 (84%), Gaps = 1/607 (0%)

Query: 3   MPLKKMFTST-SPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXX 61
           M LK + TS  SPRNSSSLDSD DAYYSKQNPD+FPVKEQEIYNIDLEENNV        
Sbjct: 1   MSLKNVLTSAASPRNSSSLDSDRDAYYSKQNPDSFPVKEQEIYNIDLEENNVSSRSSTFT 60

Query: 62  XXXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAML 121
                   FAVPDGKDE TRLRKDLKARHISM                       PVAML
Sbjct: 61  SPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAML 120

Query: 122 IAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 181
           IAYAFVGLLVF+TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ
Sbjct: 121 IAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 180

Query: 182 LTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXX 241
           LTAAALVIQYW+SRDRVNPGVWIT                      WLSSFK        
Sbjct: 181 LTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLI 240

Query: 242 XXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIE 301
                      P+HDRLGFRYWRDPGAFKEYS AI GGKGKFVSF+AVFVYSLFSYTGIE
Sbjct: 241 LLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIE 300

Query: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 361
           LTGIVCSEA+NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRL+STKGK++SAA
Sbjct: 301 LTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAA 360

Query: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421
           ASPFVVAIQNSGI+VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIF+KT+
Sbjct: 361 ASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTN 420

Query: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481
           +WGVPYNALI SVLFC LAYMNVS+GSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC
Sbjct: 421 KWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 480

Query: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVY 541
           RAQGIDKSKFAYVAPGQRYGAYFAL FCI IALIKNFTVFLGHKFDYKTFITGYIGLPVY
Sbjct: 481 RAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVY 540

Query: 542 IISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYE 601
           + SW GYKLIYKTKVIKSTDVDLYTFKEIYDREEE+G+++DQEKEERLK NGKNMEWFYE
Sbjct: 541 VFSWVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYE 600

Query: 602 KFLGNIF 608
           KFLG+IF
Sbjct: 601 KFLGHIF 607

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/606 (78%), Positives = 502/606 (82%)

Query: 3   MPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXX 62
           M LKKM TS S RNSSSLD+D D Y  KQNPD FPVKEQEIYNIDLEENNV         
Sbjct: 1   MSLKKMLTSASSRNSSSLDNDRDGYSMKQNPDKFPVKEQEIYNIDLEENNVSSRSSTSTS 60

Query: 63  XXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 122
                  FAVPDGKDE TRLRKDLKARHISM                       PV+MLI
Sbjct: 61  PSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLI 120

Query: 123 AYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 182
           AY FVGLLVF+TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL
Sbjct: 121 AYGFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQL 180

Query: 183 TAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXX 242
           TAAALVIQYW+SRDRVNPGVWIT                      WLSSFK         
Sbjct: 181 TAAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLIL 240

Query: 243 XXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIEL 302
                     P+HDRLGFRYWRDPGAFKEYSTAITG KGKFV+F +VFVYSLFSYTGIEL
Sbjct: 241 LLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIEL 300

Query: 303 TGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAA 362
           TGIVCSEA+NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGK+MSAAA
Sbjct: 301 TGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAA 360

Query: 363 SPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSR 422
           SPFVVAIQNSGI+VLPHIFN CVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS+
Sbjct: 361 SPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSK 420

Query: 423 WGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACR 482
           WGVPY AL++SVLFC LAYMNVS+GSAKIFNYFVNVVSMFGILSWITILIVYIYFD+ACR
Sbjct: 421 WGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACR 480

Query: 483 AQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 542
           AQG+DKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGH FDYKTFITGYIGLP+Y+
Sbjct: 481 AQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYV 540

Query: 543 ISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEK 602
            SW GYKLIYKTKV+K  D DLYT KEIYDREEE+G+++DQEKEERL+ NGKN+EWFYEK
Sbjct: 541 FSWVGYKLIYKTKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEK 600

Query: 603 FLGNIF 608
           FLGNIF
Sbjct: 601 FLGNIF 606

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/608 (62%), Positives = 445/608 (73%), Gaps = 13/608 (2%)

Query: 3   MPLKKMFT--STSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXX 60
           M ++++ T  +TS R     D        K +   FP +E+E+ + DLE NN+       
Sbjct: 1   MTIREVLTEETTSDRYEEYFDPQK-----KVDSKTFPTQERELLHDDLE-NNISLSTSAE 54

Query: 61  XXXXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAM 120
                        DGK E TRL+K L+ R +SM                       PV+M
Sbjct: 55  DQNDSYNV-----DGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSM 109

Query: 121 LIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPN 180
           LIAYAFVGLLVF+TMA LGEMASYIPLDGFTSYA+RY DPALGFA+GY YLFKYFILPPN
Sbjct: 110 LIAYAFVGLLVFFTMASLGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPN 169

Query: 181 QLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXX 240
           QLTAAALVIQYWI R++VNPGVWIT                      WLSSFK       
Sbjct: 170 QLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFAL 229

Query: 241 XXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI 300
                       PNHDRLGFR+W+ PGAF  YS AITG  GKFV+FV+VFVY+ F+Y G 
Sbjct: 230 IILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGT 289

Query: 301 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA 360
           EL GIV  EA NPRKSVPKAIKLT+YRII+FYL ++ LLGMCV Y+DP LL  K KS SA
Sbjct: 290 ELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSA 349

Query: 361 AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 420
           AASPFVVAI NSGI+VLPHIFNACVLVFVFSACNSDLYV+SR+LY+LAID KAPKIFA+T
Sbjct: 350 AASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFART 409

Query: 421 SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 480
           +RWG+PY +L LSVLFC LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI IL+ Y+ FD+A
Sbjct: 410 NRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRA 469

Query: 481 CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV 540
            RAQGIDKS F+YVAPGQRYGAYFALFFC LIALIKNFTVFLGH+FDYKTFITGYIG+PV
Sbjct: 470 VRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPV 529

Query: 541 YIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600
           + IS+ GYKLIYKTK+I   +VDLYTFK   D+EEE+G+++D  ++ER+K+NG+N EWFY
Sbjct: 530 FFISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFY 589

Query: 601 EKFLGNIF 608
           +KFL NIF
Sbjct: 590 DKFLSNIF 597

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/598 (63%), Positives = 434/598 (72%), Gaps = 13/598 (2%)

Query: 14  PRNSSSLDSDHDAYYSKQNPDN---FPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXF 70
           P NS+S   D    Y +Q P      P++E+E+ N DLE N                   
Sbjct: 7   PSNSTS---DQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDENDSYNI---- 59

Query: 71  AVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
              DGK E TRL+K LKARH+SM                       PV+ LIAYAFVGLL
Sbjct: 60  ---DGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLL 116

Query: 131 VFYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           VF+TMACLGEMA+YIPLDGFTSYASRY DPALGFA+GY YLFKYFILPPNQLTAAALVIQ
Sbjct: 117 VFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQ 176

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW+ +++VNPGVW+T                      WLSSFK                 
Sbjct: 177 YWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLG 236

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
             P+HDRLGFRYWR PG+FKEYS  ITG  G+FV+FV+VFVY+ ++Y GIELTGIV +EA
Sbjct: 237 GGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEA 296

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           +NPRKS+PKAIKLT+YRI++FYL ++FLLGMCVAY+DP L+  K  S SAAASPFVVAI 
Sbjct: 297 QNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAII 356

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSGI  LPHI NACVLVFVFSACNSDLYVSSR+LY+LAID KAPKIFAKT+RWG+PY AL
Sbjct: 357 NSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYAL 416

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            +SVLFC LAYM VSS SAKIFNYFVNVVS+FGILSWI+ILI YI FD+A RAQG+DKS 
Sbjct: 417 SVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKST 476

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
           FAYVAP Q YGA+F+LFFC LIALIKNFTVFL H+FDYK FITGYIGLPV+   + GYK 
Sbjct: 477 FAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKF 536

Query: 551 IYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
            YKTKVI    VDLYTFK   D+EEE+G+M D EK ER+K NGKN EWFY+KFLGNIF
Sbjct: 537 TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/578 (62%), Positives = 428/578 (74%), Gaps = 3/578 (0%)

Query: 34  DNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAVPDGKDENTRLRKDLKARHISM 93
           D++  K+      DLE N+                 + V DGKD+ TRL+KDLKARHISM
Sbjct: 34  DSYFKKDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHISM 93

Query: 94  XXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEMASYIPLDGFTSY 153
                                  P ++LIAY FVG LVF+TMA LGEMA+YIPLDGFTSY
Sbjct: 94  IAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSY 153

Query: 154 ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXX 213
           ASRY DPALGFA+GY+YLFKYFI+ PNQLTAAALVIQYW+ RD VNPGVWIT        
Sbjct: 154 ASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIA 213

Query: 214 XXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYS 273
                         WLSSFK                   PNHDRLGFRYW+ PGAFK YS
Sbjct: 214 INTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYS 273

Query: 274 TA---ITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIV 330
           ++   I G  GKFV+FV VFVY+LF+Y GIELTGIV +EAENPR+++P+AIKLTV+RI+ 
Sbjct: 274 SSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILF 333

Query: 331 FYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVF 390
           FY+ T+FLLGMCVAY+DP LL+      SAAASPFVVAIQNSG++VLPHIFN CVL+FVF
Sbjct: 334 FYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVF 393

Query: 391 SACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAK 450
           SACNSDLYV +R+LY+LA+DGKAPKIFAKT+RWGVPYNA+   VLFC LAYMNVSSGSA+
Sbjct: 394 SACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAE 453

Query: 451 IFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCI 510
           IFNYFVNVVS+FG+LSW +ILI +IYFD+A RAQGID+S FAYVAP Q YG+YFALFFC+
Sbjct: 454 IFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCV 513

Query: 511 LIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTDVDLYTFKEI 570
           L+ALIKNF+VFLG++FDYKTFITGYIGLPVY  S+ GYKL YKTK +K  + DL ++K  
Sbjct: 514 LLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYKAA 573

Query: 571 YDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
            DREEEEG++K+ E++ERLK   K++EWFYEK++ +IF
Sbjct: 574 VDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/537 (65%), Positives = 419/537 (78%), Gaps = 1/537 (0%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           + DGK++  RL+K+LKARHISM                       P ++LIAY+FVG+LV
Sbjct: 40  ISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILV 99

Query: 132 FYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
           F+ MACLGEMA+YIPLDGFTSYA+RY DPALGFA+GY YLFKYFI+ PNQLTA ALVIQY
Sbjct: 100 FFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQY 159

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           WI R+ VNPGVWIT                      WLSSFK                  
Sbjct: 160 WIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGG 219

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
            PNHDRLGFRYW++PGAFK YS +ITG KGKFVSFVAVFVY+LF+Y GIELTGIV +EAE
Sbjct: 220 GPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAYNDPRLL+    S SAAASPFVVAIQN
Sbjct: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQN 339

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           SG+  LPHIFN CVL+FVFSACNSDLYV +R+LY+LAIDGKAPK+FAKT+RWGVPYNAL 
Sbjct: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALF 399

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
              LFC LAYMNVSSGSA+IFNYFVNVVS+FGILSWI+ILI YI+F +AC AQ +D++ F
Sbjct: 400 GCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           AY AP Q YGAY  LFFC+LIA IKNFTVF+G +FDYK+FITGYIGLP+Y+I + GYK+I
Sbjct: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKII 518

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           YKTK++K+ + DLY+FKE  DREE EG++K+ E +ERLK++ K+++WFYEK+LG IF
Sbjct: 519 YKTKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/535 (65%), Positives = 412/535 (77%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK +  RL+K+L+ARH+SM                       PV++LIAY+FVG LV+ 
Sbjct: 47  DGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYI 106

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            M CLGEMA+YIPLDGFTSYASRY DPALGFA+GY+YLFKY I+ PNQLTAAALV+QYW+
Sbjct: 107 VMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWV 166

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           SR++VNPGVWIT                      WLSSFK                   P
Sbjct: 167 SREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGP 226

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           +HDRLGFR+++DPGAF+ YS AI+G KGKFVSFVAVFVY+LF+Y G EL GIV +E +NP
Sbjct: 227 SHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNP 286

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R++VP+AIKLT+YRI+VFYL T+FLLGM VAYNDP LL  K KS SAAASPFVVAI+N+G
Sbjct: 287 RRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAG 346

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I VLPHIFNACVL+FVFSACNSDLYV+SR+LY LAID KAPKIFAKT++WGVPYN+LIL 
Sbjct: 347 IPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILC 406

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +LFC LAYMNVSSGSA++FNYFVNVVS+FG++SWI ILI YIYFD+A RAQG+DKS  AY
Sbjct: 407 ILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAY 466

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            AP    GAYFALFFC LIALIKNFTVFLGHKFDYK FITGYIG+PV+II + GYK I  
Sbjct: 467 AAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRG 526

Query: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           TK +K  + DLYTFKE+ D EEEEG++ D  ++E+++S+ KN +WFYEKFLG IF
Sbjct: 527 TKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/536 (65%), Positives = 401/536 (74%), Gaps = 1/536 (0%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGKDE+TRLRKDLKARHISM                       P++M IAYAFVG+LVF+
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
           TMA LGEMASYIPLDGFTSYASRY DPALGFA+GY YL KY ILPPNQLTAAALVIQYW+
Sbjct: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            R++VNPGVWIT                      WLS+FK                   P
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
            HDRLGFR++  PGAFK YS +I G KGKFV+FVAV VY+LF+Y GIELTGIV +EA NP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP L   K     AAASP+VVAI NSG
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I+ LPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFA T+RWGVPY +L++S
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
             FC LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI+ILI Y+ F +A +AQ +D+S+FAY
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            AP Q YG+YF L FCILIA IKNFTVFL H FDYK FITGYIG+PV++IS+ GYK + K
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK-SNGKNMEWFYEKFLGNIF 608
           TK+ K  +VDLYTFK   D EEE+G++ D E+ ERLK S  K  +WFYEK LGNIF
Sbjct: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/527 (64%), Positives = 402/527 (76%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L+K+L+ARH+SM                       P +M IAY+FVG+LVF+TMA +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 142 ASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPG 201
           ASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYWI RD VNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 202 VWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFR 261
           VWIT                      WLSSFK                   P+HDRLGFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 262 YWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAI 321
           YW+ PGAFK YS AI G  GKFV+FV+VFVY+LF+Y GIELTGIV +EA NPRKSVP+A+
Sbjct: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338

Query: 322 KLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIF 381
           KLTV+RI++FYL T+FLLGMCVAYNDPRLL+ KG   SAAASPFVVAIQNSGI VLPHIF
Sbjct: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIF 398

Query: 382 NACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAY 441
           NACVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T+ WG+P+ +L + VLF  LAY
Sbjct: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458

Query: 442 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 501
           MNVSSGSA++FNYFVNVVS+FG+LSWI I I YI F +A + QG+D+SKFAY AP Q YG
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 502 AYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTD 561
            YF+L +C+ IA IKNFTVFLGH FDYK FITGYIGLPV++I + GYK I KTK++KS +
Sbjct: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578

Query: 562 VDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           VDL+T KE++D++E EG++ DQEK+ RL+ N  ++EW YEKFLGNIF
Sbjct: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/590 (60%), Positives = 428/590 (72%), Gaps = 18/590 (3%)

Query: 19  SLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAVPDGKDE 78
           S  +  D   +K+ P    ++++   ++ L++ N                     DGK  
Sbjct: 17  SFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQF------------------DGKCS 58

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           + RL+KDLKARH+SM                       PV+MLI+Y+FVG+LVF+ M+C+
Sbjct: 59  DQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCI 118

Query: 139 GEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 198
           GEMA+YIPLDGFTSYASRY DPALGFA+GY YL KYFILPPNQLTAAALVIQYWI R++V
Sbjct: 119 GEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKV 178

Query: 199 NPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRL 258
           NPGVWIT                      WLSSFK                   P HDRL
Sbjct: 179 NPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRL 238

Query: 259 GFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 318
           GFRYW+ PGAFKEYS +I G  G+FVSFV+ FVY LF Y GIELTGIV +EAENPRK++P
Sbjct: 239 GFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIP 298

Query: 319 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLP 378
           KAIKLT++RII+FY+ T+FLLGMCV+ NDP LL  K KS SAAASPFVVAI NSGIE LP
Sbjct: 299 KAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALP 358

Query: 379 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCG 438
           HIFNACVL+FVFSACNSDLYV+SRNLY+LAID KAPKIFAKT+R+G+PYN+L ++VLFC 
Sbjct: 359 HIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCL 418

Query: 439 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 498
           LAYM+VSSGSAKIFNYFVNVVS+ G+L+WI+ILI YI FD+A RAQGIDKS FAYVAP Q
Sbjct: 419 LAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQ 478

Query: 499 RYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIK 558
            YGAYF+LFFC L+ALIKNFTVFL HKFDY+ FITGYIGLP++ I + GYK + KTK+ K
Sbjct: 479 PYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKIRK 538

Query: 559 STDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
             +VDL++FK   D+EEE+GR+KD    ER+K NGKN EWFYE +LG IF
Sbjct: 539 PEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/535 (62%), Positives = 405/535 (75%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK E  RL+K+L+ARH+SM                       PV++LI+Y+FVGLLV+ 
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            M+CLGEMA++IPLDGFTSYASRYVDPA+GFA+GY+YLFKYFI+ PNQLTA A+V+Q+W+
Sbjct: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           SRDRVNPGVWIT                      WLSS K                   P
Sbjct: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 221

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           NHDR GFR+WRDPGAFK YS AI+G KGKFVSF +VF  +LF+YTG EL GIV +EA+NP
Sbjct: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 281

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R+SVP+AIKLT+YRI+VFY+ T+ LLGM VAYNDPRLL  K  + SAAASPFVVAI+N+ 
Sbjct: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENAS 341

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I VLPHIFN CVLVFVFSACNSDLYV+SR+LY LAIDGKAP+IFA T++WGVPY +L LS
Sbjct: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           VLFC LAYMNVSSGSA++FNYFVNVVS+FG+LSWITILI YI FDKA R Q  DKS  +Y
Sbjct: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A  Q +  Y ALFFC LI LIKN+TVFLGHKFDYKTFI+GYIG+PVY+I + GYK++Y+
Sbjct: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521

Query: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           TK+IK  DVDLYTFK+  D EEEE ++ ++E+ E ++++ KN +WFYE FLG IF
Sbjct: 522 TKLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/538 (60%), Positives = 397/538 (73%), Gaps = 3/538 (0%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK E  RL+K+LKARH+SM                       P ++ I Y+FVG+LVF+
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
           TM+CLGEMA++IPLDGFTSYASRYVDPALGFA+GY+YL KY ILP NQLTA A+V+QYW+
Sbjct: 116 TMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            RD +NPGV+IT                      WLSSFK                   P
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGG---KGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
           NHDRLGFRYWRDPG+FK YS++I       GKFVSF + FVY+LF Y GIELTGIV +EA
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           +NPRK++PKAIKLT+YRII+FY+ T+ LL MCVAYNDP LL   G+S SAAASPFVVAI+
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSGI +LPHIFN CVL FV SA NSDLYV+SR+LY+LAID KAPK F KT++WG+PY +L
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
             S  F  LAYMNVSS ++ +FNYFVN VS+FG++SWI IL+ YI+FDKAC+AQG+DKS 
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
           F YVAP Q YGAYFALFFC ++AL+KNFTVFLG +FDYK FITGYIG+PV+ I + GYK+
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 551 IYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           +YKTK  +  +VDL T K + D+EEE+G+++D E+EERLK+  K+  WFY++FLG IF
Sbjct: 536 VYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/532 (61%), Positives = 395/532 (74%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK +  RL+K L+ARH+SM                       P A+LIAYAFVGLLVF+
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVIQYW+
Sbjct: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            RD+VNPGVWIT                      ++S+ K                   P
Sbjct: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGP 250

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           NH+ LGF+YW++PGAFKEYSTAITG KG+FVSF +VFV +LF+Y G EL GIV SE +NP
Sbjct: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP L+S K    SA+ASPFVVAI N+G
Sbjct: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAG 370

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I VLPHI NAC+L+FVFSA NSDLYV+SR+LY LAID KAP+IFAKT++ GVPY +L++ 
Sbjct: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           VLF  LAYMNVSSGS+++F YFVN VS+FG+LSWI+ILI YI FDKA R QGIDKS  AY
Sbjct: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            +P Q YGA+F+LFFCILI LIKNF  FLG  FDYK+FITGYIG+P YIIS+ GYKL YK
Sbjct: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK 550

Query: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLG 605
           TK+I S +VDL +FKE  D EEEEG+M D+E+   L ++GK+++W YEK  G
Sbjct: 551 TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFG 602

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/535 (62%), Positives = 401/535 (74%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK E  RL+K L+ARH+SM                       P ++LI+Y+FVGLLV+ 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYW+
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           SR++VNPGVWIT                      WLSS K                   P
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           NHDR GFRYWRDPGAFK YS AI+G KGKFVSF +VF  +LF+YTG EL GIV +EA+NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP L+  K  S SAAASPFVVAI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I VLPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFAKT+ WGVPY +L +S
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           VLFC LAYMNVSSGSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F KA  AQ  DKS F+Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            AP Q +  + +LFFC LI LIKN+TVFLGH FDYKTFI+GYIG+PVY I + GYKL+++
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           +K+IK  DVDLYTFK   D EEEEG++ + E++E+LKS+ KN+ WFY+ FLG IF
Sbjct: 523 SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/537 (59%), Positives = 390/537 (72%), Gaps = 2/537 (0%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK +  RL+KDL+ARH+SM                       P+A+LIAY+ +G +VF 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+GYTYLFKY +L PNQLTAAALV+QYW+
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            R +VNPGVWIT                      WLSSFK                   P
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 254 NHDRLGFRYWRDPGAFKEYSTAIT--GGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
           +H+RLGFRYW+DPG FK YS A++  GGKGKFVSF +VFVY+LF+Y G EL GIV +E +
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPR++VP+AIKLT+YRI+VFYLCTVFLLG+ VAYNDP LL TK    SAAASP+VVAI+N
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +GI VLPHIFNACVL FVFSACNSDLYV SR+LY LAID KAPKIFAKT+ WGVPYN+L 
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           L  LFC LAYMNVSS +  +F+YFVNV S+FG+LSWI+ILI YI FD+A R QGIDK+  
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           +Y AP Q   A+ AL FC+++AL+KNFTVFLG  FDYKTFITGYIG+PVYI+ +  YK++
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           +KTK IKS +VDL+T+K   D EEEEG+++    +E  K +G   + FY+   G IF
Sbjct: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/523 (58%), Positives = 378/523 (72%), Gaps = 3/523 (0%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           + DGK E  RL+K LK+RHISM                       PV+ LIAY FVG++V
Sbjct: 55  IGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMV 114

Query: 132 FYTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
           F+TMACLGEMA++IPLDGFTSYASRY DPALGFA+GY YL KYFILPPNQLTAAA+V+QY
Sbjct: 115 FFTMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQY 174

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W+ RD VNPG+W+T                      WLSS K                  
Sbjct: 175 WVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGG 234

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             +HDRLGFRYW+ PGAF +YS  I+G  GKFVSFVAV V  +F+Y GIELTGIV +EA 
Sbjct: 235 AGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEAS 294

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPR+SVPKAIKLT YRI+VFY+ ++FLLGMCV YND +L++T   S++A  SPF +AI N
Sbjct: 295 NPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTA--SPFSIAILN 352

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +GI VLP IFN C+L+FVFSA NSDLYV+SRNLY+LA+D KAPKIFA T+RWG+PYN+L 
Sbjct: 353 AGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLF 412

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +S LFC LAYM VSS SA++F YFVNVVS+ G+L+WI+ILI YI FD+A RAQ +DKS F
Sbjct: 413 VSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTF 472

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           AYVAP Q YGAY +LFFC LIA+IKNFTVFLGH FDYKTFITGYIGLP++++ + GYK+ 
Sbjct: 473 AYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKIT 531

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
            K+++  +  VDL + K + DRE+ E  + +Q K E + +N K
Sbjct: 532 CKSEIRSARYVDLVSQKSLVDREQVEYELIEQLKREEMIANTK 574

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/538 (57%), Positives = 375/538 (69%), Gaps = 3/538 (0%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DGK E  RL+KDL+ARH+SM                       P ++LIAY+ +G +VF 
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
            M+CLGEMA+YIPLDGFTSYA+RY DPALGFA+G+ YLFKY +L PNQLTA ALVIQ+WI
Sbjct: 111 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
              RV+PGVWIT                      WLSSFK                   P
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 254 NHDRLGFRYWRDPGAFKEYS---TAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
            HDRLGFRYW DPGAFKEYS   T I GG GKFV+F++VFVY+LF+Y G EL GIV +E 
Sbjct: 231 THDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAEC 290

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           ++PR++VP+AIKLT+YRI+VFYL T+FLLGMCVAYNDP L+      +SAAASP+VVAI+
Sbjct: 291 KDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIE 350

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           N+ I VLP++FNACVL FVFSACNSDLYV SR+LY LAIDGKAPK+FA+T++WGVPYNAL
Sbjct: 351 NAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNAL 410

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
               LFC LAYM+VS  +   F YFVNV S+FG++SW++ILI YI FD+A RAQGI KS 
Sbjct: 411 ACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKST 470

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
            +YVAP Q Y  + AL FCI +ALIKNF  F+G + D  TFITGYIGLP+YI  + GYK+
Sbjct: 471 LSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKI 530

Query: 551 IYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608
           ++KTK I S +VDL+TFKE  D EEEE   +    +E+L   G + +  Y+  LG IF
Sbjct: 531 VHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/504 (38%), Positives = 267/504 (52%), Gaps = 15/504 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++N  L ++LK R +S+                       P+++ IAY F G L+   + 
Sbjct: 27  EKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIF 86

Query: 137 CLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            L EMAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R
Sbjct: 87  SLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--R 144

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             VN GVW+T                       L+ FK                   PNH
Sbjct: 145 PDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNH 204

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
              GFRYWR+ GA       + GG GKF+ + A  V S+F + G E+ GIV  E  NP+K
Sbjct: 205 TTTGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKK 261

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++PK+     +RI   Y+  VF+LG+ ++  + +L+     S  A ASPFV+AI +SGI+
Sbjct: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIK 319

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLP+  NA +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   +R+ VP    +   L
Sbjct: 320 VLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSL 379

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              LAYMN    +A +F+Y  + VS+FGIL+W  ILI YI +D+A +A+GI      +  
Sbjct: 380 LGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRM 439

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
             Q Y AY  LFF  +I     +  F+  KF YKTFIT YIG+   I+   GYKL +KTK
Sbjct: 440 WFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498

Query: 556 VIKSTDVDLYTFKEIYDREEEEGR 579
            +K +++   T      R E EG 
Sbjct: 499 FVKPSEISFRT------RNEHEGE 516

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  308 bits (790), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 181/496 (36%), Positives = 262/496 (52%), Gaps = 11/496 (2%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
            D    L+K L  RHI +                       P  + +++  +  +V+  M
Sbjct: 45  SDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIM 104

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             L EM  Y+P  G      +RYVDP+LGFA G+ Y + Y +L   +LTAAA +++YW  
Sbjct: 105 CTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYW-- 162

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            D+V  GVWIT                      W +S K                   PN
Sbjct: 163 TDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPN 222

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYT-GIELTGIVCSEAEN 312
           HDR+GFRYWR+PGAF  +   ITGG  G+F+      + S F++    EL G+ C EA++
Sbjct: 223 HDRVGFRYWRNPGAFGYH---ITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKD 279

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQN 371
            R+++ KA +  +YRII FYL +  ++G+ VA ND  LL + +     AA+SPFV  I N
Sbjct: 280 TRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIAN 339

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           SGI VL H+ N  +L   +SA NS  Y SSR++ AL+  G APKIF+K +R+GVPYNA+ 
Sbjct: 340 SGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVF 399

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           L  L   LAY+NVSS S+K+F +  N+ ++ G + W  I + YI F KA     +   + 
Sbjct: 400 LCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRI 458

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y +P Q + AYF      +I L   + VF+  ++DYK F+T YI LP+++  + G+K I
Sbjct: 459 PYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTI 518

Query: 552 YKTKVIKSTD-VDLYT 566
           YKT+     D +D+ T
Sbjct: 519 YKTRFCIPVDQIDVIT 534

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  305 bits (782), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 175/490 (35%), Positives = 261/490 (53%), Gaps = 9/490 (1%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
            G      L ++L    +S+                       P+++ +AY F G ++  
Sbjct: 25  GGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSILAV 84

Query: 134 TMACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
            +  L EMA++ P+D GF+ Y ++YVDPA GFA G+ Y  KY I+    LTA  LVI YW
Sbjct: 85  VIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 144

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
             R  +N  VW+T                      +++  K                   
Sbjct: 145 --RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGG 202

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
           P+H  +GFRYWR+ G F  Y   + G  GKF+ + A  + S+F + G E+ GI+  E  N
Sbjct: 203 PDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETAN 259

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK++PKA +  + RI VFY+  VF+LG+ V+ ++ +L+     S  A ASPFV+AI  S
Sbjct: 260 PRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLV--HAHSTDANASPFVIAISTS 317

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           GI+VLP   NA +LVF+ S+  +D+Y+ SR LY LA DG APKIF + ++  +P    ++
Sbjct: 318 GIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVV 377

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
             L   LAYMN    +A +F Y  + VS+FGIL+W  IL+ YI++D+  ++ G+   +  
Sbjct: 378 GSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIP 437

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           +  P Q Y AY ALFF  +I     ++ F+  KF+YK FIT YIG+   ++   GYKL Y
Sbjct: 438 FRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIFANVLLVLGYKLYY 496

Query: 553 KTKVIKSTDV 562
           KTK +K  ++
Sbjct: 497 KTKWVKPEEI 506

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  304 bits (779), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 174/517 (33%), Positives = 275/517 (53%), Gaps = 14/517 (2%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G  + T++++ LK RHISM                       PV  LIAY F+G L +  
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW- 153

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
             D V    WI                       W++  K                    
Sbjct: 154 -TDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG- 211

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 212 KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
            +VLPHIFNA +L  + SA NS++YV SR  Y++A++G APK    T++ G+PY A++ +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I +I F +A + QGI +    +
Sbjct: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A    +GAY+A FF  +I +I+ FT F   KF    F T YI + ++ + W G+++ ++
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507

Query: 554 TKV-IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
             + IK+ D+DL T     DR E +  + +++K   L
Sbjct: 508 GPLFIKTEDIDLDT-----DRREIDDVVWEEQKPRNL 539

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  304 bits (779), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 172/514 (33%), Positives = 275/514 (53%), Gaps = 14/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E+  +++ LK RHI M                       PV  L+AY F+G +VF     
Sbjct: 62  EHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQS 121

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    +IQ+W  + 
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK- 180

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI+                      W++S K                       
Sbjct: 181 -VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PGA      +   G+ +F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 240 -IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 298

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI+  + RI++FY+ ++F +G+ V YNDP+L ST       ++SPF++ IQN+G  V
Sbjct: 299 VPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSY---VSSSPFIITIQNAGTRV 355

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LPHIFNA +L  + SA NS++YV SR L+++A +G APK  AKT+  GVPY +++    F
Sbjct: 356 LPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAF 415

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+YM +S+G AK FN+ +N+  + G  +W+ I   ++ F +A + +GI +    Y A 
Sbjct: 416 GSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKAL 475

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              + AY+A+FF ++I LI+ FT F  H F  + F+  YI + ++++ W  +++ ++ ++
Sbjct: 476 WMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRI 534

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           I K  DVD+ T     DR E E  + + +  + L
Sbjct: 535 IWKLEDVDIDT-----DRREIESVVWEDDAPKTL 563

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  303 bits (777), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 278/514 (54%), Gaps = 13/514 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           +++  +++DLK RH+SM                       PV  L+AY F+G + F    
Sbjct: 57  NDDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQ 116

Query: 137 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            LGEMA++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW   
Sbjct: 117 SLGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFA 176

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V   VWI                       W+++ K                    + 
Sbjct: 177 --VPLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SE 233

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             LGFRYW++PG +     +    + +F+ +V+  + + F+Y G EL GI   E++NPRK
Sbjct: 234 GALGFRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRK 293

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           +VPKAI    +RI+ FY+ ++F +G+ V Y DPRL +T    ++   SPFV+AIQNSG +
Sbjct: 294 TVPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINT--SPFVMAIQNSGTK 351

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLP +FN  +LV + SA NS++Y+ SR LY L+  G AP +F KT++ GVP+ A++ S +
Sbjct: 352 VLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSI 411

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LAY+N+S  + K+F++ + + ++ G  +W+ I + +I F +  + +GI ++   + A
Sbjct: 412 FGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKA 471

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               +GAY+A FF  +I LI+ F  F   +F +  FI  YI + ++I+ W G+++++KT+
Sbjct: 472 KFMPWGAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTR 530

Query: 556 VI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           +I +  DVD+ T     DR E +  +   + E +
Sbjct: 531 LILRKEDVDIDT-----DRREIDALVWSDDDEPK 559

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 183/540 (33%), Positives = 285/540 (52%), Gaps = 25/540 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D    +  L+K LK+RHI +                       P  +  +Y  + ++++ 
Sbjct: 43  DAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYP 102

Query: 134 TMACLGEMASYIPLDGFT------SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            M  LGEM  Y+P DG +         +RYVDP+LGFA G+ Y + Y IL   + TAA+ 
Sbjct: 103 VMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASG 162

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
           V+QYW +   V  G WIT                      W +S K              
Sbjct: 163 VVQYWTTA--VPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFIL 220

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIV 306
                P+HDRLGFRYW+ PGAF  + T  +G  G+F+      +   F++  G EL  + 
Sbjct: 221 FWGGGPHHDRLGFRYWQKPGAFAYHIT--SGNTGRFLDIWTGVIKGGFAFILGPELVALT 278

Query: 307 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST---KGKSMSAAAS 363
            +EA++ R+++ KA +  VYR+I FY+ +   +G  VAYND + LST   +GK   A +S
Sbjct: 279 SAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYND-KTLSTALDQGKP-GAGSS 336

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           PFV+ IQN+GI+VLPHI N C+L   +S+ NS ++ +SR+L +++ +G APKI  + +R+
Sbjct: 337 PFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRF 396

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           GVPY A+ L+ L   +AY+NVSS +A +F +F N+ ++ G + WI I I Y+ F KA   
Sbjct: 397 GVPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFF 456

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
           Q + + +  +  P Q YG +F +    +I L   + +F+   ++   FI  Y+ LP++++
Sbjct: 457 QNLYE-RVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLV 515

Query: 544 SWAGYKL---IYKTKVIKSTDVDLYT-FKEIYDREEEEGRMKDQEKEERLKSNGKNMEWF 599
            W G+KL    +KT  I   ++D+ T  KEI    EEE +  D+++     + GK MEW 
Sbjct: 516 LWIGHKLWTRTWKTWAIPVPEIDVTTGLKEI----EEESKECDEKRIVPTTAGGKFMEWL 571

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  301 bits (772), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/517 (32%), Positives = 274/517 (52%), Gaps = 14/517 (2%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G  + T++++ LK RHISM                       PV  LIAY F+G L +  
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW- 153

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
             D V    WI                       W++  K                    
Sbjct: 154 -TDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 213 T-GPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NSG
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
            +VLPHIFNA +L  + SA NSD+Y+SSR LY++ ++G APK    T++ G+PY A++ +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + +I F +A + QGI +    +
Sbjct: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A    +GAY+A FF  +I +I+ FT F   KF+   F T Y+ + ++   W G+++ ++
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507

Query: 554 TKVIKST-DVDLYTFKEIYDREEEEGRMKDQEKEERL 589
             + K T D+DL T     DR E +  + ++++ + L
Sbjct: 508 GPLFKKTEDIDLDT-----DRREIDNDVWEEDEPKNL 539

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  302 bits (774), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 181/539 (33%), Positives = 279/539 (51%), Gaps = 25/539 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           +EN +L++ LK+RH+ +                       P  +  +Y  +   ++  M 
Sbjct: 65  EENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMN 124

Query: 137 CLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             GEM  Y+P +G  S  S      +YVD +LGFA  + Y + + IL   + TAAA V++
Sbjct: 125 AFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVE 184

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW    +V  G WIT                      W +S K                 
Sbjct: 185 YWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWG 244

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCSE 309
             P+HDRLGFRYW+ PGAF ++ T  TGG   F+      +   F++  G EL  +  SE
Sbjct: 245 GGPSHDRLGFRYWQRPGAFADHITDGTGGN--FLDVYTGVIKGGFAFVLGPELVSLTSSE 302

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVA 368
             + R+++ KA +  V+R+++FY+     + + VAYNDP L +   +S   A +SPFV+ 
Sbjct: 303 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 362

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
           IQN+GI+VLPHI N C++   +SA N+ ++ SSR+L  +A  G APK F+K +R+GVPY 
Sbjct: 363 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYV 422

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
           A+  S LFC LAY+NVSS +A +FN+F N+ ++ G + WI   + YI F KA     +  
Sbjct: 423 AVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-Y 481

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGY 548
            +  Y    Q+Y  +++LF   LI L   + +F+   +DYK FI  YI LPV+I+ W G+
Sbjct: 482 DRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGH 541

Query: 549 KLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           KL+   ++   I    +D++T  E    E EE  + ++  E+R+  N       ++KFL
Sbjct: 542 KLVTRSWRQWYIPVDKIDVFTGLE----EIEE--LTNELDEKRVPPNNA-----WDKFL 589

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  301 bits (770), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 171/520 (32%), Positives = 275/520 (52%), Gaps = 14/520 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D +++   ++++LK RHISM                       P+  LIAY F+G +VF 
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W
Sbjct: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V    WI+                      W++S K                   
Sbjct: 147 TMA--VPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYW++PG +     +    + +F  +V+  + + F++ G EL GI   E + 
Sbjct: 205 VTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQE 263

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VPKAIK  V+RI+VFY+ ++ ++G+ V YNDP+L S        ++SPF++ IQN+
Sbjct: 264 PRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY---VSSSPFIITIQNA 320

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G ++LPHIFNA +L+ + SA NS++Y+ SR LY LA +  APK F  TS+ GVPY  ++ 
Sbjct: 321 GTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLF 380

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + +F  LAYM  ++G  K F + +N+V + G  +W+ I   +I F KA + +GI ++   
Sbjct: 381 TSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLP 440

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           Y A    + AY+A+FF ++I +I+ FT F   KF    F   YI + ++II W  +++ +
Sbjct: 441 YKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWF 499

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           K +++ K  DVDL T     DR + E  +   + E++ K+
Sbjct: 500 KCRLVWKLQDVDLDT-----DRRDIEEEVWSDDVEDKNKN 534

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  301 bits (771), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 167/490 (34%), Positives = 262/490 (53%), Gaps = 6/490 (1%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P+G      +++ LK RH+SM                       PV  LIA+  +G L +
Sbjct: 64  PEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAY 123

Query: 133 YTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
                LGEMA++IP+   FT ++ R++ PA+G A GY Y F + I    +L+    +IQY
Sbjct: 124 SVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQY 183

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W   D V    WI                       W++S K                  
Sbjct: 184 W--TDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGA 241

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
            P    +GFRYWR PG +     A    K +F+ +V+  + + F+Y G EL GI   E +
Sbjct: 242 GP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETK 300

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK+VP+AI    +RI++FY+ ++F +G+ V YNDP+L  +   S   A SPF++AI N
Sbjct: 301 NPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSY-IAQSPFLIAILN 359

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
               VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK F+KT++ GVP+ A++
Sbjct: 360 CRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVL 419

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           ++ +F  LAY+NVS+ + ++F++ +N+ ++ G ++W+ I I +I F +  + +GI +   
Sbjct: 420 ITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDL 479

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y A    Y AY+A FF  +I +I+ FT F  H F+   F   YI + ++ I WA ++ I
Sbjct: 480 PYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTI 538

Query: 552 YKTKVIKSTD 561
           Y+TK+ ++ D
Sbjct: 539 YRTKLFRTLD 548

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  301 bits (770), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 180/514 (35%), Positives = 276/514 (53%), Gaps = 14/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +TR+++ LK RHI M                       PV  LIAY F+G ++++    
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW  + 
Sbjct: 147 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK- 205

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI                       W++S K                    +  
Sbjct: 206 -VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQG 263

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PGA      +   G+ +F+ +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 264 PIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +G+ V YNDPRL ++   S   A+SPFV++IQN+G +V
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSAS---SAVIASSPFVISIQNAGTKV 380

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA VLV V SA NS++YV SR LYALA  G APK FA  +R GVPY  +I + L 
Sbjct: 381 LPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALL 440

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V+  +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 441 GLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 500

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              +GAY+A FF  +I  I+ F  F   KFD   F T YI L + ++ +AG +L Y+ + 
Sbjct: 501 FMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRF 559

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + K  D+D+ +     DR E +  + + ++ + L
Sbjct: 560 LWKLEDIDIDS-----DRREIDAIVWEDDEPQNL 588

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  300 bits (767), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 175/518 (33%), Positives = 276/518 (53%), Gaps = 14/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           + + ++TR+++ LK RHI M                       PV  LIAY F+G +V++
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW
Sbjct: 156 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 215

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V    WI                       W++S K                   
Sbjct: 216 --TKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS 273

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            +   +GFRYWR+PG +     +   G+ +F+ +V+  + + F+Y G EL GI   EA N
Sbjct: 274 -HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 332

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRKSVP+AI   V+RI +FY+ ++F +G+ V +ND RL      S   A+SPFV++IQN+
Sbjct: 333 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL---ANDSAVIASSPFVISIQNA 389

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G   LP IFNA VL+ + SA NS++YV SR LYALA+ G APKIF+  +++GVPY  +I 
Sbjct: 390 GTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVIC 449

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           +     LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    
Sbjct: 450 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLP 509

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    +GAY+A FF  +I  I+ F  F   KFD  TF T YI L +  + ++G +L Y
Sbjct: 510 FKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVSTFFTSYISLILLAVLFSGCQLYY 568

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + + I K  D+D+ +     DR E E  + ++++ + L
Sbjct: 569 RCRFIWKVEDIDIDS-----DRREIEAIIWEEDEPKNL 601

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  299 bits (765), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 190/614 (30%), Positives = 300/614 (48%), Gaps = 57/614 (9%)

Query: 11  STSPRNSSSLDSDHDAYY-------SKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXX 63
           S+  RN+   D++ D          ++    N  ++E  I ++DLE++            
Sbjct: 47  SSGSRNNHRSDNEKDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSV--------- 97

Query: 64  XXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIA 123
                     DG  E  +L++ L++RH+ +                       P  + I+
Sbjct: 98  ----------DGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFIS 147

Query: 124 YAFVGLLVFYTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFIL 177
           Y  +  +++  M  LGEM  ++P DG  S  S      RYVDP+LGFA G+ Y + Y IL
Sbjct: 148 YIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVIL 207

Query: 178 PPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXX 237
              + TAA+ V++YW +   V  GVWIT                      W +S K    
Sbjct: 208 VAAECTAASGVVEYWTTA--VPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCI 265

Query: 238 XXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSY 297
                          PNHDRLGFRYW+ PGAF  + T   G  G F       +   F++
Sbjct: 266 VGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAF 323

Query: 298 T-GIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--K 354
             G EL  +  +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +
Sbjct: 324 ILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQ 383

Query: 355 GKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAP 414
           GK   A +SPFV+ IQN+GI+VLPHI N C+L   +SA N+ ++ S+R+L  +A  G+AP
Sbjct: 384 GKP-GAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAP 442

Query: 415 KIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVY 474
           K   + ++WGVPY A+ +S L   LAY+NVSS +A +FN+F N+ ++ G L W+   I Y
Sbjct: 443 KCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAY 502

Query: 475 IYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITG 534
           + F KA    G+   +  +   GQ Y  +F+L    +I +   + +F+   +    FI  
Sbjct: 503 LRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAA 561

Query: 535 YIGLPVYIISWAGYKL---IYKTKVIKSTDVDLYT-FKEIYDREEEEGRMKDQEKEERLK 590
           YI LP++++ W G+KL    ++   +  +++D+ T   EI    EE+ R   + +E RL 
Sbjct: 562 YITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVEI----EEKSR---EIEEMRLP 614

Query: 591 SNGKNMEWFYEKFL 604
             G     F +KFL
Sbjct: 615 PTG-----FKDKFL 623

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  296 bits (758), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/491 (35%), Positives = 262/491 (53%), Gaps = 9/491 (1%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +TR+++ LK RHI M                       PV  LIAY F+G +V++    
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQ+W S  
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSA- 181

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI                       W++S K                    +  
Sbjct: 182 -VPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQG 239

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 240 PIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 299

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +GM V +NDPRL S        A+SPFV++IQN+G  V
Sbjct: 300 VPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVA---VIASSPFVISIQNAGTRV 356

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LPHIFNA V++ + SA NS++YV SR LYAL+  G APK F   +R GVPY  +I + L 
Sbjct: 357 LPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLL 416

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 417 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAK 476

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              +GAY+A FF  +I  I+ F  F   KFD   F T YI L + ++   G +L Y+ + 
Sbjct: 477 LMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRF 535

Query: 557 I-KSTDVDLYT 566
           + K  D+D+ T
Sbjct: 536 LWKLEDIDIDT 546

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  296 bits (758), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 183/515 (35%), Positives = 269/515 (52%), Gaps = 21/515 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K E   L++ L++RHI +                       P  +L +Y  + L+++  M
Sbjct: 43  KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVM 102

Query: 136 ACLGEMASYIPLDGFTS------YASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
             LGEM  Y+P  G  S        SRY DP+LGFA G+ Y + Y IL   + TAA+ V+
Sbjct: 103 NALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVV 162

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
            YW +   V    WIT                      W +  K                
Sbjct: 163 TYWTTV--VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCS 308
              P+HDRLGFRYW+ PGAF  + T  TG  G+F+      +   F++  G EL  +  S
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYHIT--TGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFV 366
           EA + R+++ KA +   YR+I FY+ +   +G+ VA NDP L      GK+  AA+SPFV
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKA-GAASSPFV 337

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           +AIQN+ I++LPHI NAC+L   +S+ NS ++ +SR+L ++A DG APK+F K +R GVP
Sbjct: 338 IAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVP 397

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
           YNA+ +S  F  LAY+NVSSGSAK F +F N+ ++ G + WI I + Y+ F KA   +G+
Sbjct: 398 YNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL 457

Query: 487 -DKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISW 545
            D+  F   +P Q YG YF +    +I L   +  F+   +    F+  YI LPV+++ W
Sbjct: 458 YDRVPFK--SPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLW 515

Query: 546 AGYKLIYKTK---VIKSTDVDLYT-FKEIYDREEE 576
            G+K+  +T    VI   +VD+ T   EI +  +E
Sbjct: 516 VGHKIYTRTLSTWVIPVAEVDVTTGLAEIEELTKE 550

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/516 (33%), Positives = 276/516 (53%), Gaps = 15/516 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
            G+  N  ++++LK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VI++W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFW 195

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
              ++V    WI+                      W++S K                   
Sbjct: 196 --TNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PGA+     +    +G+F+ +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L +    +   + SPF++AI+NS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTA---TSYVSVSPFIIAIENS 369

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ GVPY A+ +
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFI 429

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELP 489

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A      AYFA  F I+I LI+ FT F   KFD   F+  YI + +++  W  +++I+
Sbjct: 490 FKAKLMPGLAYFAATFMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586
           + + I K  DVD+ +     DR + E  + +D E +
Sbjct: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHEPK 579

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  295 bits (754), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 273/514 (53%), Gaps = 14/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +T++++ LK RH+ M                       PV  LIAY F+G ++++    
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW   D
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYW--TD 206

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           +V    WI                       W++ F                     +  
Sbjct: 207 KVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIA-FIKVLAIMGYLLYALIIVCGGSSQG 265

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PG +     +     G+F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 266 PIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 325

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI +FY+ ++F +GM V YND RL ST   S   A+SPFV++IQN+G +V
Sbjct: 326 VPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLAST---SAVIASSPFVISIQNAGTKV 382

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA V++ + SA NS++YV SR LYALA+ G APK FA  +R+GVPY  +I++   
Sbjct: 383 LPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSAL 442

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I I +I F +A + +GI +    + A 
Sbjct: 443 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 502

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              +GAY+A FF  +I  I+ F  F  H +D   F T YI L +  + + G ++ Y+ + 
Sbjct: 503 LMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
             +  D+D+ +     DR E E  + + ++ + L
Sbjct: 562 FWRVEDIDIDS-----DRREIEAVIWEDDEPKTL 590

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  295 bits (754), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 274/512 (53%), Gaps = 15/512 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           ++  +++ LK RHI+M                       PV  LIAY FVG ++F     
Sbjct: 89  KHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQS 148

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEM ++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W +  
Sbjct: 149 LGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA- 207

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI                       W++  K                   P H 
Sbjct: 208 -VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-HG 265

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
             GFRYWRDPGA+     A    + +F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 266 PFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA 325

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VPKAIK  + RI+ FY+ ++F +GM V +NDP+L S    +   ++SPF++AIQNSG+ +
Sbjct: 326 VPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSA---TSFVSSSPFIIAIQNSGVSL 382

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFN  +L+ + SA NS++YV SR L+ LA    AP+ F +T++ GVP+ A++ + LF
Sbjct: 383 LPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLF 442

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ +++   K+FN+ +++V++ G  +W+ I + +I F KA   +GI ++   + A 
Sbjct: 443 GSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAI 502

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              + AY+A  F ILI LI+ FT F   +F+   F+  YI L +++I W  ++ + K ++
Sbjct: 503 FMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLLFVIIWGVFQAMKKCRI 561

Query: 557 I-KSTDVDLYTFKEIYDREE-EEGRMKDQEKE 586
             K  D+DL +     DR++ E+ R +D   +
Sbjct: 562 FWKVEDIDLDS-----DRKDIEDIRWEDDSPK 588

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  294 bits (752), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 178/516 (34%), Positives = 278/516 (53%), Gaps = 15/516 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G+ +N  ++++LK RHI M                       PV  LIAY F+G L F 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
               +V    WI+                      W++S K                   
Sbjct: 196 --THKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PGA+     +    +G+F+ +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  T+  S   + SPF+VAIQNS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TEATSY-VSTSPFIVAIQNS 369

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++TS+ GVPY A+  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A      AY++ FF I+I +I+ FT F   KF+  +F+  YI + ++I  W  ++ I+
Sbjct: 490 FKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586
           + + I K  DVD+ +     DR + E  + +D E +
Sbjct: 549 RCRFIWKIEDVDIDS-----DRRDIEAIVWEDHEPK 579

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  294 bits (752), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 277/511 (54%), Gaps = 13/511 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           ++T++++ LK RHI M                       PV  LIAY F+G +V++    
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++SR++ PA G + GY Y F + I    +++    VI++W ++ 
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK- 216

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI+                      W++S K                       
Sbjct: 217 -VPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQG 274

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR   A      +    + +F+ +VA  + + F+Y G EL GI   EA NPRKS
Sbjct: 275 PIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKS 334

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +G+ V YNDP+L S    +   A+SPFV++I+N+G   
Sbjct: 335 VPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSA---TSYIASSPFVISIENAGTRA 391

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LPHIFNA +++ + SA NS++YVSSR LY+LA+ G APKIFA+ +  GVP+  +I++ L 
Sbjct: 392 LPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALM 451

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ + + FN+ +N+ ++ G+ +W+ I + ++ F +A + +GI +    + A 
Sbjct: 452 GLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKAR 511

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              YG+Y+A FF  +I  I+ FT F   KFD  +F T YI L +  + + G +L Y+ + 
Sbjct: 512 FMPYGSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRF 570

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
             K  D+D+ T +    RE +E   +D E +
Sbjct: 571 FWKVEDIDIDTDR----REIDEIVWEDDEPK 597

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  293 bits (749), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 185/568 (32%), Positives = 288/568 (50%), Gaps = 22/568 (3%)

Query: 30  KQNPDNFP-VKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAVPDGKDENTRLR----K 84
           K+  ++ P +KE+E+ +   EE +                      G + + R R    +
Sbjct: 14  KREANSAPTIKEKELVDAQYEEQDTSAAIAANSSIENDGA-----KGTETSPRSRGEVQR 68

Query: 85  DLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEMASY 144
            LK RHI M                       PV  LI+Y F+G +++     LGEMA++
Sbjct: 69  KLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATF 128

Query: 145 IPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVW 203
           IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW     V    W
Sbjct: 129 IPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW--THAVPLAAW 186

Query: 204 ITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRYW 263
           I                        ++S K                        +GFRYW
Sbjct: 187 IVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYW 246

Query: 264 RDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKL 323
           R+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK+VP+AIK 
Sbjct: 247 RNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKK 306

Query: 324 TVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNA 383
            V RI+VFY+ ++F +G+ V YNDP+L  + G  +SA  SPF+++I+NSG +VLP IFNA
Sbjct: 307 VVIRILVFYILSLFFIGLLVPYNDPKL-DSDGTFVSA--SPFMISIENSGTKVLPDIFNA 363

Query: 384 CVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMN 443
            VL+ +FSA NS++Y+ SR LY+L+ +  APK  +  +R GVPY A++L+ LF  LA++ 
Sbjct: 364 VVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLE 423

Query: 444 VSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAY 503
            S+GS K FN+ +N+  + G  +W+ I   +I F +A + +GI +    Y A    + AY
Sbjct: 424 TSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAY 483

Query: 504 FALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVI-KSTDV 562
           +A FF  LI LI+ FT F    F    F+  YI + ++ I W  ++L +K ++I K  D+
Sbjct: 484 YASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDI 542

Query: 563 DLYTFKEIYDREEEEGRMKDQEKEERLK 590
           D+ + +    RE EE    + E + R +
Sbjct: 543 DIDSDR----REIEEQVWIEPECKTRWQ 566

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  293 bits (750), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/527 (33%), Positives = 273/527 (51%), Gaps = 21/527 (3%)

Query: 71  AVPDGKDE------NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAY 124
           A  DG DE       T++++ LK RHI M                       PV  LIAY
Sbjct: 75  AESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAY 134

Query: 125 AFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183
            F+G ++++    LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++
Sbjct: 135 IFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIS 194

Query: 184 AAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXX 243
               VIQYW     V    WI                       W++ F           
Sbjct: 195 VIGQVIQYW--TKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIA-FVKVLAIVGYLI 251

Query: 244 XXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELT 303
                     +   +GFRYWR PGAF     +     GKF+ +VA  + + F+Y G EL 
Sbjct: 252 YALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELV 311

Query: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 363
           GI   EA NPRK+VP+AI   V+RI++FY+ ++F +GM + YND RL     +    A+S
Sbjct: 312 GITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASS 368

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           PFV++I+N+  +VLP IFNA V+V V SA NS++YV SR LYALA+ G APK F+  +R+
Sbjct: 369 PFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRY 428

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           GVPY  ++ +     LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + 
Sbjct: 429 GVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKF 488

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
           +GI +    + A    +GAY+A FF  +I  I+ +  F    +D  TF T YI L +  +
Sbjct: 489 RGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISLILLAV 546

Query: 544 SWAGYKLIYKTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
              G +L Y+ + ++K  D+D+ T     DR E E  + + ++ + L
Sbjct: 547 LVVGCQLYYRGRFLLKLEDIDIDT-----DRREIESIVWEDDEPKTL 588

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/508 (34%), Positives = 265/508 (52%), Gaps = 14/508 (2%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           + +G+     ++++LK RHI M                       PV  LIAY F+G LV
Sbjct: 49  IANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLV 108

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           +     LGEMA++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ
Sbjct: 109 YSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQ 168

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           +W S   +    WI+                      W++S K                 
Sbjct: 169 FWTSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCG 226

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +GFRYWR+PG       A    + KF+ +V+  + + F+Y G EL GI   EA
Sbjct: 227 AGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEA 285

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRKSVP+AIK  V+RI+ FY+ ++F +G+ V YNDP+L S        AASPF+++IQ
Sbjct: 286 ANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY---VAASPFIISIQ 342

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSG  +LPHIFNA +L  + SA NS++YV SR ++ L+    AP+I ++T++ GVP+ ++
Sbjct: 343 NSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSV 402

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           I + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I ++ F +A   +GI +  
Sbjct: 403 IFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDD 462

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
             + A      AY+A+FF  LI +I+ FT F    FD   F+  YI   ++I  W  ++L
Sbjct: 463 LPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQL 521

Query: 551 IYKTKVI-KSTDVDLYTFKEIYDREEEE 577
            ++ ++I K  DVD+ T     DR + E
Sbjct: 522 WFRCRLIWKIEDVDIDT-----DRRDIE 544

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/518 (32%), Positives = 275/518 (53%), Gaps = 14/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G+ +N  ++++LK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V    WI+                      W++S K                   
Sbjct: 196 TYA--VPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PGA+     +    + +F+ +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L S    +   + SPF++AI+NS
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSA---TSYVSTSPFIIAIENS 369

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA +L  + SA NS++YV SR L+ L+    APK F+KT++ GVPY A+  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + +F  LAYM  S+G  K+F + +N+  + G  +W+ I + +I F +A + +GI + +  
Sbjct: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A      AY+A FF ++I LI+ FT F    F+   F+  YI + +++  W  ++LI+
Sbjct: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIF 548

Query: 553 KTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + + V K  DVD+ +     DR + E  + ++ + + L
Sbjct: 549 RCRFVWKIEDVDIDS-----DRRDIEAIVWEEPEPKTL 581

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  291 bits (744), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 179/520 (34%), Positives = 277/520 (53%), Gaps = 14/520 (2%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           +     +   +++ LK RH+SM                       PV  LI+Y F+G L 
Sbjct: 39  IDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLA 98

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           F+    LGEMA++IP+   FT +  R++ PALG A GY Y F + I    +L+    +IQ
Sbjct: 99  FFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQ 158

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW     V    WI                       W++  K                 
Sbjct: 159 YWTLG--VPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCG 216

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +GFRYWR+PG + +   + +  +G+F+ +V+  V + F+Y G EL G+   E+
Sbjct: 217 AGKTGP-VGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGES 275

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK+VPKAI+    RI++FY+ ++F +G+ V +NDP+L ST   S   A+SPF++AIQ
Sbjct: 276 ANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYS---ASSPFIIAIQ 332

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSG   LP IFNA +L  + SA NS++YV SR LY LA +G APKI  + +R GVPY  +
Sbjct: 333 NSGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICV 392

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            +  LF  L Y++VSSGSAK F++ +N+ ++ G  +W+ I + +I F +A + QGI +  
Sbjct: 393 GIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDD 452

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
             + A    +GAY+A FF +LI +I+ FT F   KF+   F   Y+ + ++I  W  +++
Sbjct: 453 LPFKAKLMPWGAYYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQV 511

Query: 551 IYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           I+K+++I K  DVD+ +     DR E E  + + ++   L
Sbjct: 512 IFKSRLIHKVEDVDIDS-----DRREIEAEVWEDDEPTNL 546

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  292 bits (747), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 267/519 (51%), Gaps = 24/519 (4%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            L++ LK+RH+ +                       P  + I+Y  +  +++  M  +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 141 MASYIP-----LDGFTSY-ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
           M  Y+P      +GF +Y   +YVD +LGFA  + Y + Y IL   + TAA+ V++YW +
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              V    WIT                      W +S K                   PN
Sbjct: 194 S--VPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPN 251

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYT-GIELTGIVCSEAEN 312
           HDRLGFRYW++PG F  +   I GG  G F+      +   F++  G E+  +  SE E+
Sbjct: 252 HDRLGFRYWQNPGGFAHH---IRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVED 308

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQN 371
            R+++ KA +  V+R++ FY+     + + VAYNDP L +   ++   A +SPFV+ IQN
Sbjct: 309 QRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQN 368

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +GI+VLPHI NAC+L   +SA N+ ++ SSR+L  +A +G+AP+IFAK +RWGVPY A+ 
Sbjct: 369 AGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVG 428

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           LS     LAY+N SS +A +FN+F N+  + G + WI + I YI F KA    G+ +S+ 
Sbjct: 429 LSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRL 487

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y A G  Y  Y+ L    +I L   + VF+   +D K F+  YI LPV+ + W G++ +
Sbjct: 488 PYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHR-V 546

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
           Y+ K+        +T K     EE +     +E EE+ +
Sbjct: 547 YRRKI--------FTLKWWKSIEEIDVVTGVEEIEEKTR 577

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  293 bits (749), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 178/561 (31%), Positives = 274/561 (48%), Gaps = 41/561 (7%)

Query: 10  TSTSPRNSSSLDS--DHDAYYSKQNPD-----NFPVKEQEIYNIDLEENNVXXXXXXXXX 62
           +S S  N    D+  D D    K + D     N  + E+ + ++DLE++           
Sbjct: 45  SSGSRNNHQRYDNEKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKS----------- 93

Query: 63  XXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 122
                      DG +E  +L++ L++RH+ +                       P  + I
Sbjct: 94  --------PSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFI 145

Query: 123 AYAFVGLLVFYTMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFI 176
           +Y  +  +++  M  LGEM  ++P DG  S  S      RYVD +LGFA G+ Y + Y I
Sbjct: 146 SYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVI 205

Query: 177 LPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXX 236
           L   + TAA+ V++YW +   V  GVWIT                      W +S K   
Sbjct: 206 LVAAECTAASGVVEYWTTA--VPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILC 263

Query: 237 XXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFS 296
                           P HDRLGFRYW+ PGAF  + T   G  G F       +   F+
Sbjct: 264 IVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFA 321

Query: 297 YT-GIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-- 353
           +  G EL  +  +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   
Sbjct: 322 FILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALA 381

Query: 354 KGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKA 413
           +GK   A +SPFV+ IQN+GI+VLPHI N C+L   +SA N+ ++ S+R+L  +A  G+A
Sbjct: 382 QGKP-GAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQA 440

Query: 414 PKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIV 473
           PK   K +RWGVPY A+  S L   LAY+NVSS +A +FN+F N+ ++ G L WI   I 
Sbjct: 441 PKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIA 500

Query: 474 YIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFIT 533
           Y+ F KA    G+   +  +   GQ Y  +F+L    +I +   + +F+   +    FI 
Sbjct: 501 YLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIA 559

Query: 534 GYIGLPVYIISWAGYKLIYKT 554
            Y+ LP++++ W G+KL  +T
Sbjct: 560 AYVTLPIFLVLWLGHKLYTRT 580

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  291 bits (746), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 186/592 (31%), Positives = 298/592 (50%), Gaps = 33/592 (5%)

Query: 13  SPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXX---XXXXXXXXXXXXX 69
           S RN  S +S+ D   S  + DNF + E  I + D ++N++                   
Sbjct: 10  SKRNEDSTESNDD---STTSYDNFEIIE--IQHNDSKDNSIKKKIPNSELASLTHAYSRS 64

Query: 70  FAVPDGKD-------ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 122
              P+  +       E+ +++++LK RHI M                       PV  LI
Sbjct: 65  RVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALI 124

Query: 123 AYAFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 181
           AY F+G +V++    LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +
Sbjct: 125 AYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVE 184

Query: 182 LTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXX 241
           ++    VIQYW   D V    WI                       W++  K        
Sbjct: 185 ISVVGQVIQYW--TDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYL 242

Query: 242 XXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTA----ITGGK--GKFVSFVAVFVYSLF 295
                           +GFRYWR+PGA+    T+    I   K  G+F+ +VA  + + F
Sbjct: 243 LYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAF 302

Query: 296 SYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKG 355
           +Y G EL GI   EA NPRK+VP+AI   V+RI++FY+ ++F +G+ V + D RL     
Sbjct: 303 TYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SD 359

Query: 356 KSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPK 415
            +   A+SPFV++I+N+G ++LP IFNA V+V V SA NS++YV SR LY+LA    APK
Sbjct: 360 DTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPK 419

Query: 416 IFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYI 475
           IFA+ +R GVP+  +I + L   LA++ V + +   FN+ V++ ++ G+ +W+ I + ++
Sbjct: 420 IFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHV 479

Query: 476 YFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGY 535
            F +  + +GI +    + A    +G+Y+A F+  +I  ++ F  F  H FD  TF T Y
Sbjct: 480 RFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPH-FDVTTFFTDY 538

Query: 536 IGLPVYIISWAGYKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
           I L +  + + G +L Y+ + + K  DVD+ + +    RE E+   +D E +
Sbjct: 539 ISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDR----REIEDAIWEDDEPK 586

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  289 bits (740), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/516 (32%), Positives = 268/516 (51%), Gaps = 14/516 (2%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           KDE   +++DL  RHI+M                       PV  LIAY F+G +V+   
Sbjct: 54  KDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVT 113

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGEMA++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W  
Sbjct: 114 QSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF 173

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              V    WI+                      W++  K                     
Sbjct: 174 A--VPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT 231

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +GFRYWR+PG +     +    + +F+ + +  + + F++ G EL GI   EA NPR
Sbjct: 232 GP-VGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPR 290

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           ++VPKAI+  V+RI+VFY+ ++F +G+ V Y+D +L   K ++   ++SPF++AI+NSG 
Sbjct: 291 QTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGT 347

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           ++LPHIFN  +LV + SA NS++Y+ SR L+ LA +G  PK+FAKT++ GVP  A++ + 
Sbjct: 348 KILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTS 407

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           LF  LA+M  S+G  + F + +NVV + G  SW+ I   +I F +  +++GI ++   + 
Sbjct: 408 LFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFK 467

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
           A    Y AY+A    I+I   + FT F   KFD   F   YI + ++ I W  ++L +K 
Sbjct: 468 AKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKC 526

Query: 555 K-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + V K  D+D+       DR E E R+        L
Sbjct: 527 RYVWKLVDIDIDK-----DRREIEDRVWQDTTPANL 557

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  290 bits (741), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 176/528 (33%), Positives = 272/528 (51%), Gaps = 26/528 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D K E  +L++ L ARHI +                       P  + I+Y  +  +++ 
Sbjct: 49  DAKLEG-KLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 134 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            M   GEM  Y+P +G  S  S      RYVDP+L FA G+ Y + Y IL   + TAA+ 
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
           V++YW   D V    WIT                      W +S K              
Sbjct: 168 VVKYW--TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFIL 225

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYT-GIELTGI 305
                PNHDRLGFRYW++PG F  +   ITGG  G F+   +  +   F++  G EL  +
Sbjct: 226 FWGGGPNHDRLGFRYWKNPGGFAHH---ITGGNLGNFLDVYSGIIKGAFAFILGPELIAL 282

Query: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAAS 363
             SE ++ R+++ KA K  V+R++ FY+     + + VA NDP L S    GK   A +S
Sbjct: 283 ASSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKP-GAGSS 341

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           PFV+ IQN+GI++LPHI NAC+L   +SA N+ ++ SSR+L  +A +G+APKIF K +R+
Sbjct: 342 PFVIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRF 401

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           GVP+ A+  S L   LAY+NVSS +A +F +F N+ ++ G + W   L+ Y+ F KA + 
Sbjct: 402 GVPWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKY 461

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
            G++ ++  Y    Q+Y  ++++    L+     + VF+   ++   FI  YI LP++++
Sbjct: 462 NGLE-NRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVV 520

Query: 544 SWAGYKLI---YKTKVIKSTDVDLYT-FKEIYDREEEEGRMKDQEKEE 587
            W G+K+    +K       ++D+ T   EI    EE  R+ D+E+ E
Sbjct: 521 LWIGHKIYTRDFKKWWYPVEEIDVVTGLTEI----EERTRILDEERVE 564

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  290 bits (743), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 173/530 (32%), Positives = 271/530 (51%), Gaps = 21/530 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G +E  +L++ L++RH+ +                       P  + I+Y  +  +++ 
Sbjct: 102 EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 161

Query: 134 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            M  LGEM  ++P DG  S  S      RYVD +LGFA G+ Y + Y IL   + TAA+ 
Sbjct: 162 IMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASG 221

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
           V++YW +   V  GVWIT                      W +S K              
Sbjct: 222 VVEYWTTA--VPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFIL 279

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIV 306
                PNHDRLGFRYW+ PGAF  + T   G  G F       +   F++  G EL  + 
Sbjct: 280 FWGGGPNHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMT 337

Query: 307 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASP 364
            +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +GK   A +SP
Sbjct: 338 SAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKP-GAGSSP 396

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           FV+ IQN+GI+VLPHI N C+L   +SA N+ ++ S+R+L  +A  G+APK   + +RWG
Sbjct: 397 FVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWG 456

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
           VPY A+ +S L   LAY+NVSS +A +FN+F N+ ++ G L W+   I Y+ F KA    
Sbjct: 457 VPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYN 516

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIIS 544
           G+   +  +   GQ Y  + +L    +I L   + +F+   +    FI  YI LP++++ 
Sbjct: 517 GL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVL 575

Query: 545 WAGYKLIYKTKV---IKSTDVDLYT-FKEIYD--REEEEGRMKDQEKEER 588
           W G+KL  +T     +  +++D+ T   EI +  RE EE R+     +++
Sbjct: 576 WFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDK 625

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  289 bits (740), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 170/516 (32%), Positives = 274/516 (53%), Gaps = 15/516 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G+ +N  ++++LK RHI M                       PV  LI+Y F+G L + 
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
             +  V    WI+                      W++S K                   
Sbjct: 196 TYK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PGA+     +    +G+F+ +V+  + + F++ G EL GI   EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRKSVP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +   +   + SPF++AI+NS
Sbjct: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENS 369

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ GVPY A+ +
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFV 429

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           +  F  LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  
Sbjct: 430 TAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A      AY+A  F  +I +I+ FT F   KF+  +F   YI + +++  W  ++ I+
Sbjct: 490 FKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIF 548

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586
           + + I K  DVD+ +     DR + E  + +D E +
Sbjct: 549 RCRFIWKIGDVDIDS-----DRRDIEAIVWEDHEPK 579

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  289 bits (740), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 182/586 (31%), Positives = 294/586 (50%), Gaps = 25/586 (4%)

Query: 9   FTSTSPRNSSSLDSDHDAYYSKQNPDNFPVK---EQEIYNIDLEENNVXXXXXXXXXXXX 65
            ++T+   +   DSD D   S++       K   +Q  YN+ + +N+             
Sbjct: 25  LSTTASNTNKKYDSDTDMEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSDTE 84

Query: 66  XXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYA 125
                    G  ++TR+++ LK RHI M                       PV  LIAY 
Sbjct: 85  EA-------GHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYI 137

Query: 126 FVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184
           F+G ++++    LGEMA++IP+    T ++ R++ PA G   GY Y F + I    +++ 
Sbjct: 138 FMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISV 197

Query: 185 AALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXX 244
              VIQYW   D V    WI                       W++S K           
Sbjct: 198 VGQVIQYW--TDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYA 255

Query: 245 XXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTG 304
                    +   +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL G
Sbjct: 256 LVIVCGGS-SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVG 314

Query: 305 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 364
           I   EA NPRKSVP+AI   V+RI +FY+ ++F +G+ V YND  L  + G S   A+SP
Sbjct: 315 ITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL--SSGDSY-IASSP 371

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           FV++IQN+G   LP IFNA V++ + SA NS++YV SR LYALA  G APK FA  ++ G
Sbjct: 372 FVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHG 431

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
           VP+  +I++     LA++ V++ +   FN+ +N+ ++ G+ +W  I + +I F +A + +
Sbjct: 432 VPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYR 491

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIIS 544
           GI +    + A    +GAY++ FF  +I  I+ F  F    +D  TF T YI L + ++ 
Sbjct: 492 GISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVV 549

Query: 545 WAGYKLIYKTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + G +L Y+ + ++K  D+D+ T     DR E E  + + ++ + L
Sbjct: 550 FIGCQLYYRCRFLLKVEDIDIDT-----DRREIEAIIWEDDEPKNL 590

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  288 bits (738), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 176/520 (33%), Positives = 265/520 (50%), Gaps = 14/520 (2%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           V +G+     +++ LK RHI M                       PV  LIAY F+  LV
Sbjct: 67  VKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLV 126

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           +  +  LGEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I+
Sbjct: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           +W +   V    WIT                      W++  K                 
Sbjct: 187 FWTTA--VPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA
Sbjct: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRKSVP+AIK  V+RI+VFY      +G+ V YNDP+L          ++SPF++AI+
Sbjct: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIE 360

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSG +VLPHIFNA VL  + SA NS++YV SR +Y LA    AP  F +T+  GVPY A+
Sbjct: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
             +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A + +GI +  
Sbjct: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
             + A    + AY+ALFF ++I LI+ FT F    F    F   Y+ + ++I  W G ++
Sbjct: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQI 539

Query: 551 IYKTKVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERL 589
            ++ ++    D VD+ T     DR + E  + D E  + L
Sbjct: 540 WFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL 574

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  288 bits (737), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/514 (33%), Positives = 270/514 (52%), Gaps = 15/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E+  +++ LK RHI M                       PV  LI+Y F+G +V++    
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW   D
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYW--TD 220

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           +V   VWI                       W++S K                    +  
Sbjct: 221 KVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQG 279

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 280 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 339

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +G+ V YN+PRL ++   S   A+SPFV++IQN+G   
Sbjct: 340 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSAS---SAVIASSPFVISIQNAGTYA 396

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   ++ GVPY  ++ +   
Sbjct: 397 LPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 456

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   +GI +    + A 
Sbjct: 457 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAK 516

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              YGAY+A FF  +I  I+ F  F    F    F T YI L +  + + G +L YK + 
Sbjct: 517 LMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKCRF 574

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           I K  D+D+ T     DR E E  + + ++ + L
Sbjct: 575 IWKLEDIDIDT-----DRREIEAIIWEDDEPKNL 603

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  288 bits (738), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/504 (33%), Positives = 261/504 (51%), Gaps = 16/504 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
              N  L++ LK+RHI +                       P  + I+Y  +   V+  M
Sbjct: 90  SSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIM 149

Query: 136 ACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
             LGEM  ++P +G  S  S      +YVDP+LGFA  + Y + + IL   +++AA+ VI
Sbjct: 150 NALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVI 209

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW   + V  G WIT                      W +S K                
Sbjct: 210 EYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFW 269

Query: 250 XXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVC 307
              P  D  LGFRYW++PG+F  + T   GG G F+      +   FS   G EL  +  
Sbjct: 270 GGGPKSDGILGFRYWKNPGSFAHHITG--GGGGNFLDIYTGIIKGGFSVILGPELVCLTS 327

Query: 308 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA-ASPFV 366
           SE  + R+++ KA K  V+R++ FY+     +G+ VAYNDP L +   +S + A +SPFV
Sbjct: 328 SECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFV 387

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           + IQN+GI  +PHI N C+L   +SA N+ ++ SSR+L  +A +G APKIF + ++ GVP
Sbjct: 388 IGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVP 447

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
           Y A+  S+L   LAY+NVSS +A +FN+F N+ ++ G + WI   + YI F KA     +
Sbjct: 448 YTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKL 507

Query: 487 DKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWA 546
              +  + A GQ+Y  +++LF+  LI L   + +F+   ++ K FI  YI LP++I+ W 
Sbjct: 508 TH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWI 566

Query: 547 GYKLIYKTKV---IKSTD-VDLYT 566
           G+K+  +T +   ++  D +D+YT
Sbjct: 567 GHKVFTRTLLKAWLRPIDKIDVYT 590

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  285 bits (730), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 164/485 (33%), Positives = 258/485 (53%), Gaps = 8/485 (1%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G    T +++ LK RHISM                       PV  LIAY F+G +V++
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    ++     VIQYW
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
              D V    WI                       W++S K                   
Sbjct: 168 --TDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS 225

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            +   +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA N
Sbjct: 226 -HQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 284

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP+AI    +RI+ FY+ ++F +G+ V Y+D RL +T   +   A+SPFV++IQN+
Sbjct: 285 PRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNT---TAVIASSPFVISIQNA 341

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA V++ + SA NS++YV SR LY+LA+ G APK F   ++ GVPY  +I+
Sbjct: 342 GTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIV 401

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + L   LA++ V++ + + FN+ VN+ ++ G+ +W+ I + ++ F +  + +GI +    
Sbjct: 402 TALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLP 461

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    +GAY+A FF  +I +I+ F  F   KF    F T YI L +  + + G +L Y
Sbjct: 462 FKAKLMPWGAYYAAFFIGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLFY 520

Query: 553 KTKVI 557
           + + I
Sbjct: 521 RCRFI 525

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  285 bits (730), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/488 (35%), Positives = 253/488 (51%), Gaps = 9/488 (1%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G  E  +++++LK RHI M                       PV  LIAY F+G LVF  
Sbjct: 95  GVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSV 154

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W 
Sbjct: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            +  V    WI+                      W++S K                    
Sbjct: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR PG +     +    + +F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RKSVP+AIK    RI++FY+ ++F +G+ V YNDP+L ST       +ASPF++AIQNSG
Sbjct: 332 RKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSY---VSASPFIIAIQNSG 388

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
            +VLPHIFNA +L  + SA NS++YV SR LY L+    APK F KT R GVP+ A++ +
Sbjct: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
             F  LAYM  S+G    FN+ +N+  + G  +W++I I +I F +  + +G+ +    Y
Sbjct: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A      AY+  FF  LI LI+ FT F   KFD   F+T YI   +++  +   +  ++
Sbjct: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566

Query: 554 TKVIKSTD 561
           T++ ++ D
Sbjct: 567 TRLWRTLD 574

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  285 bits (730), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 168/511 (32%), Positives = 265/511 (51%), Gaps = 15/511 (2%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            +++ LK RHI M                       PV  LIAY F+G ++++    LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 141 MASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           MA++IP+    T ++ R++ PA G + GY Y F + I    +++    VIQYW   D+V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYW--TDKVP 222

Query: 200 PGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLG 259
              WI                       W++S K                    +   +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 260 FRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
           FRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK+VP+
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPH 379
           AI   V+RI++FY+ ++F +G+ V YN+PRL      S   A+SPFV++IQN+G   LP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALPD 398

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGL 439
           IFNA VL+ V SA NS++YV SR LY+LA  G APK F   ++ GVPY  ++ +     L
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 440 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 499
           A++ V++ +   FN+ +++ ++ G+ +W+ I + +I F +A + +GI +    + A    
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 500 YGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVI-K 558
           YGAY+A FF  +I  I+ F  F    F    F T YI L +  + +   +L YK + I K
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 559 STDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
             D+D+ +     DR E E  + + ++ + L
Sbjct: 577 LEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 174/519 (33%), Positives = 268/519 (51%), Gaps = 22/519 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L++ LK+RHI M                       P  + I+Y  +  +V+  M   GEM
Sbjct: 77  LQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM 136

Query: 142 ASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
             Y+P +G  +  S      RYVD +LGFA  + Y + Y IL   + TAA+ V++YW   
Sbjct: 137 VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTVA 196

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V  GVWI                       W +S K                   PNH
Sbjct: 197 --VPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNH 254

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCSEAENPR 314
           DRLGFRYW+ PGAF E+   + GG G+F+   +  +   F++  G EL  +  +E E+ R
Sbjct: 255 DRLGFRYWQRPGAFTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQR 312

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNS 372
           +++ KA +  ++R++ FY+     + + VAYNDP L+S    GK   A +SPFV+ IQN+
Sbjct: 313 RNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKP-GAGSSPFVIGIQNA 371

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           GI VLPHI NAC+L   +SA N+ ++ S+R+L  +A +G AP++F K +R+GVPY A+ L
Sbjct: 372 GIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISL 431

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S     LA++NVSS +A +FN+F N+ ++ G + WI   + YI F KA    G+   +  
Sbjct: 432 SGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLP 490

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           +   GQ Y  Y++LF   LI L   +  F+   +    F+  YI LP++++ W G+KL  
Sbjct: 491 FKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWT 550

Query: 553 KT---KVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEE 587
           +T   +  +  D +D+ T   + D EE   ++ D+ + E
Sbjct: 551 RTFTKRWWRRVDQIDVTT--GLVDIEERT-KILDETRVE 586

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  285 bits (728), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 176/531 (33%), Positives = 273/531 (51%), Gaps = 25/531 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L+K L++RHI +                       P  +L +Y  + L+++  M  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 142 ASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
             ++P     S  S      RY DP+LGFA G+ Y + Y IL   + TAA+ V+ YW + 
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V  G WI                       W +  K                   P H
Sbjct: 225 --VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCSEAENPR 314
           DRLGFRYW+ PGAF  + T  TG  G+F+      +   F++  G EL  I  SEA + R
Sbjct: 283 DRLGFRYWQHPGAFAYHIT--TGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNS 372
           +++ KA +   YR++ FY+ +   +G+ V+  DP L +   +GK+  A +SPFV+AIQN+
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKA-GAGSSPFVIAIQNA 399

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I+VLPHI NAC+L   +S+ NS ++ +SR+L ++A DG AP+I  + +R GVPY A+ L
Sbjct: 400 HIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVAL 459

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S  F  LA++NVSSGSAK F +F N+ ++ G + WI I + Y+ F KA   +G+ + +  
Sbjct: 460 SAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYE-RVP 518

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL-- 550
           + +P Q YG YF +    LI L   +  F+   ++   F+  YI LP++++ W G+K+  
Sbjct: 519 FKSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYT 576

Query: 551 -IYKTKVIKSTDVDLYT-FKEIYDREEEEGRMKDQEKEERLKSNGKNMEWF 599
             + T ++   +VD+ T   EI    EEE ++ D ++     +  K  +W 
Sbjct: 577 RTWSTWLLPVAEVDVTTGLAEI----EEETKILDAQRIPPANAWQKFEQWL 623

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  284 bits (727), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 269/514 (52%), Gaps = 15/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E+  +++ LK RHI M                       PV  LIAY F+G +V++    
Sbjct: 102 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQS 161

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW   D
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYW--TD 219

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           +V    WI                       W++S K                    +  
Sbjct: 220 KVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQG 278

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 279 PIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +G+ V YND RL ++   S   A+SPFV++IQN+G   
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSAS---SAVIASSPFVISIQNAGTYA 395

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   +R GVPY  ++ +   
Sbjct: 396 LPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAAL 455

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A + +GI +    + A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAK 515

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              YGAY+A FF  +I  I+ F  F    F    F T YI L +  + + G ++ YK + 
Sbjct: 516 LMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRF 573

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           I K  D+D+ +     DR E E  + + ++ + L
Sbjct: 574 IWKLEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  284 bits (726), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 173/514 (33%), Positives = 269/514 (52%), Gaps = 15/514 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E+  +R+ LK RHI M                       PV  LIAY F+G +V++    
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW ++ 
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK- 220

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V  GVWI                       W++S K                       
Sbjct: 221 -VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQG 278

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK+
Sbjct: 279 PIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI++FY+ ++F +G+ V Y DPRL ++   S   A+SPFV++IQN+G   
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSAS---SAVIASSPFVISIQNAGTYA 395

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA VL+ V SA NS++YV SR LY+LA  G APK F   ++ GVPY  ++ +   
Sbjct: 396 LPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAAL 455

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   +GI +    + A 
Sbjct: 456 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAK 515

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              YGAY+A FF  +I  I+ F  F    F    F T YI L +  + + G +L YK + 
Sbjct: 516 FMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRF 573

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           I K  D+D+ +     DR E E  + + ++ + L
Sbjct: 574 IWKLEDIDIDS-----DRREIEAIIWEDDEPKNL 602

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  283 bits (723), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 164/503 (32%), Positives = 264/503 (52%), Gaps = 13/503 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            E   +++ LK RHI M                       PV  LI+Y F+G +++    
Sbjct: 61  QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 137 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            LGEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+    VIQYW   
Sbjct: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYW--T 178

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           + V    WI                        ++S K                    + 
Sbjct: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +GFRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPRK
Sbjct: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P+AIK  V RI+VFY+ ++F +G+ V YNDP+L S     +  ++SPF+++I+NSG +
Sbjct: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDS---DGIFVSSSPFMISIENSGTK 355

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  +R GVPY +++ + +
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LA++ VS+GS K FN+ +N+  + G  +W+ I   +I F +A R +GI +    Y A
Sbjct: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               + AY+A FF  LI LI+ FT F    F    F+  YI + +++  W  +++ +K +
Sbjct: 476 QMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534

Query: 556 VI-KSTDVDLYTFKEIYDREEEE 577
           ++ K  D+D+ +     DR + E
Sbjct: 535 LLWKLQDIDIDS-----DRRQIE 552

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  282 bits (722), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 167/518 (32%), Positives = 272/518 (52%), Gaps = 13/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G    T +++ LKARHISM                       PV  LIAY F+G +V+ 
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I YW
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
            S   V  G WIT                      W++S K                   
Sbjct: 172 TSV--VPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            +   +GFR WR+PG +     +    + +F+ +V+  + + F+Y G EL GI   E++N
Sbjct: 230 -SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 288

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VPKAI    +RI+ FY+ ++F +G+ V YNDPR+ +T    ++A  SPFV++I+N+
Sbjct: 289 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNA--SPFVISIRNA 346

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G ++LP IFNA VLV V SA NS++Y+ SR +Y+LA  G APK F   +R GVP   +++
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + L   +A++ V++ +   FN+ VN+ ++ G+ +W+ I + +I F +  + +GI +    
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    + AY+A  F  +I  I+ +T F   KFD   F T YI L + ++ + G ++ Y
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYY 525

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           K + + K  D+D+ T     +R E +  + + ++ + L
Sbjct: 526 KCRFLWKLEDIDIDT-----NRREIDAIVWEDDEPKNL 558

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  281 bits (718), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 170/509 (33%), Positives = 263/509 (51%), Gaps = 14/509 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E   +R++LK RH+ M                       PV  LIAY F+  L +     
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+   FT ++ R+V PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW--TF 140

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            V    WI+                      W++  K                       
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR PGAF     A    + +F+ +V+  + + F++ G EL GI   EA NPRK+
Sbjct: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AIK  V+RI+ FY+ ++F +G+ V Y+D +L ST       +ASPF++AI+NSG  V
Sbjct: 260 VPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSY---VSASPFIIAIENSGTHV 316

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LPHIFNA ++  + SA NS++YV SR +Y L+    AP I ++T++ GVP+ A++++ LF
Sbjct: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LAYM  S+G  K FN+ +N+  + G  +W+ I + +I F +A   +GI +    + A 
Sbjct: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
                AY+ +FF  LI +I+ FT F    ++   F+T YI + ++I  W  ++  ++ ++
Sbjct: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQE 584
           I +  DVD+ T +    R  EE    +QE
Sbjct: 495 IWRVEDVDIDTDR----RAVEEAVWIEQE 519

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  282 bits (722), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 155/489 (31%), Positives = 263/489 (53%), Gaps = 8/489 (1%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G  ++  +++ LK RHISM                       PV  LIAY F+G + ++
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT +  R++ PA G A GY Y F + I    +L+    +IQ+W
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V  G WI                       W++  K                   
Sbjct: 194 TFA--VPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 251

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   E++N
Sbjct: 252 -KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PR++VP+AI    +RI+ FY+ ++  +G+ V +NDP+L   K +    ++SPFV+AI+NS
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENS 367

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLPHIFNA +L  + SA NS++YV SR LY LA +  APK+FA+ ++ GVPY +++ 
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           +  F  LAY+N+S+ + K+F++ +N+ ++ G  +W+ I + +I F +  + + + ++   
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    +GAY++ FF  LI +I+ FT F   KF+   F   YI + +++  W  +++ +
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 553 KTKVIKSTD 561
           +T+ I + +
Sbjct: 547 RTRFILTKN 555

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  281 bits (719), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 168/518 (32%), Positives = 270/518 (52%), Gaps = 15/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
            G   N  +++ LK RH+SM                       PV  LI+Y F+G + + 
Sbjct: 46  SGHGRNA-VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYC 104

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT +  R++   LG A GY Y F + +    +L+    +I+YW
Sbjct: 105 VTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYW 164

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
            S   V    WI                       W++  K                   
Sbjct: 165 TSA--VPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAG 222

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PG + +   +    +G+F+ +V+  V + F+Y G EL GI   E+ N
Sbjct: 223 KTGP-VGFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESAN 281

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VPKAI    +RI++FY+ ++F +G+ V +ND +L S+   S   A SPF++AIQNS
Sbjct: 282 PRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYS---AGSPFIIAIQNS 338

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G ++LP IFNA +L  + SA NS++YV SR LY LA +  AP+ FA+T+R GVP  A++ 
Sbjct: 339 GTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLF 398

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
              F  L Y++VS+G++K F++ +N+ ++ G  SW+ I + ++ F +A + QGI +    
Sbjct: 399 VANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLP 458

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    +GAY++ FF  LI +I+ FT  L   F+   F   YI + ++++ WA ++  Y
Sbjct: 459 FKAKLMPWGAYYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWY 517

Query: 553 KTKVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERL 589
           +T++I   + VD+ +     DR E + +  D  +   L
Sbjct: 518 RTRIIHRIEHVDIDS-----DRREVDAQQWDNTEPTTL 550

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  282 bits (722), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 170/512 (33%), Positives = 270/512 (52%), Gaps = 15/512 (2%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           GK  +T++++ LK RH+ M                       PV  LIAY F+G +V++ 
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+    T +  R++ PALG + GY Y F + I    +L+    +IQYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            +  V    WI                       W+SS K                    
Sbjct: 215 YK--VPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR   AF +   +    + +F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 272 RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VP+AI   ++RI +FY+ ++F +G+ V YND RL  + G ++  A+SPFV+++ N+G
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL--SDGSAI-IASSPFVISMLNAG 388

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
              LP IFNA +L+ V SA NSD+Y++SR LYALA  G APK F   +R+GVPY  + ++
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            L   LA++ VS+ +   FN+ +N+ ++ G+ +W  I   +I F +A + +GI +    +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A    +GAY+A FF  LI  I+ +  F    +D K+F T YI L ++ + + G  + Y+
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYR 566

Query: 554 TK-VIKSTDVDLYTFKEIYDREEEEGRMKDQE 584
            + +IK  D+D+ T     DR+E E  + +++
Sbjct: 567 GRLLIKIEDIDIDT-----DRKEVEAYVWEED 593

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  280 bits (715), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 165/494 (33%), Positives = 261/494 (52%), Gaps = 9/494 (1%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           + +  L++  K RH+ M                       P ++LIA+ F G L+   + 
Sbjct: 41  ESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLM 100

Query: 137 CLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            L EMAS+ P+D  F+ YA+RYVDPALGFA G+ Y  KY I   ++L+A  L++QYW  R
Sbjct: 101 SLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYW--R 158

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           + ++  ++I                       W +  K                   P+ 
Sbjct: 159 EDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSK 218

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           + +GFRYWR+  AF  Y   + G  G+F+ + A  + S ++Y G E  G+V  EA NP+K
Sbjct: 219 ETIGFRYWREY-AFVPY--LVKGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKK 275

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A +  ++RI  FY+  V +LG+ ++ +D  L     K+  A+ SPFV+A  N+GI+
Sbjct: 276 TIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL--ANAKTSDASGSPFVIAFTNAGIK 333

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
            LP   NA +++F+ SA N+ LYV SR  Y LA DG APKIF   +R+GVP+N  +L+ L
Sbjct: 334 GLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGL 393

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              L++MN+S+ S+ IF Y  + V++FG L+W+++LI YI +++A     + + +  +  
Sbjct: 394 ISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRM 453

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
             Q Y AY  LFF  LI     ++ F+   F YK+FI  YIG+ V+I +   +K   K+ 
Sbjct: 454 WFQPYSAYVCLFFVSLIIFFNGYSAFIAG-FKYKSFIVSYIGIAVFIGNTLFWKFWKKSA 512

Query: 556 VIKSTDVDLYTFKE 569
             +  D+     +E
Sbjct: 513 ATRPEDLRSIMVEE 526

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  280 bits (716), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 169/512 (33%), Positives = 271/512 (52%), Gaps = 12/512 (2%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            +++ LK RHI M                       PV  LI+Y F+G +++     LGE
Sbjct: 65  EVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 141 MASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           MA++IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW   D V 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYW--TDAVP 182

Query: 200 PGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLG 259
              WI                        ++S K                    +   +G
Sbjct: 183 LVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIG 242

Query: 260 FRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
           FRYWR+PGA+     +    +G+F+ +V+  + + F+Y G EL GI   EA NPR++VP+
Sbjct: 243 FRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPR 302

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPH 379
           AIK  V RI+VFY+ ++F +G+ V YNDP+L  ++G  +S+  SPF+++I+NSG +VLP 
Sbjct: 303 AIKKVVVRILVFYILSLFFIGLLVPYNDPKL-DSEGTFVSS--SPFMISIENSGTKVLPD 359

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGL 439
           IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+  +  ++ GVPY A++ +  F  L
Sbjct: 360 IFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFL 419

Query: 440 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 499
           A++  S+GS K+FN+ +N+  + G  +W+ I + +I F +A + +GI +    Y A    
Sbjct: 420 AFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMP 479

Query: 500 YGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK-VIK 558
           + AY+A FF  LI LI+ FT F    F    FI  YI + ++I  W  +++ +K + V K
Sbjct: 480 FLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWK 538

Query: 559 STDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
             DVD+ + +    R+ EE    + E + R +
Sbjct: 539 LQDVDIDSDR----RDIEEQVWIEPECKTRWQ 566

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  280 bits (717), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 171/532 (32%), Positives = 263/532 (49%), Gaps = 24/532 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +D    L++ LK+RH+ +                       P  + IAY  +  +++  M
Sbjct: 69  EDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIM 128

Query: 136 ACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
             +GEM  Y+P DG  S  S      RYVD +L FA G+ Y + Y IL   + TAAA V+
Sbjct: 129 NAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVV 188

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW     V    WIT                      W +S K                
Sbjct: 189 EYWTLA--VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFW 246

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCS 308
              P+HDRLGFRYW++PGAF  + T   G  G F+   +  +   F++  G EL  +  S
Sbjct: 247 GGGPSHDRLGFRYWKNPGAFAHHVT--DGSLGNFLDIYSGIIKGAFAFILGPELVALTSS 304

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-KGKSMSAAASPFVV 367
           E  + R+++ KA K  +YR++ FY+     +G+ VA+NDP L S     +  A +SPFV+
Sbjct: 305 ECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVI 364

Query: 368 AIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPY 427
            IQN+GIEVLPHI NAC+L   +S+ N+ ++ SSR+L+ +A +G APKIF + +++GVPY
Sbjct: 365 GIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPY 424

Query: 428 NALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 487
            A+ILS L   LAY+N SS +A++F +  N+ ++ G L WI   I Y+ F KA     + 
Sbjct: 425 MAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL- 483

Query: 488 KSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAG 547
             +  +   GQ Y   ++L    +I +   +  F+   ++   FI  YI LP+++  + G
Sbjct: 484 YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVG 543

Query: 548 YKLIYKTK--------VIKSTDVDLYT-FKEIYDR--EEEEGRMKDQEKEER 588
           +K+    K             D+D+ T   EI  +  E +E R+    + ER
Sbjct: 544 HKVYNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWER 595

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 173/534 (32%), Positives = 267/534 (50%), Gaps = 23/534 (4%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G + NT L K L++RHI +                          +L+++  +  +V+  
Sbjct: 40  GSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPI 98

Query: 135 MACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
           M  L EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AAA V+ YW 
Sbjct: 99  MCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW- 157

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
             + V    WIT                      W +S K                   P
Sbjct: 158 -DNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAP 216

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIVCSEAEN 312
           NHDR GFRYW++PG F    +   G  G+F+      + S F++    EL GI C EA++
Sbjct: 217 NHDRTGFRYWKNPGPFAM--SLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQD 274

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQN 371
            R++  KA +  +YRII FY+    ++G+ ++  DP+L+ + +  +  AA+SPFV  I N
Sbjct: 275 TRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIAN 334

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +GI VL H+ N  +L   +SA NS +Y S+R + ALA +G APK   K +R+GVPYNA+I
Sbjct: 335 AGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVI 394

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +  L   LAY+NV + SA +F +  N+ ++ G + W  + I +I F +      + +S+ 
Sbjct: 395 VCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRI 453

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y  P Q Y AY+  F  +++ L   F VFL  +++   F+  Y+ LP+Y++ + G+KL 
Sbjct: 454 PYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLW 513

Query: 552 YKTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           ++T+  I    +D+ T        EEE +M       R+  N       +EKFL
Sbjct: 514 FRTRWYIPVEQIDVITG---LVEAEEESKMTP----PRIPKN------LWEKFL 554

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  282 bits (721), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 170/530 (32%), Positives = 264/530 (49%), Gaps = 21/530 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DG     RL++ L++RH+ +                       P  + I+Y  +  +++ 
Sbjct: 154 DGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 213

Query: 134 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            M  LGEM  ++P DG  S  S      RYVD +LGFA G+ Y + Y IL   + TAA+ 
Sbjct: 214 IMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASG 273

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
           V++YW +   V  GVWIT                      W +S K              
Sbjct: 274 VVEYWTTA--VPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 331

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGIV 306
                P HDRLGFRYW+ PG+F  +     G  G F       +   F++  G EL  + 
Sbjct: 332 FWGGGPKHDRLGFRYWQHPGSFAHHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMT 389

Query: 307 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASP 364
            +E  + R+++ KA +  V+R+I FY+     + + V YNDP L++   +GK   A +SP
Sbjct: 390 SAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKP-GAGSSP 448

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           +V+ IQN+GI+VLPHI N C+L   +SA N+ ++ S+R+L  +A  G+APK   K +R+G
Sbjct: 449 YVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFG 508

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
           VPY A+ +S L   LAY+NVSS +A +FN+F N+ ++ G L WI   I Y+ F KA    
Sbjct: 509 VPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFN 568

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIIS 544
           G+   +  +   GQ Y  +F+L    +I +   + +F+   ++   FI  YI LP++++ 
Sbjct: 569 GL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVL 627

Query: 545 WAGYKLIYKT-----KVIKSTDVDLYTFK-EIYDREEEEGRMKDQEKEER 588
           W G+KL  +T       +   DV     + E   R+ EE R+     +E+
Sbjct: 628 WLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEK 677

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 165/517 (31%), Positives = 266/517 (51%), Gaps = 14/517 (2%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G+  +T +++ LK RHI M                       PV MLIAY F+  + F  
Sbjct: 67  GEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSV 126

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
           M  LGEMA+YIP+   F+ ++ R++ PA G A GY Y F + I    +L+    ++QYW 
Sbjct: 127 MQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWT 186

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            +  V    WI+                      W++  K                    
Sbjct: 187 FK--VPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGK 244

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR   AF +   +    + +F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 245 TGP-VGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 303

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VPK+IK T++RI++FY+ ++  +G+ V +ND  L  ++     AA+SPF++AI+NSG
Sbjct: 304 RKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSY---AASSPFILAIKNSG 360

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
            + LP IFNA +L  V SA NSD+YV SR +Y++A +  AP I AK S+ GVPY A++ +
Sbjct: 361 TKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFT 420

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
                LAY+  SS  A +FN+ +N+  + G  SW  I   ++ F KA + +GI ++   +
Sbjct: 421 SAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPF 480

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A    + A ++ FF  LI L++ FT F  H F    F+  YI + ++ + WA +++ ++
Sbjct: 481 KASFMPWIAIYSFFFMTLIILVQGFTCFTPH-FQASDFVASYISVGLFFVIWAVFQIWFR 539

Query: 554 TK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
              ++   ++D+ T     DR + +  + + E  + L
Sbjct: 540 CPLLVPIAEIDIDT-----DRRDVDAEVWEDEPPKTL 571

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  279 bits (713), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 171/511 (33%), Positives = 264/511 (51%), Gaps = 13/511 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +T +++ LK RHI M                       PV  LIAY F+G +++     
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW    
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYW--TK 214

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           +V    WI                       W++ F                     +  
Sbjct: 215 KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIA-FMKVLAIAGYLLYALIIVCGGSSQG 273

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +GFRYWR+PG +     +      +F+ +V+  + + F+Y G EL GI   EA NPRKS
Sbjct: 274 PIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 333

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VP+AI   V+RI +FY+ ++F +G+ V Y+DPRL S    S   A+SPFV++IQN+G ++
Sbjct: 334 VPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSD---SAVVASSPFVISIQNAGTKI 390

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP IFNA V++ V SA NS++YV SR LYALA  G APK FA  +R GVPY  ++ +   
Sbjct: 391 LPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAAL 450

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             LA++ V++ +   FN+ +N+ ++ G+ +W+ I I +I F +A + +GI +    + A 
Sbjct: 451 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 510

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              + AY+A FF  +I  I+ F  F  H FD   F T YI L +  + + G ++ Y+ + 
Sbjct: 511 FMPWAAYYATFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRF 569

Query: 557 I-KSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
             K  D+D+ T +    RE EE   +D E +
Sbjct: 570 FWKLEDIDIDTDR----REIEEVIWEDDEPK 596

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  278 bits (711), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 267/518 (51%), Gaps = 14/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G  +  ++++ LK RH+SM                       PV  LIAY F+G +V++
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               +GEMA++IP+    T ++SR++ PA G A GY Y F + I    +L+    VI+YW
Sbjct: 167 VTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYW 226

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
              + V    WI                       W++S K                   
Sbjct: 227 T--EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS 284

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PG +     +    +G+F+ +VA  + + F+Y G EL GI   EA N
Sbjct: 285 -KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAAN 343

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PR++VP+AI    +RI+ FY+ ++F +G+ V YN   L  T   +   A+SPFV++IQN+
Sbjct: 344 PRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKT---TTVIASSPFVISIQNA 400

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G   LP IFNA VLV + SA NS++YV SR L++LA  G APK+F+  +  GVP+  +I+
Sbjct: 401 GTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIV 460

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + L   LA++ V+  + + FN+ +N+ ++ G+ +W+ I I +I F +  + +GI +    
Sbjct: 461 TSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLP 520

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + +    YGAY+A F+  +I  ++ F  F  H F    F T YI L + ++ + G +L Y
Sbjct: 521 FKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH-FKVTEFFTSYISLMLLVVVFCGAQLFY 579

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + +   +  D+D+ +     DR E +  + + ++   L
Sbjct: 580 RCRFFNRLEDIDIDS-----DRREADALIWEDDEPTTL 612

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  274 bits (701), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 168/484 (34%), Positives = 259/484 (53%), Gaps = 17/484 (3%)

Query: 117 PVAMLIAYAFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYF 175
           PV  LI+Y F+G +++     LGEMA++IP+   F+ +A R++ PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 176 ILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXX 235
                +L+    +IQYW   D V    WI                        ++S K  
Sbjct: 85  FTFALELSVLGQIIQYW--TDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 236 XXXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLF 295
                                 +GFRYWR+PGA+     +    +G+F+ +V+  + + F
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 296 SYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKG 355
           +Y G EL GI   EA NPRK+VP+AIK  V RI+VFY+ ++F +G+ V YNDP+L  + G
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL-DSDG 261

Query: 356 KSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPK 415
             +SA  SPF+++I+NSG +VLP IFNA VL+ + SA NS++Y+ SR LY+L+ +  AP+
Sbjct: 262 SFVSA--SPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 416 IFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYI 475
             +  ++ GVPY A++ + +F  LA++  S+GS K FN+ +N+  + G  +W+ I   +I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 476 YFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGY 535
            F +A   +GI ++   Y A    Y AY+A FF  LI LI+ FT F    F    F+  Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 536 IGLPVYIISWAGYKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
           I + +++  W  ++L +K  +I K  DVD+ +     DR E E    +Q   E L+    
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDS-----DRREIE----EQVWIEPLRKTKW 489

Query: 595 NMEW 598
              W
Sbjct: 490 QCVW 493

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  275 bits (703), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 179/517 (34%), Positives = 260/517 (50%), Gaps = 18/517 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++ T+L++ LK RHI M                       PV +LIAY FVG++V     
Sbjct: 39  NDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQI 98

Query: 137 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW   
Sbjct: 99  AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD- 155

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             ++P V+IT                           K                      
Sbjct: 156 --ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQ 213

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
           +RLGF YWRDPG F EY   I GG  GKFV F +     ++SY+GI+   I+  E +N R
Sbjct: 214 ERLGFHYWRDPGPFAEY---IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSR 270

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
            ++    K    RIIV YL TVF+L + V YND  + S  G   +A +SPFV+A+  +GI
Sbjct: 271 HAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTG---TAKSSPFVIAMNRAGI 327

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +VLPHI NA VL   +SA N  +   SRNL+ LA   +APKIF KTS+ G+PY  +I   
Sbjct: 328 KVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFIS 387

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  LAYM+ S  S+ +F +F  +VS   +L WI I   +IY D+A +AQG  +S   Y 
Sbjct: 388 CFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYS 447

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
            P   Y A+F+     +  L   F  F+   FD ++F T Y  +P+ I  +  +KL  KT
Sbjct: 448 TPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKT 507

Query: 555 KVIKSTDVDLYTFKEIYD--REEEEGRMKDQEKEERL 589
           + ++  +VDL     I+D  RE  E   K +    RL
Sbjct: 508 RYLRPEEVDL---ASIFDDIRENPEHIEKSKPIWARL 541

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  275 bits (703), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 173/518 (33%), Positives = 268/518 (51%), Gaps = 14/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G    T +++ LK RH+SM                       PV  LIAY F+G +V++
Sbjct: 65  EGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYF 124

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I YW
Sbjct: 125 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW 184

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
              D V    WI                        ++S K                   
Sbjct: 185 --TDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS 242

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            +   +GFRYWR+PG +   + A    K +F+ +V   V + F+Y G EL GI   EA N
Sbjct: 243 -SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASN 301

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VPKAI    +RI+VFY+ ++F +G+ V YN P+L S    S   A+SPFV++IQN+
Sbjct: 302 PRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLES---NSAVIASSPFVISIQNA 358

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G +VLP IFNA VLV + SA NS++YV SR LY+LA+ G APK F+  ++ GVPY  +I 
Sbjct: 359 GTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVIC 418

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + L   LA++  +  +   FN+ +N+ ++ G+ +W  I + +I F +  + +GI +    
Sbjct: 419 TALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLP 478

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    +GAY+A FF  LI  I+ FT F   +FD   F T YI L + ++ +   +L Y
Sbjct: 479 FKAKLMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLYY 537

Query: 553 KTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + + + K  D+D+ +     DR E +  + + ++ + L
Sbjct: 538 RCRFLTKIEDIDIDS-----DRREIDAIIWEDDEPKNL 570

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  275 bits (704), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 165/491 (33%), Positives = 261/491 (53%), Gaps = 8/491 (1%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           V  G  ++  ++++LK RHI M                       PV  LIAY F+  +V
Sbjct: 79  VDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIV 138

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           F     LGEMA++IP+   FT ++SR++ P++G A GY Y F + I    +L+    +IQ
Sbjct: 139 FSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           +W   D V    WI                       W++S K                 
Sbjct: 199 FW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG 256

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA
Sbjct: 257 AGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK+VP+AIK   +RI++FY+ ++F +G+ V ++DP+L S        ++SPF++AIQ
Sbjct: 316 ANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDD---SYVSSSPFIIAIQ 372

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           NSG +VLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T++ GVPY A+
Sbjct: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           + +  F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F +    +GI +  
Sbjct: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
             + A    + AY+A+FF I+I +I+ FT F    F+   F+  YI + ++   W  ++L
Sbjct: 493 LPFKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQL 551

Query: 551 IYKTKVIKSTD 561
            ++ K+  S D
Sbjct: 552 YFRCKLYWSLD 562

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 177/533 (33%), Positives = 273/533 (51%), Gaps = 25/533 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           DEN  L K L +RHI +                       P+ + +++  +  +V+  M 
Sbjct: 42  DEN-NLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMN 100

Query: 137 CLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            L EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AAA V+QYW   
Sbjct: 101 TLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYW--T 158

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D+V+  VWIT                      W +S K                   P+H
Sbjct: 159 DKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSH 218

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYT-GIELTGIVCSEAENP 313
           DRLGFRYW +PG F  +   ITGG  G+F+      + S F++    EL G+ C EA++ 
Sbjct: 219 DRLGFRYWNNPGPFAYH---ITGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDT 275

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST-KGKSMSAAASPFVVAIQNS 372
           R+++ KA +  ++RII FY+ +   +G  ++ +DP+L+      +  AA+SPFV  I N+
Sbjct: 276 RRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNA 335

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           GI VL HI NA +L   +S+ NS +Y SSR++ ALA  G APK+F + +R GVPYNA+ L
Sbjct: 336 GIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVAL 395

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S     L Y+N SS SA++F +  N+ ++ G + W  I I Y+ F KA     + + +  
Sbjct: 396 STAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNLYE-RVP 454

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + +  Q Y  YF + F +L+ L   +  F+   ++   F+  YI LP++ + + G+K+ +
Sbjct: 455 FKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWF 514

Query: 553 KTK-VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           KT+  I   ++D+ T   + D EEE    + +          KNM   +EKF+
Sbjct: 515 KTRWYIPFREIDVIT--GLADAEEEAKMTQPRTP--------KNM---WEKFM 554

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/501 (33%), Positives = 267/501 (53%), Gaps = 9/501 (1%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G  +   +++ LK RHI M                       PV  LIAY F+  +VF 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+   FT ++SR++ PA+G A GY Y F + +    +L+    +IQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V    WI                       W++S K                   
Sbjct: 209 T--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI   EA N
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP+AIK   +RI++FY+ ++F +G+ V Y+D +L ST       +ASPF++AI+NS
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSY---ISASPFIIAIENS 382

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G ++LPHIFNA +L  + SA NS++YV SR L+ LA    APK F  TSR GVPY ++  
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           +  F  LA++ VSSG AK FN+ +N++S+ G  +W+ I I ++ F +A + +GI +    
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + A    + AY+++FF  +I +I+ FT F    F+   F+  YI + ++   W  ++L +
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 553 KTKVIKST-DVDLYTFKEIYD 572
           ++K++ +  +VD+ T +   D
Sbjct: 562 RSKLLWTVEEVDIDTDRRDVD 582

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  273 bits (698), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 165/518 (31%), Positives = 265/518 (51%), Gaps = 14/518 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G  +  ++++ LK RH+SM                       PV  LIAY F+G +V++
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               +GEMA++IP+    T +++R++ PA G A GY Y F + I    +++    VIQYW
Sbjct: 106 VTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 165

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                V    WI                       W++S K                   
Sbjct: 166 --TKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS 223

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +GFRYWR+PG + +   +    KG+F+ +VA  + + F+Y G EL GI   EA N
Sbjct: 224 -KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAAN 282

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VPKAI    +RI+ FY+ ++F +G+ V YN P L      +   A+SPFV++IQ++
Sbjct: 283 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSPFVISIQSA 339

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G  +LP IFNA VLV + SA NS++YV SR L++LA  G APK F+  +  GVPY  +I 
Sbjct: 340 GTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVIC 399

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + L   LA++ V   + + FN+ +N+ ++ G+ +W+ I I +I F +  + +GI +    
Sbjct: 400 TALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLP 459

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + +    YGAY+A F+  +I  ++ F  F   KF    F TGYI L +  + +   +L Y
Sbjct: 460 FKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLYY 518

Query: 553 KTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           + +   +  D+D+ +     DR E +  + ++E+   L
Sbjct: 519 RCRFFNRLEDIDIDS-----DRREIDALIWEEEEPTTL 551

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  273 bits (698), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/538 (32%), Positives = 269/538 (50%), Gaps = 20/538 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           + N +L++ L +RH+                         P  ++I+Y  +  +++  M 
Sbjct: 53  EGNGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMN 112

Query: 137 CLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
            LGEM  Y+P +G  S  S      RYVD +L FA G+ Y + + IL   + TAA+ V+ 
Sbjct: 113 ALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVT 172

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW +   V   VWIT                      W +S K                 
Sbjct: 173 YWTTS--VPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWG 230

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGK-GKFVSFVAVFVYSLFSYT-GIELTGIVCS 308
             P+H RLGF YW+DPG F  +   ITGG  G F+      +   F++  G EL  +  S
Sbjct: 231 GGPSHVRLGFHYWKDPGTFAHH---ITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSS 287

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFV 366
           E  + R+++ KA K  ++R++ FY+     + + VAYNDP LL+   +GK   AA+SPFV
Sbjct: 288 ECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKE-GAASSPFV 346

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           + IQN+GI+VLPHI NAC+L   +SA NS ++ SSR+L  +A +G APKIF K +R+GVP
Sbjct: 347 IGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVP 406

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
           Y ++ LS +   LA++NVSS +A++F++F N+ ++ G L WI  +I Y+ F KA     +
Sbjct: 407 YYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM 466

Query: 487 DKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWA 546
              +  +   GQ Y  +++L    +I L   +  F+   +    F+  YI LP+++I W 
Sbjct: 467 -YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWV 525

Query: 547 GYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           G+K   + K         Y   EI   +   G  + +E  E+L  N      ++ KF+
Sbjct: 526 GHKFWARYKHAVPLLKLYYPVDEI---DVITGLAEAEEVAEKLDMNRIPPSTYWGKFI 580

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  273 bits (697), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 168/515 (32%), Positives = 266/515 (51%), Gaps = 15/515 (2%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G   +  ++++LK RHI M                       PV  LI+Y F+G LV+  
Sbjct: 66  GYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSV 125

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+   FT +A R++ P++G A GY Y F + +    +L+    VIQYW 
Sbjct: 126 TQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT 185

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
               V    WI+                      W++  K                    
Sbjct: 186 YA--VPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGV 243

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +GFRYWR+PG +     +    + +F+ +V+  +   F+Y G EL GI   EA NP
Sbjct: 244 TGP-VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANP 302

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VP+AIK  V+RI+ FY+ ++F +G+ V YND  L +T       A+SPF++AI+NSG
Sbjct: 303 RKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSY---VASSPFIIAIKNSG 359

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
             VLPHIFNA +   + SA NS++YV SR L+ L+ +  APKI ++T++ GVP+ A++++
Sbjct: 360 TPVLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVT 419

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +   LAYM  S+G    FN+ +N+ ++ G  +W+ I + +I F +A + +GI +    +
Sbjct: 420 SVVGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPF 479

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            A      AY+A F   +I +I+ FT F   KF    F   YI + ++I  W  +++I++
Sbjct: 480 KAALMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFR 538

Query: 554 TKVI-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586
            + I K  DVD+ T     DR + E  + +D E +
Sbjct: 539 CRFIHKVEDVDIDT-----DRRDIEAVVWEDAEPK 568

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  271 bits (694), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 170/508 (33%), Positives = 257/508 (50%), Gaps = 12/508 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++ T+L++ LK RHI M                       PV +LIAY FVG++V     
Sbjct: 44  NDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQI 103

Query: 137 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW   
Sbjct: 104 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD- 160

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V+P V+IT                           K                      
Sbjct: 161 --VSPAVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQ 218

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           +RLGF YWR+PG F  Y   + G  GKFV F A     ++SY+GI+   I+  E +N R 
Sbjct: 219 ERLGFHYWREPGPFANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRH 276

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++    K    RIIV YL TVF+L + V YND  + +  G   +A +SPFV+A+  +GI+
Sbjct: 277 AIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTG---TARSSPFVIAMNRAGIK 333

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI NA +L   +SA N  +   SRNL+ LA   +APKIF +TS+ G+PY  +I    
Sbjct: 334 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISS 393

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LAYM+ S  SA +F +F  +VS   +L WI I   +I+ D+A +AQG  +S   Y  
Sbjct: 394 FLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYST 453

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
           P   + A+F+     +  L   F  F+   FD ++F T Y  +P+ I  +  +KL  KTK
Sbjct: 454 PMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTK 513

Query: 556 VIKSTDVDLYT-FKEIYDREEEEGRMKD 582
            ++  +VDL + F +I +  E   + K+
Sbjct: 514 YLRPHEVDLESIFDDIKENPEHIVKTKN 541

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  271 bits (694), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 153/487 (31%), Positives = 253/487 (51%), Gaps = 7/487 (1%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K   + ++++LK RH++M                       PV  L+AY FV  + +   
Sbjct: 43  KPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVT 102

Query: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            D V    W+                       W++S K                     
Sbjct: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
             R+GFRYW+DPG +     +      +F+ +V+  + + F++ G EL G+   E +NPR
Sbjct: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           ++VPKAI    +RI++FY+ ++ ++G+ V Y+DP+L+   G + +A ASPFVVAI  +G 
Sbjct: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQ-DGSTTNANASPFVVAINAAGT 338

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +VLP I N  ++V + SA NS++YV SR LY L   G AP   ++T+  GVPY A++ + 
Sbjct: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  L Y+NVSS S  +F++ +++ ++ G  +W+ I + +I F +  + +GI +    + 
Sbjct: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
           A    YGAY+A FF I+I L++ FT F    F    F+  YI   ++++ W  ++ ++K 
Sbjct: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516

Query: 555 KVIKSTD 561
           +   + D
Sbjct: 517 RWFHTVD 523

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  271 bits (692), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/520 (31%), Positives = 276/520 (53%), Gaps = 19/520 (3%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G   +  ++++LK RHI M                       PV  LIAY FVG L +  
Sbjct: 55  GSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAV 114

Query: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              LGEMA++IP+   FT +ASR++ P++G A+GY Y F + +    +L+    ++ YW 
Sbjct: 115 TQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWT 174

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
               V    WI+                      W+++ K                    
Sbjct: 175 FA--VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGV 232

Query: 254 NHDRLGFRYWRDPGAFKEYSTA----ITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVC 307
               +GFRYWR+PG + +  T+    I+  K  G+F+ +    + + F+Y G EL GI  
Sbjct: 233 TGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291

Query: 308 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 367
            EA NPRK+VP+AIK  V+RI++FY+ ++F +G+ V ++DP+L S        ++SPF++
Sbjct: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSD---DSYVSSSPFII 348

Query: 368 AIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPY 427
           AI+NSG ++LP IFNA +L+ + SA NS++YV SR L++LA  G APKI ++T++ GVP+
Sbjct: 349 AIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPW 408

Query: 428 NALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 487
            +++ + +F  LAYM  + G   +F++ VN+ ++ G  +W+ ILI +I F +  + +GI 
Sbjct: 409 VSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGIS 468

Query: 488 KSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAG 547
           +    + A      AY+A+F  ++I + + FT F    FD   F   YI + ++ + W  
Sbjct: 469 RDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGA 527

Query: 548 YKLIYKTKVI-KSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
           ++L +K + I K  DVD+ + +    R+ E+   +D E +
Sbjct: 528 FQLWFKCRWIWKLEDVDIDSNR----RDVEKIIWEDPEPK 563

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  268 bits (685), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 174/543 (32%), Positives = 275/543 (50%), Gaps = 29/543 (5%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P   D N  L+K LK+ HI +                       P  + I+Y  +  +++
Sbjct: 45  PQSGDHN--LKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIY 102

Query: 133 YTMACLGEMASYIPL--------DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184
             M  L EM  ++P            ++  +RYVD +LGFA+G+ Y++ Y IL   + TA
Sbjct: 103 PVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTA 162

Query: 185 AALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXX 244
           A+ V+ YW +   V    WIT                         S K           
Sbjct: 163 ASGVVTYWTTA--VPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVS 220

Query: 245 XXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELT 303
                   PNHDRLGFR+W+DPGA+  Y  A  GG G+    +   + + F++  G EL 
Sbjct: 221 IVLFFGGGPNHDRLGFRFWKDPGAWA-YHLA-DGGAGRLSDIITGVIRAGFAFILGPELV 278

Query: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS--TKGKSMSAA 361
            +  +EA++ R+++ KA +  V+R+I FY  +    G+ V+ NDP LL+  ++GK   A 
Sbjct: 279 VLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKP-GAG 337

Query: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421
           +SPFV+ IQN+GI+VLPHI N C+L   +S+ NS +Y ++R+L +L+ +G APKIF + +
Sbjct: 338 SSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVN 397

Query: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481
           RWGVPY  +  +  F  LAY+NVSS +A +FN+F N+ ++ G L WI   + Y+ F KA 
Sbjct: 398 RWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAV 457

Query: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVY 541
               +   +  +  P Q Y  +F +    +I LI  +  F+   ++YK FI  YI LP++
Sbjct: 458 FFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLF 514

Query: 542 IISWAGYKLIYKT---KVIKSTDVDLYT-FKEIYDREEEEGRMKDQEKEERLKSNGKNME 597
           +I W G+K   +T    +I  +++D+ T  +EI    EEE +  +  +        K +E
Sbjct: 515 LILWLGHKAYTRTWSQWMISVSEIDVTTGLREI----EEETKELNARRIPPRNLWEKILE 570

Query: 598 WFY 600
           W +
Sbjct: 571 WLF 573

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  268 bits (685), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 168/545 (30%), Positives = 270/545 (49%), Gaps = 31/545 (5%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DG+    +L++ L ARHI +                       P  ++ +Y  +  +V+ 
Sbjct: 96  DGR--KNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 134 TMACLGEMASYIPLDGFTSYAS------RYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            M  LGEM  Y+P DG  S  S      RY+D +L FA G+ Y + + +L   + TAA+ 
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 188 VIQYWISRDRVNPG-VWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXX 246
           V++YW    +V P   WI                       W +  K             
Sbjct: 214 VVEYW---TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 247 XXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIELTGI 305
                 PNHDRLGFRYW  PG+F   +T   G  G F+      +   FS+  G EL  +
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVL 328

Query: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK--GKSMSAAAS 363
             SE  +PR+++ KA K  ++R++ FY+     + + V+YNDP +LST        A +S
Sbjct: 329 PSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDP-ILSTALIQDKPGAGSS 387

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           PFV+ IQN+GI+VLPHI N C+L+  +S+ N+ L+ SSR+L  +AI+ +APK   K +R+
Sbjct: 388 PFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRF 447

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           GVPY A+I+S++   +AY+N S  ++ +F +F N+ ++ G L WI + + Y+ F KA   
Sbjct: 448 GVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEY 507

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
            G+ K +  Y   GQ Y   ++L   I+I +   F + +   ++   FI  Y+ LP++++
Sbjct: 508 HGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLM 566

Query: 544 SWAGYKLI-YKTKVI--------KSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
            W G+K   Y+ K+         +  D+D+ T  E  + E E+   +  + E      GK
Sbjct: 567 IWIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESEYVKPE---TVGGK 623

Query: 595 NMEWF 599
            ++W 
Sbjct: 624 FVDWL 628

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/501 (33%), Positives = 259/501 (51%), Gaps = 13/501 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++ T+L++ LKARHI M                       PV MLIAY  VG++V     
Sbjct: 41  NDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQI 100

Query: 137 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            + E+AS++P  G T  ++ +++D A+GF  G+  +  Y  L P +L+A A+V+ YW   
Sbjct: 101 AIAEVASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD- 157

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             ++P ++IT                      +    K                      
Sbjct: 158 --LSPAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQ 214

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           +RLGF YWR+PG F EY   + G  GKFV F A     ++SY+GI+   I+  E +N R 
Sbjct: 215 ERLGFHYWRNPGPFAEY--LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 272

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++    K    RII+ YL TVF+L + V YND +L++T   S +A +SPFV+A++ +GI+
Sbjct: 273 AIFHGAKNVFVRIILLYLITVFVLTLIVPYND-KLIATG--SGNARSSPFVIAMERAGIK 329

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI NA +L   +SA N  +   SRNL+ LA   +APKIF KTS+ G+P+  ++    
Sbjct: 330 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISS 389

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LAYM+ S  SA +F++F  +VS   +L WI I   +I+ D+A RAQG  +    Y  
Sbjct: 390 FLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYST 449

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               Y A+F+     +  L   F  F+   FD ++F + Y  +P+ I  +  +KL  KT+
Sbjct: 450 TIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTR 509

Query: 556 VIKSTDVDLYT-FKEIYDREE 575
            ++  +VDL + F++I +  E
Sbjct: 510 YLRPHEVDLQSIFEDIRENPE 530

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  264 bits (675), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 154/501 (30%), Positives = 256/501 (51%), Gaps = 7/501 (1%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E    R+ L  R +SM                       P ++LIA+    ++      C
Sbjct: 113 EERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKC 172

Query: 138 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           +  M +Y+P+ G F  +  R+VD + GFA+G+TY          ++TA  LV++YW   D
Sbjct: 173 MCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYW--TD 230

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++     I+                      +LS  K                   P H 
Sbjct: 231 KIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHT 290

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            LGF+ W +PGAF EY +   G  G+F  F++  V++L+ + G++  G   SEA NPRK 
Sbjct: 291 VLGFKNWSNPGAFAEYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKV 348

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQNSGIE 375
           +P + +    R+I+FY+     +G+ + YNDP ++ + K  ++ A ASP+V A++  GI 
Sbjct: 349 IPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIR 408

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI N  +L  + SA NS LY +SR L+ LA+D +AP+IF  T++ GVP    I  ++
Sbjct: 409 VLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLV 468

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
            CGLAY++VS+ +  +  +F+NV +    + +I I + Y+ F K C AQ +D     Y +
Sbjct: 469 ICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYS 528

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               Y A+ +LF+ +L+ L+  +TVFL   +D ++F+  Y  +P +++   G+KL   TK
Sbjct: 529 SSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTK 588

Query: 556 VIKSTDVDLYT-FKEIYDREE 575
            ++  ++DL+T  +E+ D + 
Sbjct: 589 SVRPLEMDLFTGIEELADEDR 609

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/519 (30%), Positives = 266/519 (51%), Gaps = 14/519 (2%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +G  + T +++ LKARHISM                       PV  L+AY F+G +V+ 
Sbjct: 47  EGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYS 106

Query: 134 TMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
               LGEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +IQYW
Sbjct: 107 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYW 166

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
              DRV    WI                       W++S K                   
Sbjct: 167 --TDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS 224

Query: 253 PNHDRLGFRYWRD-PGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
                +G       P      S+  T  +  F+ +V+  + + F+Y G EL GI   E+ 
Sbjct: 225 -KQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGEST 283

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK+VPKAI    +RI+ FY+ ++  +G+ V Y+DPRL S    S    ASPFV++I+N
Sbjct: 284 NPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSES--STDVNASPFVISIKN 341

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +G ++LP IFNA VL+ V SA NS++Y+ SR  Y+LA+ G APK  A  ++ GVPY  ++
Sbjct: 342 AGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVL 401

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           ++ L   ++++ ++  ++  F++ VN+ ++ G+ +W+ I + +I F +  + +GI +   
Sbjct: 402 ITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDL 461

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            + A    + AY+A FF  +I  I+ +T F   KFD  TF T YI L + ++ + G ++ 
Sbjct: 462 PFKAKFMPWAAYYATFFVTVIIFIQGYTAFT-PKFDVTTFFTSYISLFLMLLVFIGCQIY 520

Query: 552 YKTKVIKST-DVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           YK + + +  D+D+ +     DR E +  + ++++ + +
Sbjct: 521 YKCRFLWAVEDIDIDS-----DRREIDAIVWEEDEPKNI 554

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/514 (30%), Positives = 258/514 (50%), Gaps = 9/514 (1%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E    R+ L  R +SM                       P ++LIA+    ++      C
Sbjct: 41  EERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQC 100

Query: 138 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           +  M +Y+P+ G F  +  R+VD + GF++G+TY          ++TA  LV+++W   D
Sbjct: 101 MCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFW--TD 158

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++     I+                      +LS  K                   P H 
Sbjct: 159 KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK 218

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            LGF+ W +PGAF EY +   G  GKF  F++  +++L+ + G++  G   SEA NPRK 
Sbjct: 219 VLGFKNWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKV 276

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGK-SMSAAASPFVVAIQNSGIE 375
           +P + +    R+I+FY+     +G+ V +ND  ++    + ++ A ASP+V A++  GI 
Sbjct: 277 IPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIG 336

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI N  +L  + SA NS LY +SR L+ LA++G+APK+F  T R GVP    +  +L
Sbjct: 337 VLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLL 395

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
            CGLAY++VS+ +  +  +F+NV +    + +I I I Y+ F K C+AQ ID     Y +
Sbjct: 396 VCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSS 455

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               Y  + +LF+ +L+  +  + VFL   +D ++FI  Y  +P +I+ +AG+KL  KT+
Sbjct: 456 SFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTR 515

Query: 556 VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
            +K  ++DL  F  I +  EE+   ++   +  L
Sbjct: 516 FVKPVEMDL--FSGIAELAEEDAYWEENPPKMNL 547

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  251 bits (640), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 165/501 (32%), Positives = 254/501 (50%), Gaps = 13/501 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++ TRL++ LK RHI M                       P  M +AY  VG++V     
Sbjct: 45  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI 104

Query: 137 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A+V++YW   
Sbjct: 105 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD- 161

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             +NP VWIT                      +    K                      
Sbjct: 162 --INPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQ 218

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           +RLGF YWR+PG F EY   + G  GKFV F A     ++SY+GI+   I+  E +N R 
Sbjct: 219 ERLGFHYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++    +    RIIV YL  V +L + V YND  + +  G   +A +SP+V+AIQ + I+
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTG---TAKSSPYVIAIQRANIK 333

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           +LPHI NA +L   +SA N  +   SRNL+ALA   +APKIF  T++ G+PY  +     
Sbjct: 334 ILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISA 393

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  L+YM+VSS SA +F++F  +VS   +L WI I   +I+ D+A +AQG  +S   +  
Sbjct: 394 FLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHST 453

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
               + A+F+    ++  L   F  F+   FD ++F T Y  +P+ II +  +KL  KTK
Sbjct: 454 CLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTK 513

Query: 556 VIKSTDVDLYT-FKEIYDREE 575
            ++  +VDL + F++I    E
Sbjct: 514 YLRPAEVDLESIFEDIRQNPE 534

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  249 bits (637), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/539 (28%), Positives = 264/539 (48%), Gaps = 21/539 (3%)

Query: 72  VPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           V +    N  L K+L  RH+                         P +++I +  +   +
Sbjct: 60  VSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCL 119

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           F  +  LGEMA+  P+  GF  Y +R+VDP++GFA+   YL ++ +L P +L AA++ I+
Sbjct: 120 FTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIK 179

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW   D +N   W+                        LS  K                 
Sbjct: 180 YW--NDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCG 237

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
             P    LG +YW +PG+F  +++       KF    +VFV + FSY+GIE+T +  +E+
Sbjct: 238 GGPQGGYLGGKYWHNPGSFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAES 292

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           ++PR+++PKA K T + I   Y+  + L+G  V Y++PRLLS    S+ AA+SP V+AI+
Sbjct: 293 KDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGS-SSVDAASSPLVIAIE 351

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           N GI+ LP + NA +L+ + S  NS +Y  SR + A+A  G  P++     + G P NA+
Sbjct: 352 NGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAI 411

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           + ++ F  L+++  S   A++F +   +  +  I  W+ I I +I F +A + Q     +
Sbjct: 412 LFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDE 471

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAG 547
             Y++    +G+++ +    L+ ++  +T      G   D ++F  GY+  P+ I  + G
Sbjct: 472 LPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVG 531

Query: 548 YKLIYKTK--VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           +KL+Y+ K  V+   D+D+ T +   D       MK +E+E   KS+      F+ +FL
Sbjct: 532 HKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMK-EEQEHLAKSS------FFARFL 583

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  246 bits (629), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 154/457 (33%), Positives = 228/457 (49%), Gaps = 11/457 (2%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++ TRL++ LK RHI M                       PV +LIAY FVG++V     
Sbjct: 43  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQI 102

Query: 137 CLGEMASYIPLDGFT-SYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            + E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A A++++YW   
Sbjct: 103 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYW--- 157

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V+P V+IT                           K                      
Sbjct: 158 TDVSPAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQ 217

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           +RLGF YWRDPG F  Y  A  G  GKFV F A     ++SY+GI+   I+  E +N R 
Sbjct: 218 ERLGFHYWRDPGPFANYLVA--GHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRY 275

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++    K    RIIV YL TVF+L + V YND  + +  G   +A +SPFV+A+  +GI+
Sbjct: 276 AIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLIATGTG---TAKSSPFVIAMNRAGIK 332

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI NA +L   +SA N  +   SRNL+ LA   +AP+IF KTS+ G+PY  +I    
Sbjct: 333 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISS 392

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LAYM+ S  SA +F +F  +VS   +L WI I   +I+ D+A +AQG  +S      
Sbjct: 393 FLPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCST 452

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFI 532
               + A+F+    ++      F  F+   FD ++F+
Sbjct: 453 RIAPFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  246 bits (628), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 247/526 (46%), Gaps = 21/526 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K E   L+K +K RH+ M                       P  ++I YA +G  ++  +
Sbjct: 136 KFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCII 195

Query: 136 ACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA      L GF +Y S  VDP  GFA+ + Y  ++  + P +L   +L I+YW 
Sbjct: 196 QAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWT 255

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           +   VNP  ++                       + +  K                    
Sbjct: 256 TT--VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAG 313

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           N   LG +YW DPGAF+      T G  +F   +A FV + F++   E   +  +E  NP
Sbjct: 314 NDGYLGAKYWHDPGAFRG-----TNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNP 368

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK++P A K  +YR+I  ++ T+ LLG  V ++  +L+   G +  A  SP+V+AI   G
Sbjct: 369 RKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKA--SPYVLAISIHG 426

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           + V+PH  NA +L+ VFS  NS  Y SSR L  LA  G APK F    R G P+ A+  +
Sbjct: 427 VRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCA 486

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            LF  +A+   S    ++F + + +  +  + +WI I + +I F +A   QG    +  +
Sbjct: 487 ALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGF 546

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGY 548
            A    YG+Y+A    +L ALI  F V +         D + F   Y+ +P+ I  + GY
Sbjct: 547 KAQLGVYGSYYATIMMVL-ALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGY 605

Query: 549 KLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           KL  +     I++ D+DL ++++++D  EE  + +D+E +E+LK+ 
Sbjct: 606 KLWKRDWRLFIRAKDIDLDSYRQVFD--EELLKQEDEEYKEKLKNG 649

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  243 bits (621), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 151/518 (29%), Positives = 260/518 (50%), Gaps = 18/518 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            NT L K+L  RH+                         P ++++ +  +   +F  +  
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+A+  P+  GF  Y +R+VDP++GFA+   YL ++ +L P +L AA+L I+YW   D
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYW--ND 156

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N   W+                        LS  K                   P+  
Sbjct: 157 KINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGG 216

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            LGF+YW +PGAF   + A      KF    +VFV + FS++GIE+  +  +E++NPRK 
Sbjct: 217 YLGFKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKV 271

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + +   Y+  + L+G  V YND RLL+    S+ AAASP V+AI+N GI+ 
Sbjct: 272 IPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNA-ATSVDAAASPLVIAIENGGIKG 330

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ + S  NS +Y  SR + ++A  G  PK+ +K  + G P NALI++++F
Sbjct: 331 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIF 390

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S    ++F +   +  +  I  W+ I    I F +A + Q     +  Y++ 
Sbjct: 391 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQ 450

Query: 497 GQRYGAYFALFFCILIALIKNFTVF--LGHKF-DYKTFITGYIGLPVYIISWAGYKLIYK 553
              +GA++ +    L+ +   +T    LG    D ++F   ++ LP+ ++ + G+KL + 
Sbjct: 451 TGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYFA 510

Query: 554 TK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
                 I + ++D+ + ++I D   EEG  +++E+EE+
Sbjct: 511 RNWRLQIGAEEMDIDSGRKIID---EEGLKQEREEEEK 545

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  242 bits (617), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/516 (30%), Positives = 255/516 (49%), Gaps = 15/516 (2%)

Query: 71  AVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           +V D + +   + + LK+RH+ +                       P  +LIAYA + L 
Sbjct: 40  SVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLF 99

Query: 131 VFYTMACLGEMASYIPLDGFTSYASR---YVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
           V+  M  + EM + IPL G ++  S    YV+  L F  G+   +   ++ P ++TA AL
Sbjct: 100 VWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACAL 159

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
           ++QYW      NP ++I+                      W+SS K              
Sbjct: 160 LVQYW---TDANPAIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVI 216

Query: 248 XXXXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI-ELTGI 305
                P  +  LGF YW+ PGAFK Y   + GG GKF++F    + S FS+  + E+   
Sbjct: 217 FFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAFWTAIIKSGFSFVLVPEIVSS 274

Query: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS-P 364
             +EA  PR+++P+A K  +YR+ +FY+  + ++G+ V Y++ RLL+      S+AA+ P
Sbjct: 275 CAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASP 334

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           FV+ I+ +GI VLPHI NA +L   +S     LY +SR L+++A  G AP+I    +++G
Sbjct: 335 FVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYG 394

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
           VPY    ++ LFC LAY+N S+ S+ +FN+  N+ ++ G +SW+ + I YI F       
Sbjct: 395 VPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVL 454

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIIS 544
            ++  +  +  P Q+  AY A+ F  ++ L   F VF+   +D   F   YI L   ++ 
Sbjct: 455 KLND-RIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVL 513

Query: 545 WAGYKLIYK---TKVIKSTDVDLYTFKEIYDREEEE 577
           + G  + YK    + I   + D+     + + EE E
Sbjct: 514 FVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYE 549

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  241 bits (614), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 157/530 (29%), Positives = 256/530 (48%), Gaps = 27/530 (5%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           + +  ++ + LK+RHI +                       P  +LI+Y  +   V+  M
Sbjct: 61  EGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIM 120

Query: 136 ACLGEMASYIPLDGFTSY---ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
             L EM   +P+ G TS       Y++  L F  G    +   ++ P+++TA A++IQYW
Sbjct: 121 NFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYW 180

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                 N  ++I+                      W+S  K                   
Sbjct: 181 TD---ANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGA 237

Query: 253 PNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS-EA 310
           PN D+ LGF YW+ PGAF  +   + G  GKF++     + S FSY  +    + C+ EA
Sbjct: 238 PNQDKVLGFHYWKHPGAFNPH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEA 295

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS-AAASPFVVAI 369
           ++PR+++P+  +  VYR+ +FY+C    +G+ V Y++ RLL+      S AAASPFV+ I
Sbjct: 296 KDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGI 355

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
           Q  GI VLPHI NAC+L   +S   S LY +SR L+++A++G  PKIFA T+R+G PY +
Sbjct: 356 QEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYS 415

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC-RAQGIDK 488
              + +FC LAY+N S  S+ +F +  N+ ++ G + W+ + +VY+ F K    A   DK
Sbjct: 416 TAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLTDK 475

Query: 489 SKFAYVAPGQRYG---AYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISW 545
             F      +R+    AY +  F  +++L   + VF+   ++   F   Y  L +  + +
Sbjct: 476 MPFR-----KRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLY 530

Query: 546 AGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKN 595
            G  + YKT  IK  D+D     E+      +  M D+E++  +    KN
Sbjct: 531 IGAAIYYKT--IKLRDLD-----EVAAEIIPKIAMADEEEKGEVPIVPKN 573

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 159/530 (30%), Positives = 256/530 (48%), Gaps = 32/530 (6%)

Query: 75  GKDENT----RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           G DE T    +++K +K+RH+ M                       P  ++I Y     +
Sbjct: 53  GYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAM 112

Query: 131 VFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 188
           ++  +   GE+   Y  + G +T+Y+S  VDPALGF++ + Y  ++  + P QL  AA+ 
Sbjct: 113 LYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAIT 172

Query: 189 IQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXX 248
           I+YW      NP +++                         ++ K               
Sbjct: 173 IKYWTD---TNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIIN 229

Query: 249 XXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS 308
                N   +G RYW  PGAF       TG KG       VF Y+ F+Y GIE+  +  S
Sbjct: 230 CGGAGNDGYIGARYWHTPGAFS------TGFKG----VCYVFCYAAFAYGGIEVMVLTAS 279

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 368
           E ENPRKS+P A K  +YRI++ Y+ T  ++   V Y+ P L ST   S    ASPFV+A
Sbjct: 280 EQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASR---ASPFVIA 336

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
           I + GI V+PHI NA +LV V S  NS LY + R L +L+  G APK+F    R G P  
Sbjct: 337 IASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLL 396

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
             ++++    LA++  S     +F++ + +  +  +  WI+I + ++ F  A +AQG   
Sbjct: 397 CFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSL 456

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYII 543
            +  Y +    +G++FA+   + + L+  F V +     G K   K F   Y+  PV I 
Sbjct: 457 GEVGYKSQTGYWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIF 515

Query: 544 SWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
            + GYK+ YK     I +T+VDL + ++I+D  E+E + +D + +E++++
Sbjct: 516 IYFGYKIYYKDWRLCIPATEVDLNSHRKIFD--EDELKQEDLDWKEKMRT 563

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  240 bits (612), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 150/521 (28%), Positives = 255/521 (48%), Gaps = 16/521 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            NT L KDL  RH+                         P +++I +  +G  +F  +  
Sbjct: 82  NNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINS 141

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+++  P+  GF  Y  R+V+P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N   W+                        LS  K                   P+  
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGG 259

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YWR+PGAF  +++       KF    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWRNPGAFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N  I+ 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGRIKG 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  + G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S+  A++F +   +  +  I  W+ I + +I F KA + Q     +  +++ 
Sbjct: 434 GLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQ 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
               G+++  F  + + LI +F   L          ++F  GY+  P+ I+ + G+K+  
Sbjct: 494 TGVLGSWYG-FVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 553 K--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           +  T ++K  D+DL T ++  D       MK + +    KS
Sbjct: 553 RNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKS 593

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 244/507 (48%), Gaps = 17/507 (3%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
           ++ + LK RHI +                       P  +LIAY  +   V+  M  + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 141 MASYIPLDG---FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           M   IPL G     S A  Y++  + F  G+   +   ++ P ++TA AL++QYW     
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYW---TD 170

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
            N  ++I+                      W+SS K                   P  D 
Sbjct: 171 ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDH 230

Query: 258 -LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS-EAENPRK 315
            LGF YW++PGAF  +     G  G+F++     + S FS+  +  T   CS E   PR+
Sbjct: 231 VLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRR 288

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAIQNSG 373
           ++PKA +  +YR+ +FY+    ++G+ V +N+ RL++    GKS  AAASPFV+ IQ +G
Sbjct: 289 NMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKS-DAAASPFVIGIQEAG 347

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I++LPHI NAC+L   +S     LY SSR LY++A+ G APKIFAK +R+G PY +  L+
Sbjct: 348 IKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLA 407

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            LF  LAY+N S  ++ +FN+  N+ ++ G +SWI + + YI F K   A  ++  +  +
Sbjct: 408 SLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLND-RVPF 466

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
             P Q   AY    F  +++L   + VF+   ++   F   Y+ +   I  +      YK
Sbjct: 467 RRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYK 526

Query: 554 T---KVIKSTDVDLYTFKEIYDREEEE 577
               +  K  +V++    +I D EE  
Sbjct: 527 QWTFRDFKEIEVEILPKIDIADEEERN 553

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  239 bits (611), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 164/586 (27%), Positives = 270/586 (46%), Gaps = 27/586 (4%)

Query: 2   KMPLKKMFTSTSPRNSSSLDSDHDAYYSKQNPDNF---PVKEQEIYNIDLEENNVXXXXX 58
           K PLKK + +       S D    A     +PDNF    V      N+    N+      
Sbjct: 3   KNPLKKQYWTEVIDGFHSPDRTDSANDRSSSPDNFELSSVNSPVRVNVSSSGNDDILKGD 62

Query: 59  XXXXXXXXXXXFAVPDGKD-----ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXX 113
                       A P+         NT L KDL  RH+                      
Sbjct: 63  TKEYPRDVK---ATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLT 119

Query: 114 XXXPVAMLIAYAFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLF 172
              P +++I +  V   +F  +  LGE+A+  P+  GF  Y +R+++P+  FAI   YL 
Sbjct: 120 TGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLA 179

Query: 173 KYFILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSF 232
           ++ +L P +L AA++ I+YW   D++N   W+                        LS  
Sbjct: 180 QWLVLLPLELVAASITIRYW--NDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMV 237

Query: 233 KXXXXXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVY 292
           K                   P+   +G +YW +PGAF  +S        +F    +VFV 
Sbjct: 238 KILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAG-----SQFKGLCSVFVT 292

Query: 293 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS 352
           + FSY+GIE+T +  +E+ NP++++PKA K T + I V Y+  + L+G  V YNDPRLL+
Sbjct: 293 AAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLN 352

Query: 353 TKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 412
               S+ AAASP V+AI+N GI+ LP + NA +L+ + S  NS +Y  SR + ++A  G 
Sbjct: 353 GS-SSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGN 411

Query: 413 APKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 472
            PK  +K  + G P NA++L++ F  L+++  S    ++F +   +  +  I  W+ I +
Sbjct: 412 LPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINL 471

Query: 473 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDY 528
             I F  A +AQG    +  +++    +GA++ +    L+ L+ +F   L          
Sbjct: 472 SLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLV-LVASFWTSLFPVGSSTASA 530

Query: 529 KTFITGYIGLPVYIISWAGYKLIYKT--KVIKSTDVDLYTFKEIYD 572
           K+F  GY+ LP+ I  + G+KL  +    ++   ++DL + + + D
Sbjct: 531 KSFFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  239 bits (610), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 249/502 (49%), Gaps = 16/502 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            NT L KDL  RH+                         P +++I +  +   +F  +  
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+++  P+  GF  Y+ R+++P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N   W+                        LS  K                   P+  
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPGAF  +S+       +F    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N GI+ 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGGIKG 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  + G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S   A++F +   +  +  I  W+ I + +I F +A + Q     +  +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
               G+++  F  + + LI +F   L    G     ++F  GY+  P+ I+ + G+KL  
Sbjct: 494 TGVKGSWYG-FIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYT 552

Query: 553 K--TKVIKSTDVDLYTFKEIYD 572
           +  T ++K  D+DL T ++  D
Sbjct: 553 RNWTLMVKLEDMDLDTGRKQVD 574

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  239 bits (610), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 253/515 (49%), Gaps = 16/515 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            NT L KDL  RH+                         P +++I +  +   +F  +  
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+++  P+  GF  Y+ R+V+P+  FA+   YL ++ +L P +L AA++ I+YW   D
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--ND 199

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N   W+                        LS  K                   P+  
Sbjct: 200 KINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPGAF  +S+       +F    +VFV + FSY+GIE+T +  +E++NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I   Y+  + L+G  V  NDPRLL+    S+ AA+SP V+AI+N GI+ 
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLN-GSSSVDAASSPLVIAIENGGIKG 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ V S  NS +Y  SR + A+A  G  PK   +  + G P NA++L++ F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S   A++F +   +  +  I  W+ I + +I F +A + Q     +  +++ 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
               G+++  F  + + LI +F   L        + ++F  GY+  P+ I+ + G+K+  
Sbjct: 494 TGVKGSWYG-FIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 553 K--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEK 585
           +  T ++K  D+DL T ++  D       MK + +
Sbjct: 553 RNWTLMVKLEDIDLDTGRKQVDLALRREEMKVERE 587

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  239 bits (609), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 154/527 (29%), Positives = 255/527 (48%), Gaps = 24/527 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            N++ ++ +K+RH+ M                       P  +LI Y+ V ++ +  M  
Sbjct: 78  SNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQA 137

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F  Y+S ++  + GFA  + Y  ++  + P +L  A+L I+YW   
Sbjct: 138 AGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYW--N 195

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             +NP  +I                         S+ K                      
Sbjct: 196 SSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTG 255

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
             +G  YWR+PGAF        GG   G F     V V + FSY G+EL  +  +E  NP
Sbjct: 256 GYIGGEYWRNPGAF-------AGGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANP 308

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK+VP A K  +YRI++ Y+ T+ L+G  V YN   L+ + GKS +  ASP+V+A+ + G
Sbjct: 309 RKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKS-ATHASPYVIAVASHG 367

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           ++V+PHI NA +L+ V S  NS +Y + R L +LA  G APKIF+   R G P  AL+  
Sbjct: 368 VKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGC 427

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +F  L+++  S    ++F +   +  +  + +W  I + ++ F  A + QG   S+  Y
Sbjct: 428 SIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGY 487

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGY 548
            +    +G+ +A+FF I++  +  F V L     G K D + F   Y+  P++I  + GY
Sbjct: 488 KSKTGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGY 546

Query: 549 KLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
           K+  K    ++   ++DL + + I+D+   +   +D E +E+LK++G
Sbjct: 547 KIYSKEWKLLVPLDEIDLNSHRHIFDKHILQ--QEDDEHKEKLKNSG 591

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  238 bits (607), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 155/533 (29%), Positives = 266/533 (49%), Gaps = 31/533 (5%)

Query: 75  GKDENTR-LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
            K+ ++R L+  L++RHI +                       P A++I+Y  +  +V+ 
Sbjct: 48  AKESSSRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYP 107

Query: 134 TMACLGEMASYIPLD-------GFTSY-ASRYVDPALGFAIGYTYLFKYFILPPNQLTAA 185
            M   GEM  Y+P +       G+ +Y  S+YVD +LGFA  + Y + + +L   + TAA
Sbjct: 108 IMNMFGEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAA 167

Query: 186 ALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXX 245
           + +++YW S+  +   V I                       W +  K            
Sbjct: 168 SSIVEYWTSK--IPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAF 225

Query: 246 XXXXXXXPNHDR---LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT-GIE 301
                  PN++    +GF YW++P +F++Y T   G  G F+      +   F++  G E
Sbjct: 226 VIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVT--NGSLGNFLDVYNALIKGAFAFILGPE 283

Query: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKG-KSMSA 360
           L  +  SE  + R+++ KA +  VYR++ FY+     + + V YNDP LL+        A
Sbjct: 284 LVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGA 343

Query: 361 AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 420
            +SPFV+ IQN+GI +LPHI N C+L    SA N+ L+ S+R L  +  +G AP+IF++ 
Sbjct: 344 GSSPFVIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRI 403

Query: 421 SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 480
           +R GVPY AL LS++   LA++N S+ SAK+F +F N+ ++ G + W T  I Y+ F + 
Sbjct: 404 NRHGVPYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRT 463

Query: 481 CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPV 540
               G+   +  +   GQ Y  +++  F  ++ L   +   +   ++Y+ FI  YI LPV
Sbjct: 464 IDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPV 522

Query: 541 YIISWAGYKLIY-----KTKVIKSTD-VDLYT-FKEIYDREEEEGRMKDQEKE 586
           +++ + G+ +IY     + K  K  D +D+ T  +EI    E + ++ D+E++
Sbjct: 523 FLVLYFGH-IIYSGRWRQRKWWKPVDEIDVVTGLEEI----ELKTKIADEERQ 570

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  237 bits (604), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 256/508 (50%), Gaps = 19/508 (3%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
           ++++ LK+RH+ +                       P  +LI+Y  +   V+  M  L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 141 MASYIPLDGFTSY---ASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           M    P+ G  S    A  Y++  L F  G+   +   ++ P+++TA+ L+IQYW     
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTD--- 174

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN-HD 256
            N  ++++                      W+S  K                   PN H 
Sbjct: 175 ANSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHH 234

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS-EAENPRK 315
            LGF YW+ PGAFK + +  TG  GKF++     + S F++     T   CS EA+ PR+
Sbjct: 235 VLGFHYWKHPGAFKPHIS--TGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRR 292

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS-AAASPFVVAIQNSGI 374
           ++P+A    V+R+++FY+    ++G+ V Y++  LLS      S AAASPFV+ I+  GI
Sbjct: 293 NMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGI 352

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +VLPHI NA +L   +SA  +++Y +SR L+++A+ G APKIFA+ +R+GVPY ++I+  
Sbjct: 353 KVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPS 412

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI-DKSKFAY 493
            FC LAY+N S+ ++++F +  N+ ++ G +SW+ + I Y+ F +      + D+ KF  
Sbjct: 413 CFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLNDRIKFR- 471

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLP----VYIISWAGYK 549
             P QR  AYF+  F ++++L   + VF    +    F   YI +     ++I+  A YK
Sbjct: 472 -KPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYK 530

Query: 550 LIYKTKVIKSTDVDLYTFKEIYDREEEE 577
             ++ + ++    +L    ++ D EE  
Sbjct: 531 E-WRFRDMEEIRSELIPKIDMADEEESN 557

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  237 bits (604), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/537 (29%), Positives = 262/537 (48%), Gaps = 29/537 (5%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +++L KDL  RH+                         P ++++A+  V   +F  +  
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+A+  P+  GF  Y +R+V+P+ GFA+   YL ++ +L P +L AA++ I+YW   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYW--NN 201

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N   W+                        LS  K                   P+ +
Sbjct: 202 TINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGE 261

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G RYW DPGAF       T G+ +F    AVFV + FSY+G EL  +  +E+ NPR +
Sbjct: 262 YIGGRYWNDPGAF----VGDTPGR-RFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVT 316

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I + Y+  + ++G  V YND RLL+    S+ AAASP V+AI+N GI+ 
Sbjct: 317 LPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGN-SSVDAAASPLVIAIENGGIKG 375

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ + S  NS +Y  SR + A+A  G  PK      + G P  A+  +++F
Sbjct: 376 LPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIF 435

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S    ++F +   +  +  +  W +I + +I F +A +AQ    ++  +V+ 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSI 495

Query: 497 GQRYGAYFALFFCILI--ALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
              YG+++    CI+I   LI +F   L        D ++F  GY+ LP++I+ + G+K 
Sbjct: 496 TGVYGSWYG---CIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHK- 551

Query: 551 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFL 604
           +YK      +K+ D+DL       D    E  +   ++E RL+      + FY +FL
Sbjct: 552 VYKKDWRLYVKTKDMDL-------DTGRREIDLDILKQEIRLEREQMAQKPFYIRFL 601

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  237 bits (604), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 258/521 (49%), Gaps = 18/521 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           D + ++ KDL  RH+                         P +++I +  +   +F  + 
Sbjct: 91  DGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVN 150

Query: 137 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            LGE+A+  P+  GF  Y +R++DP+ GFA+   YL ++ +L P +L AA++ I+YW   
Sbjct: 151 SLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYW--N 208

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++N   W+                        LS  K                   P  
Sbjct: 209 DKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKG 268

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YW DPGAF   ++       KF    +VFV + FSY+G+ELT +  +E+ NPR+
Sbjct: 269 GYIGGKYWHDPGAFVGETSGT-----KFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRE 323

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++PKA K T + I + Y+  + L+G  V YN+P+LL+    S+ AA+SP V+AI+N GI 
Sbjct: 324 TIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGS-SSVDAASSPLVIAIENGGIR 382

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
            LP + NA +L+ + S  NS +Y  SR + ++A     P+   +  R G P NA +L++ 
Sbjct: 383 GLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLF 442

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  L+++  S    ++F +   +  +  I +W+ I + +I F +A   QGI   +  Y++
Sbjct: 443 FGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYIS 502

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
                G+++ +    L+ L+ +F   L    G   D  +F  GY+  P+ I+ + G+KL 
Sbjct: 503 MTGVSGSWYGVIVLFLV-LVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLY 561

Query: 552 YKTK--VIKSTDVDLYTFKEIYDRE--EEEGRMKDQEKEER 588
            + K  +I   D+DL + +++ D E   EE R++ ++  +R
Sbjct: 562 IRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKR 602

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  236 bits (602), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 161/604 (26%), Positives = 279/604 (46%), Gaps = 39/604 (6%)

Query: 2   KMPLKKMF-----------TSTSPRNSSSLDSDHDAYYSKQNP---DNFPVKEQEIYNID 47
           K PLKK +             T P N    + D  A+ ++Q P     FP+  +    ++
Sbjct: 3   KNPLKKEYWADVVDGFKPSAPTGPEN----EKDSSAFVTEQTPKTDSGFPLSAKGSSGVN 58

Query: 48  LEENNVXXXXXXXXXXXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXX 107
              N++                  V      NT L K+L  RH+                
Sbjct: 59  QTTNDITSSGRFHSDDD-------VQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVN 111

Query: 108 XXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAI 166
                    P +++I +  +   +F  +  LGE+++  P+  GF  Y+ R+V+P+  FA+
Sbjct: 112 TGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAV 171

Query: 167 GYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXX 226
              YL ++ +L P +L AA++ I+YW   D++N   W+                      
Sbjct: 172 NLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIAMANMLDVKSFGETE 229

Query: 227 XWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSF 286
             LS  K                   P+   +G +YW DPGAF  + +       KF   
Sbjct: 230 FVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHDSGT-----KFKGL 284

Query: 287 VAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYN 346
            +VFV + FSY+GIE+T +  +E++NPR+++PKA K T + I + Y+  + L+G  V  N
Sbjct: 285 CSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSN 344

Query: 347 DPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYA 406
           DPRLL+    S+ AA+SP V+AI+N  I+ LP + NA +L+ V S  NS +Y  SR + A
Sbjct: 345 DPRLLN-GSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVA 403

Query: 407 LAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILS 466
           +A  G  PK   +  + G P NA++L++ F  L+++  S   A++F +   +  +  I  
Sbjct: 404 MAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFC 463

Query: 467 WITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAY--FALFFCILIALIKNFTVFLGH 524
           W+ I + +I F +A + Q     +  +++    +G+   F + F +LIA        +G 
Sbjct: 464 WMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGS 523

Query: 525 K-FDYKTFITGYIGLPVYIISWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMK 581
              + ++F  GY+  P+ I+ + G+K+  +    ++K  D+DL T ++  D       MK
Sbjct: 524 SGANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVDLNLRRQEMK 583

Query: 582 DQEK 585
            +++
Sbjct: 584 IEQE 587

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  236 bits (603), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 153/527 (29%), Positives = 260/527 (49%), Gaps = 24/527 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
            +++  L+K +K RH+ M                       P A++I YA +G  ++  +
Sbjct: 114 NEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCII 173

Query: 136 ACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GE+A  Y  L+G F +Y S  VDPALGF++ + Y  ++  + P +L  A++ I+YW 
Sbjct: 174 QAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWT 233

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           ++  V+P V++                       + +  K                    
Sbjct: 234 TK--VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAG 291

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKG--KFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
           N   LG +YW DPGAF        G K   +F   +  FV + F++   E   +  +E  
Sbjct: 292 NDGYLGAKYWHDPGAFN-------GDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQS 344

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK++P A K  +YRI+  +L ++ L+G  V YN  +LL + G  + A  SP+V+A+ +
Sbjct: 345 NPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKA--SPYVIAVSS 402

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G+ V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    R G P+ A++
Sbjct: 403 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAML 462

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +S LF  +A+   S    ++F++ + +  +  + +WITI + +I F +A + QG    + 
Sbjct: 463 MSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEV 522

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAG 547
            Y++    YG+ +A    + +ALI  F V +      K D + F   Y+ +P+ I  + G
Sbjct: 523 GYLSQSGVYGSAYAAIM-LFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFG 581

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           Y++  +     I++ D+DL T ++I+D  E   R +D+E +E+L++ 
Sbjct: 582 YRVWKRDWKLFIRAKDIDLDTHRQIFD--ENILRQEDEEYKEKLRNG 626

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  235 bits (599), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 254/527 (48%), Gaps = 23/527 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
            D+N  L+K +K+RH+ M                       P +++I Y  V  + ++ +
Sbjct: 73  SDDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVI 130

Query: 136 ACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA   P    GF +YAS +V    GFA  + +  ++  + P +L  A++ I+YW 
Sbjct: 131 QAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW- 189

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
             D++N  V++                         +S K                    
Sbjct: 190 -NDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAG 248

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +G +YWRDPGAF   + A    + K V+FV V  Y  FSY G+EL  +  +E ENP
Sbjct: 249 VDGYIGGKYWRDPGAFASDNAA---SRFKGVAFVLVTAY--FSYGGVELFALSVNEQENP 303

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R+S P A K ++YRI++ YL T+ L+G  V +N  +L+   G +  A  SP+V+A+   G
Sbjct: 304 RRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHA--SPYVLAVSIHG 361

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           ++V+PHI NA +L+ V S  NS LY S R L +LA  G APK F    R G P  ALIL 
Sbjct: 362 VKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILC 421

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +F  +A+   S     IF +   +  +  + +W +IL+ ++ F  A +AQG   ++  Y
Sbjct: 422 SIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGY 481

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL---GHK--FDYKTFITGYIGLPVYIISWAGY 548
           ++    +G+ +  FF +L+  I  F V L   G K  +  + F   Y+  PV++  + GY
Sbjct: 482 ISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540

Query: 549 KLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
            L  +  T +     +DL   + +YD E    R +D+E +ER+++ G
Sbjct: 541 MLYSRDFTFLTDLKKIDLDNHRRLYDPELL--RQEDEETKERIRNGG 585

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 149/510 (29%), Positives = 249/510 (48%), Gaps = 18/510 (3%)

Query: 71  AVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           A+ +    +  L +DL  RH+                         P +++IA+  +   
Sbjct: 60  AIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTC 119

Query: 131 VFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           +F  +  LGE+A+  P+  GF  Y +R VDP+LGFA+   YL ++ +L P +L AA++ I
Sbjct: 120 LFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITI 179

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW   + VN   W+                        LS  K                
Sbjct: 180 RYW--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLIC 237

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309
              P +  +G +YW DPG+F   S        +F    +VFV + FSY+G EL G+  +E
Sbjct: 238 GGGPKNGYIGAKYWNDPGSFVGASPG-----SQFKGLCSVFVTAAFSYSGTELVGVSAAE 292

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 369
           + NPR ++PKA K T + I + YL  + ++G  V ++DP+LLS    S+  AASP V+AI
Sbjct: 293 SANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSAS-SSVDVAASPLVIAI 351

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
           +N GI+ LP + NA +L+ + S  NS +Y  SR + ++A  G  P+IF      G P  A
Sbjct: 352 ENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVA 411

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 489
           +I +++F  L+++  S+   +IF +   +  +  +  W+ I I +I F +A   QG    
Sbjct: 412 IIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLD 471

Query: 490 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISW 545
           +  Y++     G+++     IL+ LI +F   L        D+++F  GY+ LP+++  +
Sbjct: 472 ELPYLSMTGVIGSWYGCVVIILV-LIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCF 530

Query: 546 AGYKLIYKTK---VIKSTDVDLYTFKEIYD 572
            G+KL YK     +I+S  +D+ T + + D
Sbjct: 531 VGHKL-YKRNWSWMIRSNKIDVNTGRRMID 559

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/529 (30%), Positives = 255/529 (48%), Gaps = 21/529 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D    +T + + LK+RH+                         P  +LI+Y+ +   V+ 
Sbjct: 56  DTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWA 115

Query: 134 TMACLGEMASYIPLDGFTSYAS---RYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
            M  + EM   IPL G +S AS    Y++    F  G+   +   ++ P ++TA AL+I+
Sbjct: 116 IMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIE 175

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW      N  +++T                       +S  K                 
Sbjct: 176 YWTD---ANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFG 232

Query: 251 XXP-NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGI-ELTGIVCS 308
             P  H  LGF YW  PGAF  Y   + G  G F++     + S F++  I E+T    +
Sbjct: 233 GGPAQHKVLGFHYWNTPGAFNSY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSA 290

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS--TKGKSMSAAASPFV 366
           EA  PRK++P+A +  VYR+ VFY+    ++G+ V Y++  L    + GK+ +AAASPFV
Sbjct: 291 EAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKA-NAAASPFV 349

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           + IQ +GI +LPHI NAC+L   +S   S+LY +SR L++LA+ G APK F+K +++GVP
Sbjct: 350 IGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVP 409

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
           Y ++  + LF  LAY+N S  S  +FN+  N+ ++ G ++W+ + I Y+ F K      I
Sbjct: 410 YYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKI 469

Query: 487 DKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWA 546
           +  +  Y   GQR  AY +  F  L+A+   F VF+   ++   F T Y+ +    + + 
Sbjct: 470 ND-RVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFI 528

Query: 547 GYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKN 595
           G  + YK    +  DV     +EI  + ++     DQE++E      KN
Sbjct: 529 GSSIYYKEWTFRDMDV---VGREIMPKIDQ----ADQEEKEEYLPPPKN 570

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  235 bits (599), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 151/526 (28%), Positives = 257/526 (48%), Gaps = 22/526 (4%)

Query: 77  DE-NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           DE N +L+K ++ RH+ M                       P  ++I YA +   ++  +
Sbjct: 93  DELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCII 152

Query: 136 ACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
             +GEMA +Y+ L  GF +Y    VDPAL F+I + Y  ++F + P +L  A++ IQYW 
Sbjct: 153 QAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWT 212

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWL-SSFKXXXXXXXXXXXXXXXXXXX 252
           ++  VN  +++                       ++ +S K                   
Sbjct: 213 TK--VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGA 270

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            N   +G +YWRDPGAF+      + G  +F   V+  V + FS+   E   I  SE  N
Sbjct: 271 GNDGFIGGKYWRDPGAFRG-----SDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSN 325

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK++P A K  +YR ++ YL ++ ++G+ V Y+   LL +   S +  ASP+V+A+   
Sbjct: 326 PRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSS--SAATKASPYVLAVSTH 383

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G+ V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APK+F    R G P    ++
Sbjct: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
             +   +A+   SS   ++FN+ + +  +  + +W  I + +I F +A + QG    +  
Sbjct: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFT--VFLGH-KFDYKTFITGYIGLPVYIISWAGYK 549
           Y +    +G+ +A    ILI + + +   V +G    D + F   Y+ +PV+I+ + GYK
Sbjct: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563

Query: 550 LIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
            I+K      I++ D+DL + + I+D E    R + +E +E+L++ 
Sbjct: 564 -IWKRDWRLFIRAKDIDLISHRHIHDPEIL--RQEREEYQEKLRNG 606

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  234 bits (596), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 249/521 (47%), Gaps = 22/521 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +  N+ L+  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 75  RTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 134

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE+A   P+ G FT+YA+R++D + GFA    Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 135 MALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT 194

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
             R   G ++                         S  K                   P 
Sbjct: 195 NPRYRDG-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPV 253

Query: 255 HDRLGFRYWRDP-GAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
              +G RYW  P GAF   S        +F    +VFV + FS+ G EL G+  +E  NP
Sbjct: 254 KGYIGGRYWHHPYGAFVGDSAG-----ARFKGVCSVFVTAAFSFAGSELVGLASAETANP 308

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RKSVPKA K   +RI +FYL  + ++G+ V Y + RL+     S+ AAASPFV+AI   G
Sbjct: 309 RKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGAS--SVDAAASPFVIAITTHG 366

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I  LP + N  +L+ V S  NS +Y  SR L ALA     PK F    R G P  +++++
Sbjct: 367 IRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVT 426

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
             F  +A++  S    ++FN+ + +  +  + +W  I + +I F KA  AQG    + ++
Sbjct: 427 SGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSF 486

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKL 550
           V+P   YG+Y+ LF  IL+  I  F V L   G K + K F   Y+  P+ I  + G+K 
Sbjct: 487 VSPAGVYGSYWGLFMIILM-FIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHK- 544

Query: 551 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           IYK      IK+ D+D+ T +    ++++   ++ +  EER
Sbjct: 545 IYKKNWKIFIKAEDMDIDTGR----KDDDLDLLRQEVAEER 581

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  234 bits (597), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/524 (28%), Positives = 252/524 (48%), Gaps = 23/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +++L+K +K+RH+ M                       P A++I Y  V  + ++ +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQA 146

Query: 138 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA   P     F +Y+S ++  + GFA  + Y F++  + P +L  A++ IQ+W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW--N 204

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++NP ++I                         +  K                    N 
Sbjct: 205 DKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGND 264

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G  YW +PGAF    T+I    G+F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGATYWHNPGAFAG-DTSI----GRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRK 319

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P A K ++YRI+V YL T+ L+G  V YND +L+   G +  A  SP+V+A    G++
Sbjct: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           ++PHI NA +L+ V S  NS LY   R + +LA  G APK      R G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
               +G+ + +FF IL+  +  F V L     G K D ++F   Y+  P+++  + GY +
Sbjct: 498 TTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGY-M 555

Query: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           +Y    T +     +DL   + IYD E    R +D+E +E+L++
Sbjct: 556 VYNRDFTLLNPLDKIDLDFHRRIYDPELM--RQEDEENKEKLRN 597

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  233 bits (595), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 168/608 (27%), Positives = 278/608 (45%), Gaps = 49/608 (8%)

Query: 10  TSTSPRNSSSLDS-----DHDAYYSKQN--PDNFPVKEQEIYNIDLEENNVXXXXXXXXX 62
           +S +P  ++S+DS     DH    S+     D+F   E+E  + +L E            
Sbjct: 35  SSLTPTTTASIDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEAE---------- 84

Query: 63  XXXXXXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLI 122
                   A+   K     L+  LK RH+ M                       P  ++I
Sbjct: 85  ------RIAINTAK---APLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVI 135

Query: 123 AYAFVGLLVFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQ 181
            +     +++  +  LGE+A   P+ G FT+YA+R++D + GFA  + Y  ++    P +
Sbjct: 136 GWGLTSTMIYCMVMALGELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLE 195

Query: 182 LTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXX 241
           + +A++ + YW + +R   G ++                         S+ K        
Sbjct: 196 IVSASITVNYWQTPERYRDG-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFI 254

Query: 242 XXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIE 301
                      P    +G RYW +PGAF   +        +F    +VFV + FS+ G E
Sbjct: 255 ILGIVLVAGGGPEGGFVGGRYWHNPGAFVGDNAGT-----QFKGVCSVFVTAAFSFAGSE 309

Query: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 361
           L GI  +EA NPRKSVP+A K  V+RI++FY+ ++ ++G+ V Y DPRL+     S+ A+
Sbjct: 310 LVGITAAEAANPRKSVPRAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGAS--SVDAS 367

Query: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421
           ASPFV+AI   GI  LP + N  +L+ V S  NS ++  SR + AL+  G  P+IF    
Sbjct: 368 ASPFVIAIVTHGIRGLPSVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYID 427

Query: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481
           R G P   +I+   F  +A++  S    ++F + + +  +  + +W  I + +I F  A 
Sbjct: 428 RKGRPLVGIIVISTFGLIAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMAL 487

Query: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGL 538
           +AQG   ++  +V+P    G+ + LF  +L+  I  F V L   G K   + F   Y+  
Sbjct: 488 KAQGRSTNELPFVSPAGIIGSSWGLFMLLLM-FIAQFYVALFPPGSKPSAEVFFESYLSF 546

Query: 539 PVYIISWAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKN 595
           P+ +  + G+K IYK      IK+ D+D+ T      R E +  +  QE EE  K+    
Sbjct: 547 PIVLAFYFGHK-IYKKNWKLFIKAEDMDIDT-----GRRETDLELLKQEIEEE-KAILAT 599

Query: 596 MEWFYEKF 603
             W+Y ++
Sbjct: 600 KGWWYRQY 607

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  234 bits (597), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 157/595 (26%), Positives = 266/595 (44%), Gaps = 22/595 (3%)

Query: 7   KMFTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXX 66
           K    +  +  S++    D++     P++  +   E+      EN +             
Sbjct: 55  KDLNPSDKKKKSNIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGITTSVSPSAPNLRK 114

Query: 67  XXXFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAF 126
                 P   ++N  L++ ++ RH+ M                       P  ++I Y+ 
Sbjct: 115 LNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSI 174

Query: 127 VGLLVFYTMACLGEMA---SYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183
           +G +++  +   GEMA   S +P  G+  Y S  V+   GFAI + Y  ++  + P +L 
Sbjct: 175 MGSIIYCIIQATGEMAIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELV 233

Query: 184 AAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXX 243
            A+L I+YW +   VN  +++                       + +  K          
Sbjct: 234 TASLTIKYWTTS--VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFIL 291

Query: 244 XXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELT 303
                     N   LG  YW  PGAF+  S+        F       V + F+Y G E  
Sbjct: 292 SITITAGGAGNDGYLGGLYWHTPGAFRGDSSI-----DHFKGICGTLVTAAFAYGGTEFL 346

Query: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 363
            +  +E  NPR ++P A K  +YRII  YL ++ ++G  V ++  RLL + G + SA  S
Sbjct: 347 ALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSA--S 404

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           P+V+A    G+ V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    R 
Sbjct: 405 PYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDRE 464

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           G P  A+++S LF  +A+   S    ++F + + +  +  + +W  I + +I F  A + 
Sbjct: 465 GRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKV 524

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLP 539
           QG    +  Y+A    +G+++ALF   LI  I  F V +      +   + F   Y+ +P
Sbjct: 525 QGRSLGEVGYLAQTGVWGSWYALFMMFLI-YIAQFWVAIAPIGSGELSAQNFFENYLAMP 583

Query: 540 VYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           + I+ + GYK+ YK  T +IK+ D+DL + ++I+D  E+  + +D E  +RLK+ 
Sbjct: 584 ILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFD--EDLLKEEDFEYRQRLKNG 636

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  235 bits (599), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 153/528 (28%), Positives = 249/528 (47%), Gaps = 22/528 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +D N  LR+ +K RH+ M                       P  ++I Y  +G  ++  +
Sbjct: 153 EDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCII 212

Query: 136 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA +Y  L G F ++ S  VDP   FA+ + Y  ++  + P +L  A++ IQYW 
Sbjct: 213 QACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWT 272

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           ++  V+P V++                         ++ K                    
Sbjct: 273 TK--VDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAG 330

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +G +YW DPGAF+   T I     +F   +  FV + F++   E   +  +E  NP
Sbjct: 331 TDGYIGAKYWNDPGAFRG-QTKIE----RFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 385

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK++P A K  +YR++V +L T+ L+G  V Y+  +LL + G +  A  SP+V+AI   G
Sbjct: 386 RKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKA--SPYVLAISLHG 443

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           + V  H  NA +L+ V S  NS  Y SSR L +LA  G APKIF    R G P  A+  S
Sbjct: 444 VRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCS 503

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +   +A+   S    ++F + + +  +  + +W  I + ++ F +A + QG    +  Y
Sbjct: 504 AVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGY 563

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYK 549
           ++     G+ +A    IL ALI  F V L     H  D  +F + Y+ +P+ I+ + GYK
Sbjct: 564 LSQTGILGSLYAAIMMIL-ALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYK 622

Query: 550 LIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
            I+K      I++ D+DL + + IYD  EE  R +D+E  E+L++  K
Sbjct: 623 -IWKRDWRLFIRAKDIDLISHRTIYD--EELLRQEDEEYREKLRNGPK 667

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 159/533 (29%), Positives = 252/533 (47%), Gaps = 24/533 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T+L+K +K+RH+ M                       P  ++IAY  V  + ++ +   
Sbjct: 72  DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAA 131

Query: 139 GEMASYIP-LDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEMA   P L G F +Y S ++    GFA  + +  ++  + P +L  AA+ +QYW   D
Sbjct: 132 GEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYW--ND 189

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N  V++                         +  K                    N  
Sbjct: 190 SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPGAF   + A     G+F     V V + FSY G+EL  +  +E ENPR+S
Sbjct: 250 YIGAKYWHDPGAFTSDTNA-----GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
            P A K ++YRI+V YL T+ L+G  V  N   L+ + G    A  SP+V+A    G++V
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHA--SPYVLAASIHGVKV 362

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           +PHI NA +L+ + S  NS LY + R + ALA  G APK      R G P  ALI+  +F
Sbjct: 363 VPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVF 422

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             + ++  SS   ++FN+   +  +  + +W  I+I +I F +A + Q     +  Y +P
Sbjct: 423 GVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSP 482

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKLIY 552
              YG+YF +FF +L+  +  F V L      +    TF   Y+  P++   + GY +I+
Sbjct: 483 FGVYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGY-MIW 540

Query: 553 KTKVIKSTD---VDLYTFKEIYDREEEEGRMKDQEKEERLKSNG--KNMEWFY 600
           K      +D   VDL   + IYD E    + +D+EK+E LK++   K M +F+
Sbjct: 541 KRDFTLFSDLESVDLDYHRRIYDPELV--KQEDEEKKEMLKNSPMWKRMYYFW 591

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 147/520 (28%), Positives = 256/520 (49%), Gaps = 16/520 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           + + L KDL  RH+                         P +++I +  V   +F  +  
Sbjct: 85  DGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINS 144

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+A+  P+  GF+ Y +R++DP++ F+I   YL ++ +L P +L AA++ I+YW   D
Sbjct: 145 LGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--ND 202

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N   W++                       LS  K                   P   
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPGAF  ++        +F    +VFV + FSY+GIE+  +  +E+ +PRK+
Sbjct: 263 YIGGKYWHDPGAFVGHTAG-----SQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKT 317

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +P A K T + I   Y+  + L+G  V Y+DPRLL+    S+  A+SP V+AI+N GI+ 
Sbjct: 318 IPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGS-SSVDVASSPLVIAIENGGIKG 376

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ V S  NS +Y  SR + ++AI G  PK   +  + G P NA ++++ F
Sbjct: 377 LPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFF 436

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             ++++  S   A++F +   +  +  I  W+ I I +I F +A   QG    +  Y++ 
Sbjct: 437 GLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQ 496

Query: 497 GQRYGAYFA--LFFCILIALIKNFTVFLG-HKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
              YG+++   + F +LIA        +G  + +  TF  GY+ LP+ +  + G+K  +K
Sbjct: 497 VGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFK 556

Query: 554 TKVIKS--TDVDLYTFKEIYDRE--EEEGRMKDQEKEERL 589
              + +   ++DL + K   D E   EE +M++   +++L
Sbjct: 557 NWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKKQL 596

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  232 bits (592), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 155/595 (26%), Positives = 271/595 (45%), Gaps = 44/595 (7%)

Query: 9   FTSTSPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXX 68
           F     +N+S + S      S +N D      +E+ +++++EN V               
Sbjct: 53  FKRAEQQNNSEITSAASCDGSSENLDK---DGKEVADLEVQENQVL-------------- 95

Query: 69  XFAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVG 128
                    +N  L++ +K RH+ +                       P  +LI Y+ +G
Sbjct: 96  ---TEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMG 152

Query: 129 LLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAA 186
             ++  +   GE+A SY  L G F  Y S  VDPA GF++ + Y  ++  + P +L  A+
Sbjct: 153 TCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTAS 212

Query: 187 LVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXX 246
           + I+YW +   VN  +++                       + +  K             
Sbjct: 213 MTIKYWTTT--VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIV 270

Query: 247 XXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTG 304
                  N   +G RYW  PGAF        G +    F   +A  V + F++   E   
Sbjct: 271 INTGGAGNDGYIGDRYWHTPGAF-------AGDRPIDHFKGIMATMVTAAFAFGATEFIA 323

Query: 305 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 364
           +  +E  NPRK++P A K  +YRI+  +L ++ L+G  V Y+  +L+ + G +  A  SP
Sbjct: 324 LTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKA--SP 381

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           +V+A+   G++V+PH  NA +L+ V S  NS  Y SSR LY+LA  G APK F    R G
Sbjct: 382 YVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREG 441

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
            P+ A++ + +F  +++   S    ++F + + +  +  + +W  I + +I F KA   Q
Sbjct: 442 RPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQ 501

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPV 540
                +  + A    +G+Y+  F  ++I LI  F V +      K D + F   Y+ +P+
Sbjct: 502 KRSLGEIGFKAQTGVWGSYYVCFMLVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPI 560

Query: 541 YIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
            I+ + GYK+  K  +  I++ ++DL   ++I+D  EE  + +D+E  E+LK+ G
Sbjct: 561 LILFYVGYKIWKKDWSLFIRANNIDLDKHRQIFD--EELLKQEDEEYREKLKNGG 613

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  231 bits (590), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 245/528 (46%), Gaps = 20/528 (3%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P    ++  L+K ++ RH+ M                       P  +LI YA +G +++
Sbjct: 107 PHTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILY 166

Query: 133 YTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +   GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+
Sbjct: 167 CIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIK 226

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW +   VNP V++                       + +  K                 
Sbjct: 227 YWTTS--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVG 284

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
              N   +G +YW +PGAF            +F   VA  V + F++ G E   I  +E 
Sbjct: 285 GAGNDGYIGGKYWHEPGAFNGVHAI-----DRFKGVVATLVTAAFAFGGSEFIAITTAEQ 339

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK++P A K  +YRI+  +L T+ ++G  V YN  +LL + G    A  SP+V+AI 
Sbjct: 340 SNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKA--SPYVIAIA 397

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           + G+ V PH  NA +L+ V S  NS  Y S+R    L+  G APKIF+   R G P  A+
Sbjct: 398 SHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAM 457

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            +S LF  +A+   S    ++F + + +  +  + +W  I + +I F +A + QG    +
Sbjct: 458 CVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGE 517

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWA 546
             + +    +G+ ++    ILI LI  F V +      K D + F   Y+ +P+ I+ + 
Sbjct: 518 LGFKSQTGVWGSIYSCIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYV 576

Query: 547 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           GYK+  K     I++  +DL + ++I+D  EE  + +D E  ERL++ 
Sbjct: 577 GYKMWNKDWKLFIRADKIDLTSHRQIFD--EELIKQEDDEYRERLRTG 622

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  231 bits (590), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 246/528 (46%), Gaps = 20/528 (3%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P   +++  L+K ++ RH+ M                       P  +LI YA +G +++
Sbjct: 107 PPAGNKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILY 166

Query: 133 YTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +   GE+A  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+
Sbjct: 167 CIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIK 226

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW +   VNP V++                       + +  K                 
Sbjct: 227 YWTTS--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVG 284

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
              N   +G +YW DPGAF    +       +F   VA  V + F++ G E   I  +E 
Sbjct: 285 GAGNDGFIGGKYWHDPGAFNGKHSI-----DRFKGVVATLVTAAFAFGGSEFIAITTAEQ 339

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK++P A K  +YRI+  +L T+ +LG  V YN  +LL + G    A  SP+V+AI 
Sbjct: 340 SNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKA--SPYVIAIA 397

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           + G+ V+PH  NA +L+ V S  NS  Y S+R    L+  G APK F+   R G P  A+
Sbjct: 398 SHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAM 457

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            +S LF  +A+   S    ++F + + +  +  + +W  I   +I F +A + QG    +
Sbjct: 458 GVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGE 517

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWA 546
             + +    +G+ +A    +LI LI  F V +      K D + F   Y+ +P+ I  + 
Sbjct: 518 LGFKSQTGVWGSMYACIMMLLI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

Query: 547 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           GYK+  K     I++  +DL + ++I+D  EE  + +D+E  ERL++ 
Sbjct: 577 GYKIWTKDWKLFIRADKIDLESHRQIFD--EELIKQEDEEYRERLRNG 622

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  231 bits (590), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 246/524 (46%), Gaps = 20/524 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           +++  L+K ++ RH+ M                       P  +LI Y  +G +++  + 
Sbjct: 111 NKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQ 170

Query: 137 CLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+YW +
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VNP V++                       + +  K                    N
Sbjct: 231 S--VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW DPGAF    +       +F   VA  V + F++ G E   I  +E  NPR
Sbjct: 289 DGFIGGKYWHDPGAFNGKHSI-----DRFKGVVATLVTAAFAFGGSEFIAITTAEQANPR 343

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K+VP A K  +YRI+  +L T+ LLG  V YN  +LL + G    A  SP+V+A+ + G+
Sbjct: 344 KAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKA--SPYVIAVASHGV 401

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
            V+PH  NA +L+ V S  NS  Y S+R L  L+  G AP++F    + G P  A+ +S 
Sbjct: 402 RVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSA 461

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           LF  +A+   S    ++F + + +  +  + +W  I + +I F +A + QG    +  + 
Sbjct: 462 LFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFR 521

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKL 550
           +    +G+ +A    ILI LI  F V +      K D + F   Y+ +P+ I  + GYK+
Sbjct: 522 SQTGVWGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKI 580

Query: 551 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
             K     I++  +DL + ++I+D  EE  + +D+E  ERLK+ 
Sbjct: 581 WKKDWKLFIRADKIDLISHRQIFD--EELIKQEDEEFRERLKNG 622

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  231 bits (589), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 149/523 (28%), Positives = 247/523 (47%), Gaps = 20/523 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           ++  L+K ++ RH+ M                       P  +LI YA +G +++  +  
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 138 LGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA  Y  L  G+ +Y S  VD   GFA+ + Y  ++  + P +L  A++ I+YW + 
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             VNP V++                       + +  K                    N 
Sbjct: 232 --VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGND 289

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YW DPGAF     AI     +F    A  V + F++ G E   I  +E  NPRK
Sbjct: 290 GFIGGKYWHDPGAFNG-KHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRK 344

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A K  +YRI+  +L T+ LLG  V YN  +LL + G    A  SP+V+A+ + G+ 
Sbjct: 345 AIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKA--SPYVIAVASHGVR 402

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           V+PH  NA +L+ V S  NS  Y S+R    L+  G APK+F+   R G P  A+ +S L
Sbjct: 403 VVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSAL 462

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  +A+   S    ++F + + +  +  + +W  I + ++ F +A + QG    +  + +
Sbjct: 463 FAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKS 522

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKLI 551
               +G+ +A    ILI LI  F V +      K D + F   Y+ +P+ I  + GYK+ 
Sbjct: 523 QTGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVW 581

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           +K     I++  +DL + ++I+D  EE  + +D+E  ERL++ 
Sbjct: 582 HKDWKLFIRADKIDLDSHRQIFD--EELIKQEDEEYRERLRNG 622

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  230 bits (586), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 257/536 (47%), Gaps = 18/536 (3%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           PD   ++  L++++K RH+ M                       P ++LI YA V  +++
Sbjct: 78  PDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLY 137

Query: 133 YTMACLGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +    E+A  Y  L G F +Y +  VD A  F++ + Y  ++  + P +L  A++ I+
Sbjct: 138 CVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIK 197

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW   D +NP  ++                       + ++ K                 
Sbjct: 198 YW--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCG 255

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
              N   LG  YW DPGAF+        G  +F   VAV V + F+Y G E + +  +E 
Sbjct: 256 GAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           +NP+KS+  A K  VYRII  YL T  LLG  V YN P LL +   S +  ASPFV+AI 
Sbjct: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSG--SAATHASPFVIAIA 368

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           + G++V+PHI NA +L+ V S  NS LY SSR L +L+  G APK+F    R G P   L
Sbjct: 369 SHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCL 428

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           ++S +F  L ++  S     +F + + +  +  + +W +I + ++ F ++   QG    +
Sbjct: 429 LVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDE 488

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWA 546
             Y +    +GAY+A+   +LI LI  F V +     +K D   F   Y+ +P+ I  + 
Sbjct: 489 LGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYL 547

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600
           GYKL Y+    +I + +VDL + ++I+D E  +    +++++ R  S  K    F+
Sbjct: 548 GYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFW 603

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  231 bits (589), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 154/527 (29%), Positives = 251/527 (47%), Gaps = 23/527 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           + K EN  L+K +K RH  M                       P  ++I YA +G  V+ 
Sbjct: 139 EQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 134 TMACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GE+A      + GF +Y    VDPALGF++ + +  ++  + P +L  A++ I+Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W +   VNP V++                       + +  K                  
Sbjct: 257 WTTS--VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGG 314

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
                 +G +YWRDPGAF+   T I     +F   VA FV + F++   E   +  SE  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQ----RFKGVVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +  A  SP+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKA--SPYVIAVSS 427

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G+ V+PH  NA +L+ V S  N   Y SSR L +LA  G APK F    R G P  A++
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAML 487

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +S LF  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    + 
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWA 546
            Y +    +G+ +A+   +L ALI  F V +     G K   ++F   Y+ +P++I  + 
Sbjct: 548 GYKSQVGVWGSAYAVLMMVL-ALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYI 606

Query: 547 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
            YK+  K  +  I +  VDL + + I+D  EE  + +D+E +ERL++
Sbjct: 607 FYKVWKKDWSLFIPADKVDLVSHRNIFD--EELLKQEDEEYKERLRN 651

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  231 bits (589), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 151/526 (28%), Positives = 252/526 (47%), Gaps = 22/526 (4%)

Query: 76  KDENTR-LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           +D+N   L+K +K RHI M                       P  ++I YA +G  ++  
Sbjct: 136 QDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCI 195

Query: 135 MACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           +   GE+A      + GF +Y S  VDPALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 196 IQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYW 255

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
             +  V+P V++                       + +  K                   
Sbjct: 256 TVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGA 313

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +G RYW +PGAF+  +     G  +F   VA FV + F++   E   +  SE  N
Sbjct: 314 GTDGYIGSRYWHNPGAFRGNT-----GIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSN 368

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ + 
Sbjct: 369 PRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSA--TKASPYVIAVASH 426

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G+ V+PH  NA +L+ V S  N   Y SSR L +LA  G APK F    R G P  A+++
Sbjct: 427 GVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLV 486

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S +F  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    +  
Sbjct: 487 SSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVG 546

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAG 547
           Y +    +G+ +A+   +L ALI  F V +     G K   ++F   Y+ +P+ I  +  
Sbjct: 547 YKSQVGIWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVF 605

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           YK+  K  T  I +  +DL T ++I+D  EE  + +D+E +E+L++
Sbjct: 606 YKVWKKDWTLFIPADKIDLVTDRQIFD--EELLKQEDEEYQEKLRN 649

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  229 bits (583), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/524 (28%), Positives = 249/524 (47%), Gaps = 19/524 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +  +  L+K +K+RH+ M                       P A++I Y  V  + ++ +
Sbjct: 60  ESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMI 119

Query: 136 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA +Y  L G F +Y S ++   +GFA  + +L ++  + P +L    + IQYW 
Sbjct: 120 QAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW- 178

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
             D +N  VWI                         ++ K                    
Sbjct: 179 -NDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAG 237

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +G +YW++PG+F   ++A     G+F     V V + FSY G EL  +  +E  NP
Sbjct: 238 TDGYIGAKYWKNPGSFASSTSA-----GRFKDVCYVLVTAYFSYGGTELYVLSVNEQANP 292

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R+S PKA K ++YRI++ YL T+ L+G  V +++ +L+   G S  A  SP+V+A    G
Sbjct: 293 RRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHA--SPYVLAASIHG 350

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           ++V+PHI NA +L+ V S  NS LY + R   +LA  G APK  A   R G P  AL   
Sbjct: 351 VKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAAC 410

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +   +A+   SS   ++F +   + ++  + +W TIL+ +I F  A + QG D ++  Y
Sbjct: 411 AVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGY 470

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKL 550
            A    +G+ +   FC+L+  I  F V L   G     + F   Y+  P+++  +  Y L
Sbjct: 471 KALTGVWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYML 529

Query: 551 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
             +  T + K  D+DL   + IYD E    R +D+E++E+++++
Sbjct: 530 WKRDFTFLTKLEDIDLDAHRRIYDPEFL--RQEDEERKEKIRNS 571

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  229 bits (585), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/523 (27%), Positives = 247/523 (47%), Gaps = 22/523 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N +L+K ++ RH+ M                       P  ++I YA +   ++  M  +
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 139 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEMA +Y+ L  GF++Y    +DP L FA+ + Y  ++F + P +L  A++ IQYW ++ 
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTK- 214

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSF-KXXXXXXXXXXXXXXXXXXXPNH 255
            VN  +++                       +  +  K                    N 
Sbjct: 215 -VNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNS 273

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G RYW  PGAF+        G  +F   V+  V + F++ G E   I  SE  NPRK
Sbjct: 274 GFIGARYWHSPGAFRG-----DNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRK 328

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A K  +YR ++ Y+ ++ ++G  V YN   LL + G +  A  SP+V+A+ + GI 
Sbjct: 329 AIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKA--SPYVIAVASHGIR 386

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           V+PH  NA +L+ VFS  +S  Y SSR L  LA  G APKIF    + G P    ++  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              +++   SS  A +FN+ +++  +  + +W  I + +I F +A + QG    +  + +
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
               +G+ +A    IL+ LI  F V +        D  +F   Y+ +PV+I+ + GYK+ 
Sbjct: 507 QAGVWGSVYAFVMMILV-LIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 552 YKT--KVIKSTDVDLYTFKEIYDRE---EEEGRMKDQEKEERL 589
            +     I++ ++DL   + IYD E   +E   M+++ +   L
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPL 608

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 146/533 (27%), Positives = 258/533 (48%), Gaps = 26/533 (4%)

Query: 74  DGKDE----NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 129
           DG D     + +L+K +K+RH+ M                       P  ++I YA +G 
Sbjct: 84  DGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGS 143

Query: 130 LVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            ++  +   GE+A  Y  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A++
Sbjct: 144 CLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASI 203

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
            I+YW +   VNP +++                       + ++FK              
Sbjct: 204 TIKYWTTS--VNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIV 261

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGI 305
                 N   +G +YW DPG+F       +G K    F   V+  V + F++   E   +
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAAFAFGATEFIAL 314

Query: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 365
             +E  NPRKS+P A K  +YRI+V Y+ ++ L+G  V +N   L+ + G +  A  SP+
Sbjct: 315 TAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHA--SPY 372

Query: 366 VVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGV 425
           V+AI + G++V+PH+ NA +L+ V S  NS  Y SSR L  LA  G AP       R G 
Sbjct: 373 VIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGR 432

Query: 426 PYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 485
           P  A+++S +F  ++++  S     +F + + +  +  + +W  I + +I F +A + QG
Sbjct: 433 PTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQG 492

Query: 486 IDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVF--LGH-KFDYKTFITGYIGLPVYI 542
               +  + +    +G+Y+A    +LI + + +T    +G  K D + F   Y+ +P+ I
Sbjct: 493 RSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILI 552

Query: 543 ISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
             + GYK+  +  T  I ++ +DL + + I+D  E+  + +D E  E+L+++G
Sbjct: 553 ALYFGYKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEYREKLRNSG 603

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  228 bits (582), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 147/536 (27%), Positives = 252/536 (47%), Gaps = 32/536 (5%)

Query: 72  VPDGKDEN------TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYA 125
           V + K EN      T+++K +K+RH+ M                       P  ++I YA
Sbjct: 54  VKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYA 113

Query: 126 FVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183
              ++++  +   GE+   Y  + G +T+Y+S  VDPALGF++ + Y  ++  + P QL 
Sbjct: 114 VASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLV 173

Query: 184 AAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXX 243
            AA+ ++YW      NP +++                         +  K          
Sbjct: 174 TAAMTVRYW---TNANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVIL 230

Query: 244 XXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELT 303
                         +G +YW  PG+F             F     VF Y+ FSY GIE+ 
Sbjct: 231 GIAINCGGAGTSGYIGAKYWHSPGSFA----------AGFKGVCYVFCYAAFSYGGIEVM 280

Query: 304 GIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAAS 363
            +  SE ENPRKS+P A K  +YRI++ Y+ T  ++   V YN   L+ + G+S S A S
Sbjct: 281 VLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHA-S 339

Query: 364 PFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRW 423
           P V+A+ + G++++PHI NA +L+ V S  NS +Y + R L +L+  G APK      R 
Sbjct: 340 PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQ 399

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
           G P     +++L   +A++  S     IF + + +  +  I  W +I + ++ F  A  A
Sbjct: 400 GRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHA 459

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGL 538
           QG+   +  Y +    +G++FA+   +L+ LI  F V +       + + +TF   Y+  
Sbjct: 460 QGLSLGQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAF 518

Query: 539 PVYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           P+ + ++ GYK+ +K     I +++VDL + + I D  EE  R +D E  E++ ++
Sbjct: 519 PILLGAYFGYKVYHKDWRLCIPASEVDLSSHRNISD--EEILRQEDYEWNEKMSNS 572

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 238/506 (47%), Gaps = 17/506 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K   + L+  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 73  KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 132

Query: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             +GE+A   P+  GFT+YA+R+VD + GFA  + Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 133 MAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGT 192

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
             +   G ++                         S  K                    +
Sbjct: 193 DPKYRDG-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKD 251

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
           H  +G +YW +PGAF       T G+ +F  F  VFV + FS+ G EL G+  SEAE PR
Sbjct: 252 HKYIGAQYWYNPGAF----VGDTAGQ-QFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPR 306

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KSVP A K   +RI +FY+  + L+GM V  + PRL+     S+ AAASPFV+AI N GI
Sbjct: 307 KSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGAS--SVDAAASPFVIAIVNHGI 364

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           + LP + N  +L+ V S  NS +Y  SR L ALA  G  P I     R G P   + +S 
Sbjct: 365 KGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISA 424

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  +A++  S     +FN+ + +  +  + +W  I + +I +  A  AQG    +  + 
Sbjct: 425 FFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQ 484

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           AP   +G+Y+  F CIL+  I  F V L   G K +   F   Y+   ++I  +A +K I
Sbjct: 485 APAGVWGSYWGFFMCILM-FIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHK-I 542

Query: 552 YKTK---VIKSTDVDLYTFKEIYDRE 574
           +K      I   D+D+ T +   D +
Sbjct: 543 WKRNWKLFIPLKDLDIDTGRREVDLD 568

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  228 bits (582), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 253/519 (48%), Gaps = 19/519 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K   + L+  LK+RH+ M                       P  +LI ++  G ++F  +
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMV 141

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE+A   P+ G FT+YA+R++D + GFA  + Y+ ++ ++ P ++ AA++ + YW +
Sbjct: 142 MALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWET 201

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
             R   G ++                         S  K                   P 
Sbjct: 202 PVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPV 260

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G RYW +PGAF       T G+ KF  F +VFV + FS+ G EL G+  SEA+NPR
Sbjct: 261 GGYVGARYWHNPGAF----VGSTSGQ-KFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPR 315

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K+VP A K   +RI++FY+  + L+G  V YNDPRL+S+   S+ A+ASPFV+AI   GI
Sbjct: 316 KAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSS--SVDASASPFVIAIVTHGI 373

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
             LP + N  +L+ V S  NS +Y  SR L AL+  G  PKI +   R G P   + +S 
Sbjct: 374 SGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISS 433

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  +A++  S+   ++FN+ + +  +    +W  I I +I F  A +AQG    +  +V
Sbjct: 434 TFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFV 493

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           +P    G+Y+ LF  IL+ LI  F + L   G       F + Y+  PV +  +  +KL 
Sbjct: 494 SPAGVIGSYWGLFLNILM-LIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLW 552

Query: 552 YKTK--VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
            K    +I   DVD+ T +    R+ +   +K +  EE+
Sbjct: 553 KKNWKFLIPLEDVDIDTGR----RDTDVNLLKQEIAEEK 587

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  228 bits (582), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 151/521 (28%), Positives = 245/521 (47%), Gaps = 23/521 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +++L+K +K+RH+ M                       P A++I Y  V  + ++ +  
Sbjct: 87  SDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQA 146

Query: 138 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  AA+ I++W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--N 204

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D +NP ++I                         +  K                    N 
Sbjct: 205 DTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGND 264

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YWR+PGAF   ++A     G+F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGKYWRNPGAFAGDTSA-----GRFKNVCYILVTAYFSFGGMELFALSVQEQANPRK 319

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           + P A K ++YRI+V YL T+ L+G  V YND +L+   G +  A  SP+V+A    G++
Sbjct: 320 TTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           V+PHI NA +L+ V S  NS LY   R + +LA  G  PK      R G P  ALI+  +
Sbjct: 378 VVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSV 437

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  + ++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
               +G+ + +FF IL+  I  F V L     G K   ++F   Y+  P++I  + GY +
Sbjct: 498 TTGIWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGY-M 555

Query: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           IY    T +     +DL   + IYD E    R +D E EER
Sbjct: 556 IYNRDFTFLNPLDKIDLDFHRHIYDPELM--RQEDLENEER 594

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  229 bits (583), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 147/529 (27%), Positives = 252/529 (47%), Gaps = 24/529 (4%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P  ++++  L+K +K RH+ +                       P  ++I YA +G  ++
Sbjct: 122 PHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLY 181

Query: 133 YTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +   GEMA +Y  L G F +Y S  VD A GF++ + Y  ++  + P +L  A++ IQ
Sbjct: 182 CIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQ 241

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW +   VN  V++                       + +S K                 
Sbjct: 242 YWTTT--VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTG 299

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKG--KFVSFVAVFVYSLFSYTGIELTGIVCS 308
              N   +G +YW +PGAF+       G K   +F   ++ F  + F++   E   I  S
Sbjct: 300 GAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSTFTTAAFAFGASEFIAIGAS 352

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 368
           E  NPR+++P A K  +YRI+  +L ++ L+G  V YN   L+ +   S +  ASP+V+A
Sbjct: 353 EQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSG--SAATKASPYVIA 410

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
           + + G+ V+PH  NA +L+ V S  NS  Y S R LY+L+  G AP  F    R G P  
Sbjct: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
           A+I+S LF  +A+   SS    +F + + +  +  + +WI I + +I F +A + QG   
Sbjct: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIIS 544
            +  + +    +G+ +A     L ALI  F V +        D + F   Y+ +P+ I+ 
Sbjct: 531 DEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVL 589

Query: 545 WAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           + GYK+  +     I++ D+DL + ++IYD E    + +++E +ERL++
Sbjct: 590 YFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELI--KQEEEEFKERLRN 636

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  228 bits (581), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 251/524 (47%), Gaps = 18/524 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +D N  L KDL  RH+                         P +++I +  +   +F  +
Sbjct: 86  EDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVI 145

Query: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE+A+  P+  GF  Y +R+VDP++ FAI   YL ++ +L P +L AA++ I+YW  
Sbjct: 146 NALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYW-- 203

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            D +N   W+                        LS  K                   P 
Sbjct: 204 NDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQ 263

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
              LG  YW DPG+F        G K   +F    +VFV + FSY+GIELT +  +E+++
Sbjct: 264 GGFLGGHYWHDPGSF-------VGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKD 316

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK++PKA K T + +   Y+  + ++G  V ++DPRLL+    S+ AAASP V++I+N+
Sbjct: 317 PRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLN-GSSSVDAAASPLVISIKNA 375

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           GI+ L  + NA +L+ + S  NS +Y  SR + ++A  G  PK+ ++  + G P NA++ 
Sbjct: 376 GIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILS 435

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           ++ F  L+++  S   A++F +   +  +  I  W+ I   +I F  A + Q     +  
Sbjct: 436 TLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELP 495

Query: 493 YVAPGQRYGAYFA--LFFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYIISWAGYK 549
           Y++     G+++   + F +L+A        LG    D  +F  GY+ LP+ I  + G+K
Sbjct: 496 YLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHK 555

Query: 550 LIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           L  +    ++K  D+DL T ++  D  E    +  ++     KS
Sbjct: 556 LYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKS 599

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  228 bits (581), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/510 (28%), Positives = 238/510 (46%), Gaps = 19/510 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D  D   +L+K ++ RH+ +                       P  ++I Y  +G L++ 
Sbjct: 108 DEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYC 167

Query: 134 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GEMA +Y+ L  GF +Y +  +DP   FA  + Y  ++  + P +L  A++ I+Y
Sbjct: 168 IIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWL-SSFKXXXXXXXXXXXXXXXXX 250
           W ++  V+P V++                       ++ +S K                 
Sbjct: 228 WTTK--VDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICG 285

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +G RYW DPGAF+           +F   VA  V + FS+   E   +  SE 
Sbjct: 286 GAGTDGYIGGRYWHDPGAFRGERAV-----DRFKGVVATLVTAAFSFGQSEFIAVTASEQ 340

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPR+++P A K  +YR +  YL ++ LLG  V YN  +LL  +   + A  SP+V+A+ 
Sbjct: 341 SNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKA--SPYVLAVA 398

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           N G+ V+PH  NA +++ V S  NS  Y S R L  L+  G APKIF+   R G P   +
Sbjct: 399 NHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGI 458

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           I++ LF  +A+   S    ++F + + V  +  I +W++I + ++ F +A   QG    +
Sbjct: 459 IVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGE 518

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWA 546
             +++    YG+ ++ FF + + L+  F V L      K D  +F   Y+  P++I  + 
Sbjct: 519 CGFLSQVGIYGSAYS-FFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYI 577

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYDRE 574
           GYK   K     IKS D+DL   ++IYD +
Sbjct: 578 GYKCYTKDWRLYIKSQDIDLVAHRQIYDED 607

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  227 bits (579), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 154/541 (28%), Positives = 253/541 (46%), Gaps = 24/541 (4%)

Query: 73  PDGKDEN---TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 129
           PD   E+   + + +DL  RH+                         P +++I +  V  
Sbjct: 74  PDDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVST 133

Query: 130 LVFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 188
            +F  +  LGE+A+  P+  GF  Y +R+VDP+  F++   YL ++ +L P +L AA+L 
Sbjct: 134 ALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLT 193

Query: 189 IQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXX 248
           I+YW   D +N   W+                        LS  K               
Sbjct: 194 IRYW--DDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLT 251

Query: 249 XXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS 308
               P    +G +YW DPGAF   S        +F    +VFV + FSY GIE+  +  +
Sbjct: 252 CGGGPKGGYIGGKYWHDPGAFVGDSAGT-----QFKGLCSVFVTAAFSYAGIEMIAVSAA 306

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 368
           E++NPRK++P A K T + I   Y+  + L+G  VAYND RLL+    S+  AASP V+A
Sbjct: 307 ESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGS-SSVDVAASPLVIA 365

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
           I+N GI+ LP + NA +L+ + S  NS +Y  SR + ++A+ G  PK  +   + G P  
Sbjct: 366 IENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLR 425

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
           A+  ++ F  L+++  S    ++F +   +  +  I  W+ I I +I F +A   Q    
Sbjct: 426 AIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSL 485

Query: 489 SKFAYVAPGQRYGAYF--ALFFCILIA-LIKNFTVFLGHKFDYKTFITGYIGLPVYIISW 545
            +  Y++    YG+Y+  A+ F +LIA    +     G   D + F  GY+  P+ I  +
Sbjct: 486 DEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACY 545

Query: 546 AGYKLIYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKF 603
            G+KL +K   I +   ++DL T ++  D +  +  +K + +  R  S       F ++F
Sbjct: 546 IGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSS-------FMKRF 598

Query: 604 L 604
           L
Sbjct: 599 L 599

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 248/515 (48%), Gaps = 14/515 (2%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +D N  L KDL  RH+                         P +++I +  +   +F  +
Sbjct: 72  EDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVI 131

Query: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE+A+  P+  GF  Y +R+VDP+  FA+   YL ++ +L P +L AA++ I+YW S
Sbjct: 132 NSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNS 191

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              +N   W+                        LS  K                   P 
Sbjct: 192 T--INSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPK 249

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              LG +YW +PGAF  +++       KF    +VFV + FSY+GIE+T +  +E+++PR
Sbjct: 250 GGYLGGKYWHNPGAFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPR 304

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K++PKA K T + I   Y+  + L+G  V Y+DPRL+S    S+ AAASP V+AI+N GI
Sbjct: 305 KTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGT-SSVDAAASPLVIAIENGGI 363

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           + L  + NA +L+ + S  NS +Y  SR + ++A  G  PK   K  + G P NA ++++
Sbjct: 364 KGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTL 423

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  L+++  S    ++F +   +  +  I  W+ I I +I F +A   Q     +  Y+
Sbjct: 424 FFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYL 483

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
           +    +G+ + +    L+ +   +T      G   D ++F  GY+ LP+ I+ + G+KL 
Sbjct: 484 SQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLY 543

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQE 584
           +K  + V+   ++DL T ++  D       +  +E
Sbjct: 544 FKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEE 578

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 149/526 (28%), Positives = 251/526 (47%), Gaps = 18/526 (3%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T L+  LK+RH+ M                       P +++I ++  G +++  +  +
Sbjct: 86  HTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAV 145

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            EMA   P+ G FT+YA+R++D + GFA  + Y+ ++ ++ P ++ +A++ + YW +  +
Sbjct: 146 AEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTK 205

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
              G ++                         S+ K                   P    
Sbjct: 206 YRDG-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGY 264

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +G +YW DPGAF       T G  +F  F +VFV + FS++G EL GI  SEAENPRK+V
Sbjct: 265 VGAKYWHDPGAF----VGATAG-AQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAV 319

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           P A K   +RI++FY+ ++  +G+ V  ND RL+ +   ++ AAASPFV+AI   GI  L
Sbjct: 320 PPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSS--NVDAAASPFVIAITVHGIRGL 377

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           P + N  +L+ V S  NS +Y  SR L ALA  G  PK+ +   R G P   + +S  F 
Sbjct: 378 PSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFG 437

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            +A++  S     +FN+ + +  +    +W  I + +I F  A +AQ     +  +V+P 
Sbjct: 438 LVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPL 497

Query: 498 QRYGAYFALFFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT- 554
             +G+Y+ LF  +L+   + +     +G       F + Y+ LPV ++ +  +KL  K  
Sbjct: 498 GVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNW 557

Query: 555 KV-IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWF 599
           K+ I    +DL T ++  D +     +  QE  E   +      WF
Sbjct: 558 KIFIPLGQLDLDTGRKQLDLD-----LLRQEVAEERATLAARPRWF 598

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/519 (29%), Positives = 255/519 (49%), Gaps = 27/519 (5%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           ++++L KDL  RH+                         P +++IA+  +   +F  +  
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE+++  P+  GF  Y +R+V+P+ GFA+ + YL ++ IL P +L AA++ I+YW    
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NK 177

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +NP  W++                       LS  K                   P+  
Sbjct: 178 SINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGG 237

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPGAF   + A      +F    AVF+ + FSY+G+EL G+  +E+ NPR +
Sbjct: 238 FIGGKYWNDPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVT 292

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I + YL  + L+G  V  NDP LL+    S+ AAASP V+AIQN GI+ 
Sbjct: 293 LPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGT-SSVDAAASPLVIAIQNGGIKG 351

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ + S  NS +Y  SR + ++A  G  P+  A   + G P  A+ +++L 
Sbjct: 352 LPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLV 411

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S+   ++F +   +  +  +  W  I + ++ F  A + Q     +  YV+ 
Sbjct: 412 GLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSM 471

Query: 497 GQRYGAYFALFFCILIA--LIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
              +G+++    CI+I   LI +F   L    G+  D  +F   Y+ LP++I  + G+K 
Sbjct: 472 TGEWGSWYG---CIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHK- 527

Query: 551 IYKTKV---IKSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
           I+K  +   IK ++VD+ +      R + +     QEKE
Sbjct: 528 IWKRNLRLYIKLSEVDVDS-----GRTDTDAATLKQEKE 561

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  226 bits (577), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 149/522 (28%), Positives = 246/522 (47%), Gaps = 19/522 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
             + L+K +K+RH+ M                       P  +++AY  V  + ++ +  
Sbjct: 97  SESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQA 156

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F SY S +V    GFA  + +L ++  + P +L  ++L I+YW   
Sbjct: 157 AGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--N 214

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++N  V++                         +S K                    + 
Sbjct: 215 DKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHD 274

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YW DPGAF  ++       G+F     + V + FSY G EL  +  +E ENPRK
Sbjct: 275 GYIGGKYWHDPGAFTSHTNI-----GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRK 329

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P+A K ++YRI+V YL T+ L+G  V +++ +L+ + G +  A  SP+V+A    G+ 
Sbjct: 330 STPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHA--SPYVLAASIHGVR 387

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           ++PH  NA +L+ V S  NS LY S R L +LA  G APK      R G P  AL    L
Sbjct: 388 IVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSL 447

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  + +   S+   ++F +   +  +  + +W  I++ ++ F +A + QG D ++  Y A
Sbjct: 448 FGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKA 507

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
               +G+ + +FF IL+     F V L   G K    +F   Y+  P++   + GY L  
Sbjct: 508 VSGVWGSVYGVFFNILV-FFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWN 566

Query: 553 K--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           K  T +I    +DL   + +YD E    R + +EK+ +LK++
Sbjct: 567 KDFTFLIPLESIDLDFHRRVYDPEFI--RQEREEKKIKLKNS 606

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  225 bits (573), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 243/502 (48%), Gaps = 20/502 (3%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            L KDL  RH+                         P +++I +  +   +F  +  LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 141 MASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           +A+  P+  GF  Y +R+VDP+  FA+   YL  + +  P +L AA++ I+YW     +N
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NREIN 194

Query: 200 PGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLG 259
              W+T                       +S  K                   P    +G
Sbjct: 195 SDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIG 254

Query: 260 FRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
            +YW DPGAF   S        +F    +VFV + FSY+G+E+T +  +E++NPRK++PK
Sbjct: 255 GKYWNDPGAFHGDSAG-----SRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPK 309

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPH 379
           A K T + I   Y+  + L+G+ V YND RLLS    S+ A+ASP V+AI+N+GI+ LP 
Sbjct: 310 ATKRTFWVITFSYISILTLIGILVPYNDKRLLSGS-SSVDASASPLVIAIENAGIKGLPS 368

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCG- 438
           + NA +L+ + S  NS +YV SR + ++A+    PK+F+K  + G P  + I + LF G 
Sbjct: 369 LMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYS-IFATLFVGL 427

Query: 439 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 498
           L+++  S    ++F +   +  +  I  WI I + +I F  A + Q     + AY++   
Sbjct: 428 LSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSG 487

Query: 499 RYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLIYK- 553
            +G+++ +   +L+ LI +F V L        D + F  GY+  P+ I S+ G+K+  K 
Sbjct: 488 IWGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKN 546

Query: 554 ---TKVIKSTDVDLYTFKEIYD 572
                 ++  D+DL     I++
Sbjct: 547 WKWVIPLEEIDIDLGKKNTIWN 568

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  226 bits (577), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 152/528 (28%), Positives = 252/528 (47%), Gaps = 25/528 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           + K EN  L+K +K RH  M                       P  ++I YA +G  V+ 
Sbjct: 139 EQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 134 TMACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GE+A      + GF +Y    VDPALGF++ + +  ++  + P +L  A++ I+Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W  +  V+P V++                       + +  K                  
Sbjct: 257 WTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGG 314

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
                 +G +YWRDPGAF+   T I     +F   VA FV + F++   E   +  SE  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQ----RFKGIVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSA--TKASPYVIAVSS 427

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G+ V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    R G P  A++
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAML 487

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +S LF  +A+   S     +F + + +  +  + +WITI + +I F +A + QG    + 
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWA 546
            Y +    +G+ +A+   +++ALI  F V +     G K   ++F   Y+ +P+ I  + 
Sbjct: 548 GYKSQVGVWGSAYAVLM-MMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYI 606

Query: 547 GYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
            +K ++K      I +  VDL + + I+D  EE  + +D+E +ERL++
Sbjct: 607 FFK-VWKNDWSLFIPANKVDLVSHRNIFD--EELLKQEDEEYKERLRN 651

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  225 bits (573), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 147/513 (28%), Positives = 248/513 (48%), Gaps = 15/513 (2%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
             + L++ LK RH+ M                       P  +LI +  +  ++      
Sbjct: 80  SQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLS 139

Query: 138 LGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA   P+ G +T+YA+R++D + GFA    Y+ +  ++ P ++ AA++ + YW  + 
Sbjct: 140 LGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKS 199

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           +     ++                         S  K                   P H+
Sbjct: 200 QYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHE 258

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G ++W +PGAF       T G+ KF    +VFV + FS+   EL G+  +E E+PRKS
Sbjct: 259 YIGSKFWSNPGAF----VGDTAGQ-KFKGICSVFVTAAFSFANTELVGLAAAETEDPRKS 313

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           VPKA K   +RI +FY+ ++ ++G+ V Y DPRLL +    + AAASPFV+A++N GI+ 
Sbjct: 314 VPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSS--IVDAAASPFVLALKNHGIKG 371

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + N  +L  V S  NS ++  SR L AL+  G  P +F    R G P  ++I S  F
Sbjct: 372 LPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAF 431

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L ++ VS    +IF++ +++  +  +  W+TI + +I F KA  AQ     + A+ +P
Sbjct: 432 GLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASP 491

Query: 497 GQRYGAYFALFFCILIALIKNF--TVFLGH-KFDYKTFITGYIGLPVYIISWAGYKLIYK 553
              +G+Y+++F  I++ LI  F   +F GH K     F   Y+ +P+ +  + G+K+  K
Sbjct: 492 IGIWGSYYSVFL-IIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTK 550

Query: 554 T--KVIKSTDVDLYTFKEIYDREEEEGRMKDQE 584
               +I    +D+ T +   D E  +  + +Q 
Sbjct: 551 NWKLLIDPKYMDIDTGRRELDIELFKQELLEQN 583

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 150/524 (28%), Positives = 247/524 (47%), Gaps = 23/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +++L+K +K+RH+ M                       P A++I Y  V  + ++ +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQA 146

Query: 138 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  A++ IQ+W   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFW--N 204

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++NP ++I                         +  K                    N 
Sbjct: 205 DKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGND 264

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G  YW  PGAF    T+I     +F +   + V + FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGAYWHKPGAFAG-DTSI----ARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRK 319

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P A K ++YRI+V YL T+ L+G  V YND +LL   G +  A  SP+V+A    G+ 
Sbjct: 320 STPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHA--SPYVLAASIHGVR 377

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           ++PHI NA +L+ V S  NS LY   R + +LA  G APK      R G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG   ++  Y A
Sbjct: 438 IGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKA 497

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
               +G+ +  FF IL+  I  F V L     G K + + F   Y+  P+++I + GY +
Sbjct: 498 TTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGY-M 555

Query: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           IY    T +     +DL   + +YD E    R +D+E +E++K+
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRVYDPELM--RQEDEENKEKIKN 597

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 244/504 (48%), Gaps = 16/504 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            N  L K+L  RH+                         P +++I +  +   +F  +  
Sbjct: 71  NNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINA 130

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGEMA+  P+  GF  Y +R++DP++GFA+   YL ++ +L P +L AA++ I+YW   +
Sbjct: 131 LGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NE 188

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N   W+                        LS  K                   P+  
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW  PG+F  +++       KF    +VFV + FSY+GIE+T +  +E+++PR +
Sbjct: 249 FIGGKYWNHPGSFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I   Y+  + L+G  V Y+DPRLLS    S+ AA+SP V+AI+N GI+ 
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGT-SSVDAASSPLVIAIENDGIKG 362

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ + S  NS +Y  SR + A+A  G  P+I  +    G P NA+I ++ F
Sbjct: 363 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFF 422

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S   A +F +   +  +  I  W+ I + +I F ++   Q     +  +++ 
Sbjct: 423 GLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
              +G+++      L+ L+ +F   L    G   D ++F  GY+  P+ +  + G+KL  
Sbjct: 483 TGVWGSWYGTIVLFLV-LVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYV 541

Query: 553 KTK--VIKSTDVDLYTFKEIYDRE 574
           + +  ++   D+DL T +   D +
Sbjct: 542 RKREFMVGLADMDLDTGRRQVDLD 565

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 245/524 (46%), Gaps = 23/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +++L+K +K+RH+ M                       P A++I Y  V  + ++ +  
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQA 146

Query: 138 LGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA   P     F +Y+S ++    GFA  + Y F++  + P +L  A++ IQYW   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--N 204

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++NP V+I                         +  K                    + 
Sbjct: 205 DKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDD 264

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G  YW +PGAF    T+I     +F +   + V   FS+ G+EL  +   E  NPRK
Sbjct: 265 GYIGGAYWHNPGAFAG-DTSIA----RFKNVCYILVTGYFSFGGMELFALSVQEQSNPRK 319

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P A K ++YRI++ YL T+ L+G  V YND +L+   G +  A  SP+V+A    G++
Sbjct: 320 STPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHA--SPYVLAASIHGVK 377

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           ++PHI NA +L+ V S  NS LY   R + +L+  G APK      R G P  ALI+  +
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCI 437

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  +A++  SS    +F +   +  +  + +W +I++ ++ F +A + QG    +  Y A
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYKL 550
               +G+ +  FF IL+  I  F V L       +   ++F   Y+  P+++  + GY +
Sbjct: 498 TTGIWGSVYGFFFNILV-FIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGY-M 555

Query: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           IY    T +     +DL   + IYD E    R +DQE EE+ K+
Sbjct: 556 IYNRDFTLLNPLDKIDLDFHRRIYDPELI--RQEDQENEEKTKN 597

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  224 bits (570), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 255/533 (47%), Gaps = 23/533 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           + + L+K +K+RH+ M                       P +++I Y  V  + ++ +  
Sbjct: 71  DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQA 130

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F SY S ++    GFA  + +  ++  + P +L  A+L I+YW   
Sbjct: 131 AGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--N 188

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D++N  V+I                         +S K                      
Sbjct: 189 DKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKD 248

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YWRDPG+F E  +       KF     + V + FSY G EL  +  +E ENPRK
Sbjct: 249 GYIGAKYWRDPGSFAEGDSV-----EKFKGICYILVTAYFSYGGAELFSLSVNEQENPRK 303

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P+A K ++YRI++ YL T+ L+G  V +N+ +L+ + G +  A  SP+V+A    G++
Sbjct: 304 STPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHA--SPYVLAASIHGVK 361

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           V+PH  NA +L+ V S  NS LY S R + +LA  G APK      R G P  ALIL  +
Sbjct: 362 VVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAV 421

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  + +++ SS   ++F +   +  +  + +W  I++ ++ F +  +  G  + +  + A
Sbjct: 422 FGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRA 481

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYKL 550
               +G+ + + F +L+  I  F V L       K D ++F   Y+  P+++  + GY +
Sbjct: 482 VTGIWGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGY-M 539

Query: 551 IYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600
           +YK   T ++    +DL   + IYD E    R +D+E +E++K++   +  F+
Sbjct: 540 LYKRDFTFLVPLDKIDLNFHRRIYDPELI--RQEDEENKEKIKNSSVWVRMFH 590

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 155/538 (28%), Positives = 250/538 (46%), Gaps = 34/538 (6%)

Query: 74  DGKDENTRLRK-------DLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAF 126
           +GKD +  L K       ++K RH++M                       P  ++I Y  
Sbjct: 53  EGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVT 112

Query: 127 VGLLVF-YTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184
              +++    AC     +Y  L G + +Y +  VD   GFA+   Y  ++  + P +L  
Sbjct: 113 TSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVT 172

Query: 185 AALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXX 244
           A++ ++YW S   VNP V++                         +S K           
Sbjct: 173 ASMTVKYWTSS--VNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMA 230

Query: 245 XXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGK---GKFVSFVAVFVYSLFSYTGIE 301
                        +G +YW DPGAF        GG     +F    +V+V + F+Y G E
Sbjct: 231 ISLTAGAS-EQGYIGGQYWHDPGAF--------GGDRAIDRFKGICSVWVQAAFAYGGSE 281

Query: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 361
              +  +E  NPR+SVPKA K  +YR++V +L  V L+G  V +N  +LLS +G S S A
Sbjct: 282 FIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRA 341

Query: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421
            SPFV+A    G+ V+PHI N  +L  V S  NS +Y + R L +LA  G  PKIF    
Sbjct: 342 -SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400

Query: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481
           R G P   LI   LF  +A++  S+    +F +   +  +  + +W  I + ++ F +A 
Sbjct: 401 RQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM 460

Query: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYI 536
           R QG    +  Y A     G+Y+A+FF +++ LI  F + +       + D + F   Y+
Sbjct: 461 RVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYL 519

Query: 537 GLPVYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
             PV ++ + GYKL  +    VI S++VDL + ++I+D  EE    ++ E++ERL+++
Sbjct: 520 AFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLLQEEAERKERLRNS 575

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  224 bits (572), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 144/511 (28%), Positives = 246/511 (48%), Gaps = 21/511 (4%)

Query: 73  PDGKDENT--RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           P  K EN    L+K +K RH+ M                       P  +L+ +  +G  
Sbjct: 138 PPRKIENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTC 197

Query: 131 VFYTMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALV 188
           ++  +  +GEMA +Y  L  GF +Y S  VDPA GF++ + Y  ++  + P +L  A++ 
Sbjct: 198 LYCIIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMT 257

Query: 189 IQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWL-SSFKXXXXXXXXXXXXXX 247
           I+YW ++  V+P V++                       ++ +S K              
Sbjct: 258 IKYWTTK--VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIII 315

Query: 248 XXXXXPNHDRLGFRYWRDPGAFK-EYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIV 306
                 N   +G +YW +PGAF+ E++        +F   +A  V + F++   E  G+ 
Sbjct: 316 ICGGAGNDGYIGGKYWHEPGAFRGEHAI------DRFKGVMATLVNAAFAFGMSEFIGVT 369

Query: 307 CSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFV 366
            SE  NPRK++P A K  +YRI+  +L ++ ++G  V Y+  +LL + G  + A  SP+V
Sbjct: 370 ASEQSNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKA--SPYV 427

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           +A+   G++V+PH  NA +L+ V S  NS  Y SSR L +LA  G APKIF    R G P
Sbjct: 428 LAVSTHGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRP 487

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
              + ++ LF  +A+   S    ++F + + +  +  + +WI I + ++ F +A   QG 
Sbjct: 488 LVGMAMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGK 547

Query: 487 DKSKFAYVAPGQRYGAYFA--LFFCILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYII 543
              +  + +    +G+ +A  +  CILIA        +G  K D K F   Y+ +P+ + 
Sbjct: 548 SIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLA 607

Query: 544 SWAGYKLIYK--TKVIKSTDVDLYTFKEIYD 572
            + GYK+  K  T  I++ D+DL + + I+D
Sbjct: 608 LYFGYKIYTKNWTIFIRAKDIDLVSHRNIFD 638

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  223 bits (568), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 153/533 (28%), Positives = 249/533 (46%), Gaps = 21/533 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           + +T L+K +K RH+ M                       P A++I Y  V ++ +  + 
Sbjct: 86  NTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQ 145

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GEMA +Y  L G F +YAS +V    GFA  + +  ++  + P +L  A+L+I+YW  
Sbjct: 146 AAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYW-- 203

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            ++VN  V++                         +  K                    +
Sbjct: 204 TEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGH 263

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW  PGAF     A T    +F     V V   FSY G EL  +  +E ENPR
Sbjct: 264 DGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPR 318

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS P A K ++YRI+V YL T+ L+G  V +ND +L+   G +  A  SP+V+A    G+
Sbjct: 319 KSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHA--SPYVLAASIHGV 376

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
            V+PHI NA +L+ V S  NS LY + R L +LA  G APK      R G P  AL+   
Sbjct: 377 RVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACA 436

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  +A+   S    ++F +   +  +  + +W +I++ ++ F +A + QG D ++  Y+
Sbjct: 437 VFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYI 496

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG---HKFDYKTFITGYIGLPVYIISWAGYKLI 551
           A    +G+ + + F IL+  I  F V L         ++F   Y+  P++I  + GY + 
Sbjct: 497 ANTGYWGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIW 555

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG--KNMEWFY 600
            K  T +     +DL   + IYD E    + +D E +ER+++      ++WF+
Sbjct: 556 NKDYTFLNPLDKIDLDHHRRIYDPEVL--KQEDMENKERVRNGNIWTKLKWFW 606

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 145/516 (28%), Positives = 247/516 (47%), Gaps = 24/516 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N  L++ LK+RH+ M                       P  +LI +A  G +++  +  +
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 139 GEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           GE+A   P+  GFT+YASR+VD + GFA    Y+ ++ ++ P ++ AA++ + YW + D+
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
              G ++                         S  K                   P    
Sbjct: 193 YRDG-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGY 251

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +G R W +PGAF             F    +VFV + FS+ G EL G+  +E  NPRKS+
Sbjct: 252 IGGRLWHNPGAFAN----------GFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSL 301

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           P A K   +RI +FY+  + ++G+ V Y   RL+     S+ AAASPFV++IQN+GI+ L
Sbjct: 302 PSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQS--SVDAAASPFVISIQNAGIKGL 359

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           P + N  +L+ V S  NS ++  SR++ ALA  G  PKIF    R G P   +I++ +F 
Sbjct: 360 PSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFG 419

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            L+++  S    ++F++ + +  +  + +W  I++ +I   +A  AQ    ++ ++ AP 
Sbjct: 420 LLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPT 479

Query: 498 QRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
             +G+ +     ILI L+  F + L   G K     F   Y+  P+ I  + G+K+  K 
Sbjct: 480 GVWGSVYGFVLIILI-LMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKN 538

Query: 555 --KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
               I++ ++D+ T +    RE +   +K +  EE+
Sbjct: 539 WKLFIRAKNIDIDTGR----RETDIEALKQEIAEEK 570

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  224 bits (571), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 151/525 (28%), Positives = 249/525 (47%), Gaps = 23/525 (4%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K EN  L+K +K RH  M                       P  ++I YA +G  V+  +
Sbjct: 141 KQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 136 ACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GE+A      + GF +Y S  VDPA+GF++ + +  ++  + P +L  A++ I+YW 
Sbjct: 199 QACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
            +  VN  V++                       + +  K                    
Sbjct: 259 VK--VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAG 316

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +G RYWRDPGAF+   T+I     +F   VA FV + F++   E   +  SE  NP
Sbjct: 317 TDGYIGSRYWRDPGAFRG-DTSIQ----RFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RK++P A K  +YRI+  +L ++ L+G  V Y   +LL   G +    ASP+V+A+ + G
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSA--TKASPYVIAVSSHG 429

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           + V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK F    R G P  A+I+S
Sbjct: 430 VRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVS 489

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
            +F  +A+   S     +F + + +  +  + +WITI + +I F K  + QG    +  Y
Sbjct: 490 AVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGY 549

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGY 548
            +    +G+ +A+   +L ALI  F V +       K   ++F   Y+ +P+ I  +  Y
Sbjct: 550 KSQVGVWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFY 608

Query: 549 KLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           K+  +  +  I +  +DL + + I+D  EE  + +D+E ++RL++
Sbjct: 609 KVWKRDWSLFIPADKIDLVSHRNIFD--EELLKQEDEEYKDRLRN 651

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  222 bits (566), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 253/528 (47%), Gaps = 30/528 (5%)

Query: 74  DGKDENT-RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           D +D  T +++K +K RH+ M                       P  +++ Y     +++
Sbjct: 56  DAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLY 115

Query: 133 YTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +   GE+   Y  + G +T+Y+S  VDPA+GF++ + Y  ++  + P QL  AA++IQ
Sbjct: 116 LIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQ 175

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW     +NP +++                       + +  K                 
Sbjct: 176 YWTD---INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCG 232

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +G +YW +P  F      + G KG       VF Y+ F+Y GIE+  +  SE 
Sbjct: 233 GAGTSGYIGDKYWHEPRPF------MNGFKG----LCFVFCYAAFAYGGIEVMVLSASEQ 282

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           ENPRKS+  A K  +YRI++ YL T  ++   V  + P L S   +     ASP V+A+ 
Sbjct: 283 ENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSR-----ASPLVIAVS 337

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
             G++++PHI NA +L+ V S  NS LY + R L +LA  G APKIF    R G P  A 
Sbjct: 338 FHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAF 397

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            ++++F  LA++  S     +F + + +  +  +  W++I I +I F  A +AQG    +
Sbjct: 398 FVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGE 457

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWA 546
             Y A    +G++ A+    LI LI  F V +        D ++F   Y+  P+ ++++ 
Sbjct: 458 VGYKARTGYWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYF 516

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           GYK+ +K     I +++VDL + ++++D  E+E + +D E + +LKS+
Sbjct: 517 GYKIYHKDWRICIPASEVDLISHRQVFD--EDELKQEDLEWKLKLKSS 562

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 148/517 (28%), Positives = 248/517 (47%), Gaps = 21/517 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
            T L+  LK RH+ M                       P ++LI +  +G +++  +  L
Sbjct: 82  QTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMAL 141

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           GE+A   P+ G FT+YA+R++D + GFA  + Y+ ++ +  P ++ +A++ + YW +  +
Sbjct: 142 GELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPK 201

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
              G ++                         S  K                   P    
Sbjct: 202 YRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGY 260

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +G +Y+ DPGAF   +        KF    +VFV + FS+ G EL G+  SE+ +PRKSV
Sbjct: 261 IGGKYFHDPGAFAGDTPG-----AKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSV 315

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           PKA K   +RI +FY+ ++ ++G+ V YND RL+     S+ AAASPFV+AI   GI+ L
Sbjct: 316 PKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGAS--SVDAAASPFVIAIVTHGIKGL 373

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           P + N  +L+ V S  NS ++  SR   ALA  G  P+IFA   R G P   +I++    
Sbjct: 374 PSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVG 433

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            +A++  S+    +FN+ + +  +  + +W  I I +I F KA  +QG    + ++ +P 
Sbjct: 434 LIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPT 493

Query: 498 QRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
             +G+Y+ LF  I+I  I  F V L         + F   Y+  P+ +  + G+K IYK 
Sbjct: 494 GVWGSYWGLFM-IVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHK-IYKR 551

Query: 555 K---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
               +I + ++D+ + +   D E     +K +  EE+
Sbjct: 552 NWKLLIPAGEMDIDSGRREVDLE----LLKQEIAEEK 584

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  223 bits (569), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 149/526 (28%), Positives = 254/526 (48%), Gaps = 22/526 (4%)

Query: 76  KDENTRL----RKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           KDE T L     KDL  RH+                         P +++I +  V   +
Sbjct: 131 KDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTAL 190

Query: 132 FYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           F  +  LGE+A+  P+  GF+ Y  ++VDP+  FA+   YL ++ +L P +L AA++ I+
Sbjct: 191 FTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIR 250

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW S   +N   W++                       LS  K                 
Sbjct: 251 YWNSS--INSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCG 308

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
             P+H+ +G +YW DPGAF       T G  KF    +VFV + FS++GIE+T +  +E+
Sbjct: 309 GGPSHEYIGGKYWHDPGAF----VGTTSGS-KFKGLCSVFVTAAFSFSGIEMTAVSAAES 363

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPR+++PKA K T + I   Y+  + L+G  V YNDPRL++    S+ AA+SP V+AI+
Sbjct: 364 RNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGS-SSVDAASSPLVIAIE 422

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           N  I  LP + NA +L+ + S  NS +Y  SR + +++     PK+FAK  R G P  A+
Sbjct: 423 NGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAI 482

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
              + F  L+++  S   A++F +   +  +  I  W+ I + +I F +    Q I   +
Sbjct: 483 CFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDE 542

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWA 546
             +++    +G+ + +    L+ L+ +F   L      K +  +F  GY+  P+ +  + 
Sbjct: 543 LPFLSQTGIWGSIYGIVILFLV-LVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYI 601

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYDRE--EEEGRMKDQEKEER 588
            +K+ +K     I ++ +DL++ ++  D E   EE R++ +   +R
Sbjct: 602 AHKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQR 647

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 160/539 (29%), Positives = 250/539 (46%), Gaps = 25/539 (4%)

Query: 74  DGKDEN-TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           DG+ ++   L+K +K RH+ M                       P  ++I Y  V  + +
Sbjct: 86  DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTY 145

Query: 133 YTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
           + +   GE+A +Y  L G F SY    +    GFA  +    ++  + P +  AA+L I+
Sbjct: 146 FMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIK 205

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           YW   DR++  V++                         +  K                 
Sbjct: 206 YW--NDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAG 263

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
              N   +G +YW DPGAF   +    G + K V ++ V  Y  FSY G EL  +  +E 
Sbjct: 264 GAGNDGYIGGKYWNDPGAF---AGETAGSRFKGVCYILVTGY--FSYGGTELFVLSVNEQ 318

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
           ENPRKS P+A K ++YRI++ YL T+ L+G  V YNDPRL+     S S A SP+V+A  
Sbjct: 319 ENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHA-SPYVLAAS 377

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
             G++++PH  NA VL+ + S  NS LY + R + +LA  G APKI A   R G P  +L
Sbjct: 378 IHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSL 437

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            +  LF  + +   SS   ++F +   +  +  + +W    I +I F  A + QG D  +
Sbjct: 438 GICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKE 497

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWA 546
             ++A    YG+++ LFF IL+     F V L      K   ++F   Y+  P+++  + 
Sbjct: 498 VGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYF 556

Query: 547 GYKLIYKT----KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN--GKNMEWF 599
           GY +  K       ++S D+D +  + IYD  EE   +  QEKEE   S+  GK + W 
Sbjct: 557 GYMVWAKDFTFLNPLESIDLDFH--RRIYD-PEEMAEINRQEKEEYKNSSIVGKIIYWL 612

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 158/551 (28%), Positives = 260/551 (47%), Gaps = 40/551 (7%)

Query: 13  SPRNSSSLDSDHDAYYSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAV 72
           SP   ++ D     Y+  Q  +N      E+  ID E+ ++                   
Sbjct: 2   SPELPTTGDIPLSPYFPNQMKENMKASVNEV--IDEEQGSISEL---------------- 43

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
            + K +N  +R  LK+RHI +                       P  +LI+Y  +   V+
Sbjct: 44  -EVKPQNEMVR-GLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVW 101

Query: 133 YTMACLGEMASYIPLDG---FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
             +  L EM + IPL G     S A  YV   L F  G+   +   ++ P+++TA A++I
Sbjct: 102 TIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLI 161

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           QYW      N  ++I+                       +SS K                
Sbjct: 162 QYWTD---ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFF 218

Query: 250 XXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCS 308
              P+ D  LGF YW+ PGAFKE+   + G  GKF++     + S FS+  +  T   CS
Sbjct: 219 GGGPSQDHILGFHYWKKPGAFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCS 276

Query: 309 -EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMS-AAASPFV 366
            E+ +PR+++P+A +  VYR+ +FY+  V ++ + V  +D  LL+      S AAASP+V
Sbjct: 277 AESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYV 336

Query: 367 VAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVP 426
           + I+ +GI+VLPHI NAC+L   +S   ++LY  SR L+++A+ G AP+IFAK +R+GVP
Sbjct: 337 IGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVP 396

Query: 427 YNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 486
           Y +  ++ LF  LAY+N S  S+ +FN+  N+ ++ G +SW+ + + Y  F        I
Sbjct: 397 YYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV-----I 451

Query: 487 DK----SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYI 542
           DK     +  +    Q+  AY  + F +L++L   + VF+   ++   F   Y+ +    
Sbjct: 452 DKLDLNDRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVA 511

Query: 543 ISWAGYKLIYK 553
           + + G  + YK
Sbjct: 512 VLFIGSTIYYK 522

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  221 bits (564), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/535 (28%), Positives = 243/535 (45%), Gaps = 26/535 (4%)

Query: 73  PDGKD------ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAF 126
           PD  D       +   +K +K+RH+ M                       P +++IAY  
Sbjct: 78  PDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGL 137

Query: 127 VGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184
           V  + ++ +   GEMA +Y  L G F +Y S ++    GFA  + +  ++  + P +L  
Sbjct: 138 VSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELIT 197

Query: 185 AALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXX 244
           AA+ I+YW     ++P V++                         ++ K           
Sbjct: 198 AAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFA 255

Query: 245 XXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTG 304
                        +G +YW DPGAF     A + G  +F       V + FSY G EL  
Sbjct: 256 IVVNCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFV 310

Query: 305 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 364
           +  ++ +NPRKS P A K  VYRI+V YL T+ L+G  V +N   LL   G +    ASP
Sbjct: 311 LSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN-GLHASP 369

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWG 424
           +V+A    GI+V+PHI NA +L+ + S  NS LY   R L +LA  G AP+  +   R G
Sbjct: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429

Query: 425 VPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ 484
            P  AL+LS L   + +   S    ++F +   +  +  + +W +I+  +I F +A + Q
Sbjct: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489

Query: 485 GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLP 539
                   Y A    +G+YF + F IL+     F V L     G K D  +F   Y+ +P
Sbjct: 490 NKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFASYLAMP 548

Query: 540 VYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           ++++ + GY   YK  T +     VDL   +++YD E    R +D E +ERL+++
Sbjct: 549 IWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFL--RQEDLENKERLRNS 601

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  221 bits (562), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 247/524 (47%), Gaps = 23/524 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N  L+K +K+RH+ M                       P +++I Y  V  + ++ +   
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ ++YW   D
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--ND 200

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N  V+I                         +S K                       
Sbjct: 201 TINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDG 260

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YWRDPG+F E S     G  +F     + V + FS+ GIEL  +  +E  NPRKS
Sbjct: 261 YIGGKYWRDPGSFAEGS-----GATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKS 315

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
            P A K +VYRI++ YL T+ L+G  V +N+ +L+ + G +    ASP+V+A     + V
Sbjct: 316 TPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSA--THASPYVLAASIHKVRV 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           +PHI NA +L+ V S  NS LY + R + +LA  G APK      R G P  AL++  L 
Sbjct: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLV 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             + ++  S    + F +   +  +  + +W  I++ +I F KA + QG    +  Y A 
Sbjct: 434 GVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
              +G+Y+ +FF +L+  +  F V L     G K D + F   Y+  P++I  + GY ++
Sbjct: 494 TGIWGSYYGVFFNMLV-FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MV 551

Query: 552 YK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           YK   T +     +DL   + +YD E    R +D+E +ERLK++
Sbjct: 552 YKRDFTFLNPLDKIDLDFHRRVYDPEIM--RQEDEENKERLKNS 593

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  220 bits (561), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 146/524 (27%), Positives = 248/524 (47%), Gaps = 22/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            +T+ +K L +RH+ M                       P +++I Y  V  + ++ +  
Sbjct: 73  SDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQA 132

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  ++L I+YW   
Sbjct: 133 AGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYW--N 190

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWL-SSFKXXXXXXXXXXXXXXXXXXXPN 254
           D++N  +++                       +L +S K                    N
Sbjct: 191 DKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGN 250

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW +PG+F E          +F     V V   FSY G EL  +  +E   PR
Sbjct: 251 DGYIGGKYWHEPGSFAE-----GDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPR 305

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K+ P A K ++YRI++ YL T+ L+G  V +N+ +L+   G +  A  SP+V+A    G+
Sbjct: 306 KATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHA--SPYVLAATIHGV 363

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +++PH  NA +L+ V S  NS L+   R L +LA  G APKI +   R G P  AL +S 
Sbjct: 364 KIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISF 423

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           L   +A+++ +S   ++F +   +  +  I +W  I+  ++ F  A + QG D ++  Y 
Sbjct: 424 LIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYK 483

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYK 549
           A    +G+ +  FF +L+ LI  F V L     G K D + F   Y+  P+++  + GY 
Sbjct: 484 ANTGVWGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYM 542

Query: 550 LIYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           +  K   + S    +DL +++ IYD E    + +D+E +E LKS
Sbjct: 543 IYNKDFTLLSPLDKIDLDSYRRIYDPELI--KQEDEENKENLKS 584

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  219 bits (559), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 154/523 (29%), Positives = 247/523 (47%), Gaps = 23/523 (4%)

Query: 80  TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLG 139
           T L+K +K+RH+ M                       P +++I Y  V  + ++ +   G
Sbjct: 51  THLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAG 110

Query: 140 EMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           EMA +Y  L G F SY S ++    GFA  + +  ++  + P +L  A+L ++YW   D+
Sbjct: 111 EMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYW--NDK 168

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
           +N  V+I                         +S K                        
Sbjct: 169 INADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGY 228

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +G +YW DPG+F +    IT  KG  V F+ V  Y  FSY G EL  +  +E ENPRKS 
Sbjct: 229 IGAKYWHDPGSFAD-GPPITRFKG--VCFILVSAY--FSYGGAELFSLSVNEQENPRKST 283

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           P A K ++YRI++ YL T+ L+G  V +N   L+     S +  ASP+V+A     ++V+
Sbjct: 284 PAAAKQSIYRILIIYLATMILIGFNVPHNSDELMG--AGSAATHASPYVLAASLHSVKVV 341

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           PH  NA +L+ V S  NS LY + R + +LA  G APK      R G P   LIL  LF 
Sbjct: 342 PHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFG 401

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            + +++ SS   ++F +   +  +  + +W  I++ +I F +A +  G    +  + A  
Sbjct: 402 VIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVT 461

Query: 498 QRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
             +G+Y+   F IL+  I  F V L     G K D + F   Y+  P++++ + GY +IY
Sbjct: 462 GIWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGY-MIY 519

Query: 553 K---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           K   T +     +DL   + IYD +    + +D+E +ERLK++
Sbjct: 520 KRDFTILNPLEKIDLDFHRRIYDPDFI--KQEDEENKERLKNS 560

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/522 (27%), Positives = 252/522 (48%), Gaps = 18/522 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +D++ R  KDL  RH+                         P +++I +  +   +F  +
Sbjct: 66  EDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIV 125

Query: 136 ACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE++S  P+  GF  Y SR+V+P+ GFA+   YL ++ +L P +L AA+L I+YW  
Sbjct: 126 NALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW-- 183

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              +N   W+                        LS  K                   P 
Sbjct: 184 NHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPK 243

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW +PGAF  ++        +F    +VFV + FSY+G EL  +  +E+ NPR
Sbjct: 244 GGYIGGKYWSNPGAFVGHTAG-----DRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPR 298

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
            ++PKA K T + I V Y+  + L+G  V+ +DPRLL+    S+  AASP V+AI+N GI
Sbjct: 299 ITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLN-GSSSVDVAASPLVIAIENGGI 357

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           + LP + NA +L+ V S  NS +Y  SR + ++A  G  PK+F    R G P  A++ ++
Sbjct: 358 KGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATL 417

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  L+++  S    ++F +   +  +  +  W  I + +I F +  + +G    +  +V
Sbjct: 418 IFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFV 477

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
           +    +G+Y+     I I L+  F   L    G   + ++F   Y+  P+ +  + G+KL
Sbjct: 478 SMTGVWGSYYGCIV-IFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKL 536

Query: 551 IYKT-KVIKST-DVDLYTFKEIYDRE--EEEGRMKDQEKEER 588
             ++ +++  T ++DL + +   D E  ++E R+++Q   ++
Sbjct: 537 YTRSWRLLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQK 578

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  219 bits (558), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 251/532 (47%), Gaps = 21/532 (3%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           NT L+K +K+RH+ M                       P A++I Y  V  + ++ +   
Sbjct: 112 NTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAA 171

Query: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEMA +Y  L G F +Y+S +V  A GFA  + +  ++  + P +L  A+L I+YW   D
Sbjct: 172 GEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYW--ND 229

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSF-KXXXXXXXXXXXXXXXXXXXPNH 255
           ++N  V+I                       +L +  K                    N 
Sbjct: 230 KINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNR 289

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
           + +G ++W DPGAF       T G  +F     V V   FSY G EL  +  +E  NPR+
Sbjct: 290 EYIGGKFWHDPGAF----AGKTAGS-RFKGICYVLVSGYFSYGGTELFALSVNEQSNPRR 344

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           S P+A K ++YRI++ YL T+ L+G  V Y+   L+ + G +  A  SP+V+A   +G++
Sbjct: 345 STPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHA--SPYVLAASLNGVK 402

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           + PH  NA +L+ V S  NS LY + R + +LA  G APK      R G P  ALI  +L
Sbjct: 403 IAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLL 462

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              + ++  S    ++F +   +  +  + +W +I++ ++ F  A + Q     +  Y A
Sbjct: 463 VGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKA 522

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYK----TFITGYIGLPVYIISWAGYKLI 551
               YG+ + + F +L+   + +T       D K    +F   Y+ +P++++ + GY L 
Sbjct: 523 TTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLW 582

Query: 552 YKT-KVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYE 601
            +  +++K  D +DL   + IYD E    R +D+E +ERL+ NG  M   Y 
Sbjct: 583 TRDFQLLKPLDKIDLDFHRRIYDPELM--RQEDEESKERLR-NGSFMMRMYH 631

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  218 bits (555), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 244/523 (46%), Gaps = 21/523 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N  L+K +K+RH+ M                       P +++I Y  V  + ++ +   
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAA 142

Query: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ I+YW   D
Sbjct: 143 GEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--ND 200

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N  V+I                         +S K                       
Sbjct: 201 SINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDG 260

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YWRDPG+F + S A      +F     + V + FS+ GIEL  +  +E  N RKS
Sbjct: 261 YIGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNARKS 315

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
            P A K +VYRI++ YL T+ L+G  V +N+ +L+ +   S +  ASP+V+A     + V
Sbjct: 316 TPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSG--SAATHASPYVLAASIHKVRV 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           +PHI NA +L+ V S  NS LY + R + +LA  G AP+      R G P  AL +  L 
Sbjct: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALV 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             + ++  S    + F +   +  +  I +W  I++ +I F KA + QG    +  Y A 
Sbjct: 434 GVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKAN 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
              +G+Y+ +FF IL+  +  F V L     G K D + F  GY+  P++I  + GY L 
Sbjct: 494 TGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLY 552

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
            K  T +     +DL   + +YD E    R +D+E +E+L+++
Sbjct: 553 NKDFTLLNPLDKIDLDFHRRVYDPEIM--RQEDEENKEKLRNS 593

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  218 bits (554), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/528 (27%), Positives = 252/528 (47%), Gaps = 21/528 (3%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L++ LK RH+ M                       P A+LI +  +GL+++  +  +GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 142 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 200
           A   P+  GFT+Y  R+VD + GFAI Y Y+ ++ ++ P ++ AA++ + YW +  +   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 201 GVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGF 260
           G ++                         S  K                   P    +G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 261 RYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 320
           +YW +PGAF   +        +F +  +VFV + FS+ G EL G+  +E ENPRK++P+A
Sbjct: 259 KYWHNPGAFNGDNAG-----QRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 321 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHI 380
            K   +RI +FY+ ++ L+G+ V Y    L+ +   S+ AAASPFV+AI+  GI  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSS--SVDAAASPFVLAIKTHGISGLPSV 371

Query: 381 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLA 440
            N  +L+ V S  NS +Y  SR L ALA  G  P+IF+   R G P   ++ +  F  L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 441 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 500
           ++  S     +FN+ + +  +  + +W  I I ++ F +A  AQG    + A+ +    +
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 501 GAYFALFFCILIALIKNFTVF---LGHKFDYKTFITGYIGLPVYIISWAGYKLIYK--TK 555
           G+YF +    L+  I  F +    +G   +   F   Y+ + V +  +  +KL  +  T 
Sbjct: 492 GSYFGVILICLV-FIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTF 550

Query: 556 VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKF 603
             ++ D+D+ T +    RE +   +K +  EE+L+ + K   W+Y  +
Sbjct: 551 AKRAKDIDIDTGR----RELDLDALKQEIAEEKLRLSTK--PWWYRVY 592

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  218 bits (554), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 245/523 (46%), Gaps = 21/523 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N RL+K +K+RH+ M                       P +++I Y  V  + ++ +   
Sbjct: 83  NNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEM  +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  +++ I+YW   D
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYW--ND 200

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
           ++N  V+I                         SS K                       
Sbjct: 201 KINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDG 260

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YWRDPG+F E       G  +F     + V + FS+ GIEL  +  +E  NPRKS
Sbjct: 261 YIGGKYWRDPGSFAE-----GNGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKS 315

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
            P A K +VYRI++ YL T+ L+G  V +N+ +L+ +   S +  ASP+V+A     + V
Sbjct: 316 TPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSG--SAATHASPYVLAASIHKVRV 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           +PHI NA +L+ V S  NS LY + R + +LA  G APK      R G P  AL +  L 
Sbjct: 374 VPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLV 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             + ++  S    + F +   +  +  + +W  I++ +I F KA + QG    +  Y A 
Sbjct: 434 GVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKAN 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
              +G+Y+ +FF IL+  +  F V L     G K + + F   Y+  P+++  + GY L 
Sbjct: 494 TGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLY 552

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
            +  T +     +DL   + +YD   E  R +++E +ERLK++
Sbjct: 553 ERDFTFLNPLDKIDLDYHRRVYD--PEIIRQENEENKERLKNS 593

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  217 bits (552), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 148/527 (28%), Positives = 242/527 (45%), Gaps = 23/527 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            ++  ++K +K+RH+ M                       P  +++ Y  V  + ++ + 
Sbjct: 73  SDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQ 132

Query: 137 CLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GEMA   P     F +YAS +V    GFA  + +  ++  + P +L  A++ I+YW  
Sbjct: 133 AAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW-- 190

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            D +NP V+I                         +S K                     
Sbjct: 191 NDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGR 250

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW +PGAF   S A      +F     + V   FSY G EL  +  +E +NPR
Sbjct: 251 DGYIGNKYWINPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPR 305

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS P A K ++YRI++ YL T+ L+G  V ++  +L+   G +  A  SP+V+A    G+
Sbjct: 306 KSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHA--SPYVLAASLHGV 363

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ V S  NS LY S R + +LA  G APK F    R G P  AL +  
Sbjct: 364 KVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICG 423

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           LF  + ++  S    + F +   +  +  + +W +I I +I F  A + QG    +  Y 
Sbjct: 424 LFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYR 483

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           A    +G+ +++FF +L+  I  F V L       K+D + F   Y+  P++++ + GY 
Sbjct: 484 ATTGIWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGY- 541

Query: 550 LIYK---TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
           +IY    T +     +DL   + IYD E    R +D E +ERL+++G
Sbjct: 542 MIYSRDFTFLTPLDKIDLDFHRRIYDPELL--RQEDAETKERLRNSG 586

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  216 bits (551), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 245/548 (44%), Gaps = 34/548 (6%)

Query: 71  AVPDGKDENT----------RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAM 120
           +VP G D  T          RLR+ ++ RH++M                       P  +
Sbjct: 58  SVPQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGL 117

Query: 121 LIAYAFVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILP 178
           +I YA V ++ +  M   GEMA +Y  + G F +Y+S ++    GFA  + Y  ++  + 
Sbjct: 118 IIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVF 177

Query: 179 PNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXX 238
           P +L  A+L I+YW   D VN  V+I                            K     
Sbjct: 178 PLELITASLTIKYWT--DSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIA 235

Query: 239 XXXXXXXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT 298
                          N   +G RYW DPGAF     A+     KF  F  V V   FSY 
Sbjct: 236 GFVILAIVINCGGAGNSGYIGARYWHDPGAF-----AVGDPASKFKGFCYVLVTGYFSYG 290

Query: 299 GIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM 358
           G EL  +  +E  +PR+++  A K  +YRI+V Y+ T+ L+G  V +    L+ + GKS 
Sbjct: 291 GTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKS- 349

Query: 359 SAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFA 418
           +  ASP+V+A+   G++V+PHI NA +L+ V S  NS +Y   R L ALA  G APK  A
Sbjct: 350 ATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLA 409

Query: 419 KTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFD 478
              R G P  ALI   +   LA++  S     +F +   +  +  + +W  IL+ +I F 
Sbjct: 410 YIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFR 469

Query: 479 KACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFIT 533
           +A +  G   S+  Y +    +G+ + + F IL+  +  F V L       K D  +F  
Sbjct: 470 QAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILV-FVAQFWVALAPIGNNGKTDVLSFFQ 528

Query: 534 GYIGLPVYIISWAGYKLIYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
            Y+  P++ + + GY +     +I     D+D+  F+ +YD E  E     QEK E  K+
Sbjct: 529 SYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIE-----QEKLEH-KT 582

Query: 592 NGKNMEWF 599
             +N  W 
Sbjct: 583 MLQNSNWL 590

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  217 bits (552), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 151/512 (29%), Positives = 239/512 (46%), Gaps = 25/512 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           + K EN +L + +K+RH+ M                       P  ++I Y    ++V++
Sbjct: 85  EEKTEN-QLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYF 143

Query: 134 TMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GE+   Y  L G +  Y S  VDPALGFAI   Y  ++  + P QL  AA+ I Y
Sbjct: 144 IVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGY 203

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W     +NP +++                         + FK                  
Sbjct: 204 W---TNINPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGA 260

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
                 +G  YW++PGAF             F    +VF Y+ FSY GIE+  +  +E E
Sbjct: 261 IGTDGYIGTIYWKNPGAFAN----------GFKGVCSVFCYAAFSYGGIEVLALTAAEQE 310

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NP K++P A K TVYRI+  Y+ T  L+G  V Y+ P+L+ +      + +SPFV+AI +
Sbjct: 311 NPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGST-SGGGSHSSPFVIAIAS 369

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G++V+PH+ NA +L+ + S  NS  Y S+R L +L+  GK PKIF    + G P+  ++
Sbjct: 370 HGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCIL 429

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
            + LF  + ++  S    ++F + + +  +  I  W++I + +I F +A   QG    + 
Sbjct: 430 FASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEI 489

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWA 546
            Y AP   +G++ AL    L +LI  F V +       K D   F   Y+  P+ +I++ 
Sbjct: 490 GYKAPTGCWGSWIALSIA-LFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYL 548

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYDREEE 576
           GYK  YK     I S  +DL   +EIY  EE+
Sbjct: 549 GYKTYYKDWRLYIPSDKIDLSYGREIYVPEEQ 580

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  216 bits (550), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 240/506 (47%), Gaps = 13/506 (2%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T+  + L  RH+ +                       P  +LIA+A   + +       
Sbjct: 64  STKTHRKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITVST 123

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            EM S++P+   F   AS+  D +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 124 AEMVSFLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 181

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
            N  + +                       WL+SFK                   P HDR
Sbjct: 182 YNAAIPLVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDR 241

Query: 258 LGFRYWRDPGAFKEY----STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
            GFRYW +   FK+Y    +T  T   G F  F+   + + F+  G E   ++  E + P
Sbjct: 242 YGFRYWGEE-PFKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLP 300

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 372
           RK +PKA K   +R+ + +L T   LG+  + NDP L +   ++   A +SPFV+A+ N 
Sbjct: 301 RKVLPKAFKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNL 360

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I VLP I NA ++   FSA N+  Y SSR LY +A+DG APKIF + +++GVP  A+ +
Sbjct: 361 RIRVLPDIVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGV 420

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S+L+  ++ + ++S SA + N+ VN+++   +++++ + ++Y++F +A  AQ        
Sbjct: 421 SLLWALISLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLP 480

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + + GQ Y A F L     +  I+ +TVF+   ++ + F+  Y+ + + +  + GYK I+
Sbjct: 481 FRSWGQPYTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIW 540

Query: 553 ---KTKVIKSTDVDLYT-FKEIYDRE 574
              K K I    VD  T  KEI   E
Sbjct: 541 KRGKDKFIDPHKVDFITDLKEIEAHE 566

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  215 bits (548), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/479 (29%), Positives = 231/479 (48%), Gaps = 14/479 (2%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
            T L+  LK RH+ M                       P ++LI +   G +++  +  L
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           GE+A   P+ G FT+YA+R++D + G+A  + Y+ ++ ++ P ++ +A++ + +W +  +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
              G ++                         S  K                   P    
Sbjct: 203 YRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGY 261

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +G +YW DPGAF   +        KF    +VFV S FS+ G EL G+  SE+  PRKSV
Sbjct: 262 IGGKYWHDPGAFAGDTPG-----AKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSV 316

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           PKA K   +RI +FY+ ++ ++G+ V YND  L+     S+ AAASPFV+AI+  GI+ L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGAS--SVDAAASPFVIAIKTHGIKGL 374

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           P + N  +L+ V S  NS +Y  SR + ALA     P+IFA   R G P   + ++  F 
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFG 434

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            +A++  S     +FN+ + +  +  + +W  I I +I F KA  AQG D  + ++ +P 
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 498 QRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
             +G+Y+ LF  ++I  I  F V L   G     + F   Y+  P+ +  + G+K IYK
Sbjct: 495 GVWGSYWGLFM-VVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHK-IYK 551

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  216 bits (551), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 145/528 (27%), Positives = 255/528 (48%), Gaps = 22/528 (4%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G   + +L+K +K+RH+ M                       P  ++I YA +G  ++  
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 135 MACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           +   GE+A  Y  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
            +   VNP +++                       + ++ K                   
Sbjct: 209 TTS--VNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGA 266

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
            N   +G +YW DPG+F       +G K    F   V+  V + F++   E   +  +E 
Sbjct: 267 GNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQ 319

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRKS+P A K  +YRIIV +L ++ L+G  V +N   L+ + G +  A  SP+V+AI 
Sbjct: 320 ANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHA--SPYVIAIA 377

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
           + G++V+PH  NA +L+ V S  NS  Y SSR L +LA  G AP       R G P  A+
Sbjct: 378 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAM 437

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
           I+S +F  ++++  S     +F + + +  +  + +W  I + +I F +A + QG    +
Sbjct: 438 IISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGE 497

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVF--LGH-KFDYKTFITGYIGLPVYIISWAG 547
             + +    +G+Y+A    +LI + + +T    +G  K D + F   Y+ +P+ I  + G
Sbjct: 498 LGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFG 557

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
           YK+  +  T  I ++ +DL + + I+D  E+  + +D E  E+L+++G
Sbjct: 558 YKVWKRDWTLYIPASKIDLISNRRIFD--EDVLKQEDAEFREKLRNSG 603

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  216 bits (549), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 189/347 (54%), Gaps = 15/347 (4%)

Query: 261 RYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 320
           RYW  PGAF       T G+ KF  F +VFV + FS+ G EL G+  +EA NPRK VP A
Sbjct: 263 RYWYHPGAF----AGDTSGR-KFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGA 317

Query: 321 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHI 380
            K   +RI +FY+  + L+GM V Y DPRL+   G S+ AAASPFV+AI+N GI  LP +
Sbjct: 318 AKQVFWRITMFYVLCLLLIGMLVPYTDPRLIG--GSSVDAAASPFVIAIKNQGISGLPTL 375

Query: 381 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLA 440
            N  +L+ V S  NS +Y  SR L ALA  G  PK F+   R G P   + ++  F  +A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 441 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 500
           ++  S    ++F++ + +  +  + +W TI + +I F +A  AQG   ++ A+ +P   +
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 501 GAYFALFFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT--KV 556
           GA + LF CI++   + +     LG       F  GY+ LP+ +  W G+K+  K     
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 557 IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKF 603
           IK+ D+D+ T +    RE +   ++ Q +EER     K M +   KF
Sbjct: 556 IKAEDMDIDTGR----RELDLDLLRQQVEEERAALAAKPMWYRIYKF 598

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 58/121 (47%), Gaps = 1/121 (0%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L+  LK RH+ M                       P  +LI +   G +++  +  + E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 142 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 200
           A   P+  GFT+YA+R++D + GFA  + Y+ ++ +  P ++ AA++ + YW +  +   
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 201 G 201
           G
Sbjct: 204 G 204

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  216 bits (549), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 245/528 (46%), Gaps = 28/528 (5%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           + K EN  L++ +K+RH+ M                       P    I +  +GL V+ 
Sbjct: 84  NAKHEN--LKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 134 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GE+A  Y  L  GF +Y S  +DPALGFA  + Y  ++  + P +L  A++ I++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W     VNP +++                       + +S K                  
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSF---VAVFVYSLFSYTGIELTGIVCS 308
                 +G +YWRDPG+         GG+  F  F   VA  V + FS    E   +  +
Sbjct: 262 VGTSGYIGGKYWRDPGSL--------GGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAA 313

Query: 309 EAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVA 368
           E  NPRKS+P A K  +Y+I V +L +V L+G  V  +   L+ +    +    SP+V+A
Sbjct: 314 EQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHV--SPYVIA 371

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
           ++  G+ V+P   NA +L+ V S  NS  Y SSR L++LA    APKIF    R G P  
Sbjct: 372 VRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLM 431

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
           A+I+S+LF  + ++  S    ++F + + +  +  + +W TI + +I F +A   QG   
Sbjct: 432 AMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYST 491

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIIS 544
            +  + A     G+Y +    +L ALI  F V L      + D ++F TGY+ +P++++ 
Sbjct: 492 DELGFKAQTGIIGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLF 550

Query: 545 WAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
           + GYK+  K     I++  +DL + + I+D +     +K ++ E R K
Sbjct: 551 YFGYKIWNKDWRLFIRADQIDLVSHRRIFDADV----LKQEDIEYRAK 594

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 240/518 (46%), Gaps = 20/518 (3%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N +L+K ++ RH+ M                       P  +LI Y  +   ++  +   
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 139 GEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEMA +Y+ L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+YW   +
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NE 194

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSF-KXXXXXXXXXXXXXXXXXXXPNH 255
           +V+P V++T                      +  +  K                      
Sbjct: 195 KVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTS 254

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G  YW +PGAF+ ++        +F   V+  V + FS+   E   I  SE  NPRK
Sbjct: 255 GYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRK 309

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A K  +YR +  Y+ ++ ++G  V YN P LL +K  S    ASP+V+A+ + GI 
Sbjct: 310 AIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSK--SSQTKASPYVIAVASHGIR 367

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           + PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    R G P   +I + L
Sbjct: 368 IAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASL 427

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
              +A+   S    ++F++ + +  +  + +W TI + +I F +A + QG   ++  Y +
Sbjct: 428 LATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKS 487

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
               +G+ +A     LI LI  F V L     +  +   F   Y+ +P+ ++ + GYK  
Sbjct: 488 QVGVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTW 546

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEE 587
            K     I++ D+DL + + IYD E+   + K+Q KE 
Sbjct: 547 KKDWNLFIRAKDIDLISHRHIYD-EDVLKQEKNQYKEN 583

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  216 bits (549), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 251/529 (47%), Gaps = 25/529 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           D++  L+K ++ RH+ M                       P A++I Y  +G  ++  + 
Sbjct: 114 DDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQ 173

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GEMA  Y  L G F +Y S  VD  + F + + Y  ++  + P +L  A++ I YW +
Sbjct: 174 ACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT 233

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
           +  VN  V++                       + +S K                    N
Sbjct: 234 K--VNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 291

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKG--KFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
              +G +YW +PGAF+       G K   +F   ++ F  + F++   E   I  SE  N
Sbjct: 292 DGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSN 344

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PR+++P A K  +YRI+  +L ++ L+G  V Y+   LL +   S S+ ASP+V+A+ + 
Sbjct: 345 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSG-GSASSQASPYVIAVASH 403

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G+ V+PH  NA +L+ V S  NS  Y S R LY+LA  G APK F    R G P  A+++
Sbjct: 404 GVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLV 463

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + +F  +A+ + S     +F + +++  +  + +W  I + +I F +A + QG    +  
Sbjct: 464 TTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIG 523

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGY 548
           + +    +G+ +A    IL ALI  F V +        D + F   Y+ +P+ I+ + GY
Sbjct: 524 FKSQVGVWGSGYAAIMMIL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 582

Query: 549 KLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
           K IYK      I++ D+DL + + I+D E    R +++E +E+L++  K
Sbjct: 583 K-IYKKDWKLFIRAKDIDLISHRTIFDGELV--RQEEEEYKEKLRNGPK 628

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  216 bits (549), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 143/534 (26%), Positives = 255/534 (47%), Gaps = 24/534 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           EN+ L++ +K RH+ +                       P  ++I Y+ +G  ++  +  
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 138 LGEMA---SYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
            GE+A   S +P   F  Y +  VD A GFA+ + Y  ++  + P +L  A++ I+YW +
Sbjct: 173 CGELAVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 231

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VNP ++++                      + +S K                     
Sbjct: 232 S--VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGT 289

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
              +G +YW  PGAF        G +    F   +A F  + F++   E   +  +E  N
Sbjct: 290 SGYIGAKYWHSPGAFN-------GNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSN 342

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK++PKA K+ +YRI+  +L ++ L+G  V YN P LL +   S +  ASP+VVA+ + 
Sbjct: 343 PRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSG--SDATKASPYVVAVASH 400

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G+ V+PH  NA +L+ V S  NS  Y SSR L +LA  G APK+F    + G P  A++ 
Sbjct: 401 GVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVC 460

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S LF  +A+   S    ++F + + +  +  + +W+ I I ++ F +A + QG    +  
Sbjct: 461 STLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIG 520

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGY 548
           + +    YG+ +A    IL ALI  F V L    G+  D + F   Y+ +P+ ++ + GY
Sbjct: 521 FKSQVGIYGSLYAATMLIL-ALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGY 579

Query: 549 KLIYKTKV--IKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFY 600
           K+  +     I +  +DL + ++++D +  +  + + E+E++  S G+ ++ F+
Sbjct: 580 KIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQEFF 633

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 149/528 (28%), Positives = 248/528 (46%), Gaps = 21/528 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D      ++++ +K+RHI+M                       P  ++I Y     +++ 
Sbjct: 68  DYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYC 127

Query: 134 TM-ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            + AC     SY  L G + SY S  VD    FA+ + Y  ++ I+ P +L  +++ I+Y
Sbjct: 128 VIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKY 187

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W   D +NP V++                         +S K                  
Sbjct: 188 W--NDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGA 245

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             +   +G +YW  PGAF     AI   KG      +V+V S F+Y G E   +  +E  
Sbjct: 246 SKS-GYIGGKYWHTPGAFVG-EKAIDHFKG----ICSVWVQSAFAYGGSEFIALTAAEQT 299

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRKSVPKA K  +YR+++ +L  + L+G  V Y+ P LL + G++ S A SPFV+A  +
Sbjct: 300 NPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHA-SPFVIAAAS 358

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G++V+PHI NA +L+ V S  NS  Y + R L +LA  G  PK+F    R G P   ++
Sbjct: 359 HGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTML 418

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
              +F  ++++  S     +F +   +VS+  + +W  I + +I F  A + QG    + 
Sbjct: 419 FVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGEL 478

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWA 546
            Y A    +G+++A+ F I++ L   F V +     G K D   F   Y+  PV +  + 
Sbjct: 479 GYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYF 537

Query: 547 GYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           GYKL Y+     I +  VDL + ++I+D +    + +D E +ER++++
Sbjct: 538 GYKLWYRDWKLFIPADKVDLESHRKIFDADLI--KQEDFEHKERIRNS 583

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  214 bits (546), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 146/530 (27%), Positives = 251/530 (47%), Gaps = 23/530 (4%)

Query: 73  PDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVF 132
           P+  D+   L+K +K RH+ M                       P  ++I YA +G  ++
Sbjct: 100 PEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIY 159

Query: 133 YTMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQ 190
             +   GE+A  Y  L  GF +Y S  +DPA GFA+ + Y  ++  + P +L  A++ I+
Sbjct: 160 CIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIK 219

Query: 191 YWISRDRVNPGVWITXXXXXXXXXXXXXXXXX-XXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           YW ++  V+P V++                        + +SFK                
Sbjct: 220 YWTTK--VDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVIC 277

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGK--GKFVSFVAVFVYSLFSYTGIELTGIVC 307
               N   +G R W +PG+F+       G K   +F   V+  V + F++   E  G+  
Sbjct: 278 GGAGNDGYIGTRLWHNPGSFR-------GDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTA 330

Query: 308 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 367
           SE  NPRK++P A K  +YRII  YL +V ++G  V Y+  +LL + G +  A  SP+V+
Sbjct: 331 SEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKA--SPYVL 388

Query: 368 AIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPY 427
           AI   G+ V+PH  NA +L+ V S  NS  Y SSR L +L+  G AP       R G P 
Sbjct: 389 AISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPL 448

Query: 428 NALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 487
            A  +S L   +A+   S    ++F + + +  +  + +W +I + ++ F +A R QG  
Sbjct: 449 KAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRS 508

Query: 488 KSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIIS 544
             +  + +    YG+ ++    +LI + + +T  +     K D + F   Y+ +P++I+ 
Sbjct: 509 MGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVL 568

Query: 545 WAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           + G+K+  K     I++ D+DL + +EI+D  EE  + +D+E   +L+  
Sbjct: 569 YFGFKIWKKDWRLFIRAEDIDLVSHREIFD--EELLKQEDEEYRRKLRDG 616

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 248/519 (47%), Gaps = 16/519 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E++R  KDL  RH+                         P +++I +  +   +F  +  
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           LGE++S  P+  GF  Y SR+V+P+ GFA+   YL ++ +L P +L AA+L I+YW S  
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNST- 184

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N   W+                        LS  K                   P   
Sbjct: 185 -INSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGG 243

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW +PGAF   +++      +F    +VFV + FSY+G EL  +  +E+ NPR +
Sbjct: 244 YIGGKYWSNPGAFVGNTSS-----QRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRIT 298

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +PKA K T + I V Y+  + L+G  V  +DPRLL     S+  AASP V+AI+N GI+ 
Sbjct: 299 LPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLH-GSSSVDVAASPLVIAIENGGIKG 357

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + NA +L+ V S  NS +Y  SR + ++A  G  PK F+   R G P  A++ +++F
Sbjct: 358 LPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIF 417

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L+++  S+    +F +   +  +  +  W  I + +I F    + +G    +  +V+ 
Sbjct: 418 GLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSM 477

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHK---FDYKTFITGYIGLPVYIISWAGYKLIYK 553
              +G+Y+      ++ ++  +T            ++F   Y+  P+ ++ + G+KL  K
Sbjct: 478 TGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTK 537

Query: 554 T--KVIKSTDVDLYTFKEIYDRE--EEEGRMKDQEKEER 588
           +   +  +T++D+ + +   D E  ++E RM++Q   E+
Sbjct: 538 SWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  214 bits (544), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 146/530 (27%), Positives = 244/530 (46%), Gaps = 21/530 (3%)

Query: 73  PDGKD-ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           P+G    N  L++ LK RH++M                       P  +LI Y  V +  
Sbjct: 89  PEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNT 148

Query: 132 FYTMACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           ++ +   GE+A   P     F +Y S+ V    GFA  + +  ++  + P +L A    +
Sbjct: 149 YFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAV 208

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           ++W +R  V+  V++                       +L+ FK                
Sbjct: 209 RFWTTR--VDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAA 266

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309
               +   +G +YW DPGAF  ++      +G+F     V V + FSY G EL  +  +E
Sbjct: 267 GGAGDSGYIGAKYWHDPGAFVSHTA-----EGRFKGVCYVLVSAYFSYGGTELFVLSVNE 321

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK-GKSMSAAASPFVVA 368
            ENPRK++P A K T+YRII  YL T+ L+G  V  N PRL+ +   K    + SP+V+A
Sbjct: 322 QENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLA 381

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
                + VLPH  NA V++ + S  NS +Y + R + +LA  G  PK F    R G P  
Sbjct: 382 ASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTR 441

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
           AL+L  +   +A+ + S     IF++   +  +  + +W +I++ ++ F  A + QG D 
Sbjct: 442 ALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDI 501

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYII 543
           ++  Y +    +G+ + +FF +L+     F V L     G K     F   Y+ LP+++ 
Sbjct: 502 NELGYKSNTGVWGSAYGVFFSLLV-FAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLT 560

Query: 544 SWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
            + G+ L  +  T +I    VDL +++  YD E    R +D+E ++ +KS
Sbjct: 561 FYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELL--RQEDEEHKQAMKS 608

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  213 bits (543), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 143/532 (26%), Positives = 246/532 (46%), Gaps = 20/532 (3%)

Query: 70  FAVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGL 129
           F     +   T+L++ +  RH+ M                       P  ++I YA +G 
Sbjct: 78  FGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGS 137

Query: 130 LVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAAL 187
            ++  +   GE+A SY  L G F +Y S  ++ A GF++ + Y  ++  + P +L  A++
Sbjct: 138 CLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASI 197

Query: 188 VIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
            I+YW +   VNP +++                       + +  K              
Sbjct: 198 TIKYWTTS--VNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIV 255

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVC 307
                 N   +G RYW +PGAF  Y T        F   ++  V + F++   E   +  
Sbjct: 256 NCGGAGNDGYIGGRYWNNPGAF--YGTKPIH---HFKGIISTMVTAAFAFGATEFIALTA 310

Query: 308 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 367
           +E  NPR+++P A K  VYRI++ +L  + L+G  V +N P L+ +   S +  ASP+V+
Sbjct: 311 AEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSG--SSATHASPYVI 368

Query: 368 AIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPY 427
           A+ + G+ V+PH  NA +L+ V S  NS  Y SSR L ALA    AP       R G P 
Sbjct: 369 AVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPM 428

Query: 428 NALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGID 487
            A+++S +F  ++++  S     +F + + +  +  + +WI+I + +I F KA   QG  
Sbjct: 429 RAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKP 488

Query: 488 KSKFAYVAPGQRYGAYFALFF--CILIALIKNFTVFLGH-KFDYKTFITGYIGLPVYIIS 544
             +  Y +     G+Y+A F   CILI         +G  K D  +F   Y+ LP++++ 
Sbjct: 489 IGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVL 548

Query: 545 WAGYKLIYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
           + G+K I+K      I    +DL + ++ +D  EE  + +D E EE +++ G
Sbjct: 549 YFGFK-IWKRDWRLYIPLEQIDLDSHRKTFD--EELLKQEDAEYEENIRNKG 597

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  213 bits (543), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 147/520 (28%), Positives = 238/520 (45%), Gaps = 22/520 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           ++K LKARH+ M                       P +++I Y  V  +V++ +   GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 142 A-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           A +Y  L G F +Y S ++  + GFA  + +  ++  + P +L  ++L IQYW     +N
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD---LN 206

Query: 200 PGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLG 259
             +++                         +  K                    N   +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 260 FRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
            +YW  PG+F E      G   +F     V V   FSY G EL  +  +E   PRK+ P 
Sbjct: 267 GKYWHTPGSFAE-----GGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPA 321

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPH 379
           A K ++YRI+V YL T+ L+G  V +N  +L+   G S  A  SP+V+A    G++V+PH
Sbjct: 322 AAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHA--SPYVLAASIHGVKVVPH 379

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGL 439
           I NA +L+ V S  NS LY S R L +LA  G APK      R G P  AL+L  +F  +
Sbjct: 380 IINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCI 439

Query: 440 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 499
           A++  S    ++F +   +  +  + +W  I+  ++ F  A + Q  D  +  Y A    
Sbjct: 440 AFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGI 499

Query: 500 YGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
           YG++F   F +L+ LI  F V L     G     ++F   Y+ +P+++  +  Y +  K 
Sbjct: 500 YGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKE 558

Query: 555 KVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
             I +  + +DL   + IYD +    R +D E +E+LK++
Sbjct: 559 WTILTDLSKIDLDAHRRIYDPDLI--RQEDAENKEKLKNS 596

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  214 bits (544), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/508 (27%), Positives = 238/508 (46%), Gaps = 23/508 (4%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           GK E   L+  +K RH+ M                       P  ++I YA +G  ++  
Sbjct: 118 GKSE--ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCI 175

Query: 135 MACLGEMASYIP--LDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           +   GEMA      + GF SY S  ++PALGF++ + Y  ++  + P +L  A++ I+YW
Sbjct: 176 IQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYW 235

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXX-XXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
            ++  V+P V++                        + +S K                  
Sbjct: 236 TTK--VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGG 293

Query: 252 XPNHDRLGFRYWRDPGAFK-EYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
             +   +G RYW DPGAF+ E++        +F   V+  V + F++   E+ G+  SE 
Sbjct: 294 AGDDGYIGGRYWHDPGAFRGEHAI------DRFKGVVSTLVNAAFAFGLSEMIGVTASEQ 347

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK++P A K  +YRI+  YL +V ++G  V +N  +LL + G  + A  SP+V+A+ 
Sbjct: 348 SNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKA--SPYVLAVS 405

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
             G+ V+PH  NA +L+ V S  NS  Y SSR L  LA  G APKIF    R G P   +
Sbjct: 406 THGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGM 465

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
            ++ L   +++   S    ++F + + +  +  + +W  I + +I F +A   QG    +
Sbjct: 466 CVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGE 525

Query: 491 FAYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWA 546
             + +    +G+++A    +LI LI  F V +      + D + F   Y+  P+ I  + 
Sbjct: 526 IGFKSQCGVWGSWYAFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYF 584

Query: 547 GYKLIYKT--KVIKSTDVDLYTFKEIYD 572
           GYK+  K     I++ D+DL   ++++D
Sbjct: 585 GYKIYTKDWRLFIRAKDIDLDINRDVFD 612

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  213 bits (542), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 144/523 (27%), Positives = 246/523 (47%), Gaps = 21/523 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           ++   L++D+K RH+ M                       P  + I YA +G  ++  + 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+A +Y  L G F +Y S  VDPA+ FA    Y  ++  + P ++ +AA+ I+YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              +NP VW                        + ++ K                    +
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW DPGAF   +     G  +F + V+  V + F++   E   +  SE  NPR
Sbjct: 275 SVYIGGKYWNDPGAFNGDT-----GISRFKAIVSTLVTAAFAFGASEAVALTASEQANPR 329

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K++P A K  +YRII  YL ++ L+G  V YN P L+ +   S S  +SP+V+A+ + G+
Sbjct: 330 KAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSG--SSSVHSSPYVIAVASHGV 387

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+P   NA +L+ V S  N   Y SSR L  L+  G APK F    R G P  A+I+  
Sbjct: 388 KVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGA 447

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           L   + +++ SS    +F + + V  +  + +W  I I ++ F KA + Q     +  + 
Sbjct: 448 LVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFR 507

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAGYK 549
           +    +G+Y+ +F  IL+  I  F V L         D + F   Y+ +PV++  + G+K
Sbjct: 508 SQVGVWGSYYGIFMMILV-FIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK 566

Query: 550 LIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
           +  K     I ++++DL + ++I+D  EE  + +D+E + ++K
Sbjct: 567 IWKKDWRLYIPASEIDLISHRKIFD--EEILKQEDEEYKIKMK 607

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  214 bits (544), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/527 (29%), Positives = 251/527 (47%), Gaps = 20/527 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +GK +   L+K +K RH+ M                       P  + I YA +G  ++ 
Sbjct: 117 EGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYC 176

Query: 134 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GEMA +Y  L  GF +Y S  V P LGFA+ + Y  ++  + P +L  A++ I+Y
Sbjct: 177 IIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKY 236

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W ++  VNP V++                       + +  K                  
Sbjct: 237 WTTK--VNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGG 294

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             N   +G +YW DPGAF+    AI     +F    A  V + F++ G E   +  SE  
Sbjct: 295 AGNDGYIGGKYWHDPGAFRG-DKAID----RFKGVAATLVTAAFAFGGSEFIALTASEQS 349

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK++P A K  +YRII+ +L ++ ++G  V +N  +L+ +   S    ASP+V+AI +
Sbjct: 350 NPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSD--SSKTKASPYVIAISS 407

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G+ V+PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    R G P  A++
Sbjct: 408 HGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMV 467

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +  LF  +A+   SS    +F + + +  +  I +W  I + +I F +A   QG    + 
Sbjct: 468 IGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEI 527

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAG 547
            + +    +G+Y+A     L+ LI  F V L     +K D ++F   Y+ + + I  + G
Sbjct: 528 GFKSELGVWGSYYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVG 586

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           Y    K  T  I++ D+DL   ++I+D  E+  R +D+E +E+L++ 
Sbjct: 587 YMFWKKDWTLFIRAKDIDLDHHRQIFD--EDVLRQEDEETKEKLRNG 631

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  213 bits (543), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 231/504 (45%), Gaps = 25/504 (4%)

Query: 74  DGK--DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           DG+  +  T+L K +K RHI M                       P  ++I Y    +++
Sbjct: 96  DGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMI 155

Query: 132 FYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           +  +   GE+   Y  L G +T+Y +  +DPA+GFA+   Y  ++  + P QL  AA+ I
Sbjct: 156 YCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTI 215

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW +   VNP +++                       + +  K                
Sbjct: 216 RYWTTN--VNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINC 273

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309
               + + +G +YW+ PGAF             F    AVF Y+ FSY GIE+  +  +E
Sbjct: 274 GGAGDKEYIGVKYWQTPGAFAN----------GFKGVAAVFCYAAFSYGGIEVLVLTANE 323

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 369
             NPRK++P A +  VYR++  Y+ T  ++   V YN P LL +      + ASPFV+A+
Sbjct: 324 QANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAV 383

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
            + G++V+PHI NA +L+ V S  NS LY   R L +L+  G APK F    R G P   
Sbjct: 384 ASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIIC 443

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ--GID 487
           +++SV    +A++       ++F + + V  +  I  W++I I ++ F  A R+Q  G+ 
Sbjct: 444 VLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLR 503

Query: 488 -KSKFAYVAPGQRYGAYFALFFCILIALIKNFTVF--LGH--KFDYKTFITGYIGLPVYI 542
            +    Y A     G+  AL   I I + + +     LGH  + D + F   Y+  PV +
Sbjct: 504 ARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLL 563

Query: 543 ISWAGYKLIYKT--KVIKSTDVDL 564
             +  YK+ ++     I + ++DL
Sbjct: 564 GGYLAYKIWHRDWRLCIPANEIDL 587

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 145/523 (27%), Positives = 246/523 (47%), Gaps = 21/523 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N  L+K +K+RH+ M                       P +++I Y  V  + ++ +   
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAA 142

Query: 139 GEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196
           GEM  +Y  L G F +Y S +V  + GFA  + +  ++  + P +L  +++ I+YW   D
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--ND 200

Query: 197 RVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHD 256
            +N  V+I                         +S K                       
Sbjct: 201 TINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDG 260

Query: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G  YWR+PG+F + S+A      +F     + V + FS+ GIEL  +  +E  NPRKS
Sbjct: 261 YIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLSINEQANPRKS 315

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
            P A K ++YRI++ YL T+ L+G  V +++ +L+ +   S +  ASP+V+A    G++V
Sbjct: 316 TPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSG--SSATHASPYVLAASIHGVKV 373

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           +PHI NA +L+ V S  NS LY + R + +LA  G APK      R G P  AL++    
Sbjct: 374 IPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFV 433

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             + ++  SS   + F +   +  +  I +W  I++ +I F KA + QG    +  Y + 
Sbjct: 434 GLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSN 493

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYKLI 551
              +G+Y+ + F IL+  +  F V L       K D ++F   Y+  P++I  + GY + 
Sbjct: 494 TGIWGSYYGVIFNILV-FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIY 552

Query: 552 YK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
            K  T +     +DL   + +YD E    R +D+E +ERL+++
Sbjct: 553 NKDFTLLNPLDKIDLDFHRRVYDPEIM--RQEDEENKERLRNS 593

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  213 bits (543), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/507 (27%), Positives = 241/507 (47%), Gaps = 18/507 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K+E+  LRK ++ RH+ M                       P  ++I YA +G  ++  +
Sbjct: 121 KEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCII 180

Query: 136 ACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA SY  L G F +Y +  VD   GFA+ + Y  ++  + P +L  A++ I YW 
Sbjct: 181 QACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWT 240

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           ++  VN  +++                       + ++ K                    
Sbjct: 241 TK--VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAG 298

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
               +G +YW DPGAF+   +       +F   +A F  + F++   E   I  SE  NP
Sbjct: 299 TSGYIGAKYWHDPGAFRGDRSI-----DRFKDVMATFTTAAFAFGASEFIAIGASEQSNP 353

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           R+++P A K+ +YRI+  +L ++ L+G  V Y+   L+ +   S    ASP+V+AI + G
Sbjct: 354 RRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSG--SGGTKASPYVLAISSHG 411

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           + V+PH  NA +L+ V S  NS  Y S R L++L+  G AP+ F    R G P  A+I+S
Sbjct: 412 VRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIIS 471

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +LF  +A+   SS   ++F + + +  +  I +W+ I + +I F +A   QG   S+  +
Sbjct: 472 ILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGF 531

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYK 549
            +    +G+ +A    + +ALI  F V +        D K+F   Y+ +P+ I+ + GYK
Sbjct: 532 RSQLGVWGSVYAATM-LFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYK 590

Query: 550 LIYK--TKVIKSTDVDLYTFKEIYDRE 574
           +  +     I++ ++DL T + I+D E
Sbjct: 591 IYNRDWKLFIRAKNIDLITHRNIFDAE 617

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  214 bits (545), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 144/532 (27%), Positives = 251/532 (47%), Gaps = 22/532 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +   ++  L+K +K RH+ M                       P  ++I +  +G  ++ 
Sbjct: 150 NDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYC 209

Query: 134 TMACLGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +  +GE+A +Y  L  GF +Y S  VD A  FA+ + Y  ++  + P +L  A++ I+Y
Sbjct: 210 IIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKY 269

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWL-SSFKXXXXXXXXXXXXXXXXX 250
           W ++  V+P +++                       ++ +S K                 
Sbjct: 270 WTTK--VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICG 327

Query: 251 XXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA 310
                  +G +YW DPGA +   T+I     +F   +A  V + F++   E  G+  SE 
Sbjct: 328 GAGTDGYIGAKYWHDPGALRG-DTSIQ----RFKGCMATLVNAAFAFGMSEFIGVTASEQ 382

Query: 311 ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQ 370
            NPRK++P A K  +YRI+  +L ++ ++G  V YN  +LL + G  + A  SP+V+AI 
Sbjct: 383 SNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKA--SPYVLAIS 440

Query: 371 NSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNAL 430
             G+ V+PH  NA +L+ V S  NS  Y SSR L +LA  G APKI++   R G P   +
Sbjct: 441 THGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGM 500

Query: 431 ILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSK 490
             + +F  +A+   S    ++F + + +  +  + +W+ I I +I F +A   QG    +
Sbjct: 501 ATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGE 560

Query: 491 FAYVAPGQRYGAYFA--LFFCILIA----LIKNFTVFLGHKFDYKTFITGYIGLPVYIIS 544
             + +    YG+ +A  + F ILIA     +      L  K D K F   Y+ +P+ +  
Sbjct: 561 LGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAF 620

Query: 545 WAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
           + GYK+  K     I++ ++DL + + I+D  EE  + ++ E  ERL++  K
Sbjct: 621 YFGYKIWKKDWKLFIRAKNIDLISHRNIFD--EELIKQEEDEYRERLRTGPK 670

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  212 bits (539), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 149/525 (28%), Positives = 251/525 (47%), Gaps = 20/525 (3%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           +   ++  L+++++ RH+ M                       P +++I YA V  +++ 
Sbjct: 73  ESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYC 132

Query: 134 TMACLGEMAS-YIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +    E+A  Y  L  GF +Y S  VD A GF++ + Y  ++  + P +L  A++ I+Y
Sbjct: 133 VIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKY 192

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W     +NP  ++T                      + +  K                  
Sbjct: 193 W--NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGG 250

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             N   LG RYW DPGAF+  S +I     +F   VAV V + F+Y G E + +  +E +
Sbjct: 251 AGNDGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQ 305

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NP+KS+  A K  VYRI+  Y+ T  LLG  V +N   LL + G +  A  SPFV+A+ +
Sbjct: 306 NPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHA--SPFVIAVAS 363

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
            G+ V+PH  NA +L+ V S  NS LY SSR L +L+  G AP+      R G P   L+
Sbjct: 364 HGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLL 423

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +S +F  L+++  S     +F + + +  +  + +W +I + ++   +A   QG    + 
Sbjct: 424 VSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADEL 483

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAG 547
            YVA    +GAY+A+   + I L+  F V +     +K D   F   Y+ +P+ I  + G
Sbjct: 484 GYVAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLG 542

Query: 548 YKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
           YK+  +    +I S++VDL   ++I+D E    R +  E++E+L+
Sbjct: 543 YKIWTRDWRLLIPSSEVDLVAHRKIFDAEVL--RHEQLEEKEQLR 585

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  213 bits (541), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 148/524 (28%), Positives = 254/524 (48%), Gaps = 22/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           E+  L+K +K RH+ M                       P  ++I Y+ +G  ++  +  
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 138 LGEMAS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA  Y  L+G F +Y S  +DPALGF++ + Y  ++  + P +L  A+L I+YW ++
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK 237

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V+P V++                       + +  K                    N 
Sbjct: 238 --VDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGND 295

Query: 256 DRLGFRYWRDPGAFK-EYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
             LG +YW +PGAF+ E++        +F   +  FV + F++   E   +  +E  NPR
Sbjct: 296 GYLGAKYWHEPGAFRGEHAV------DRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPR 349

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K++P A K  +YRI++ +L ++ +LG  V Y+  +LL + G  + A  SP+V+A+   G+
Sbjct: 350 KAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKA--SPYVLAVSLHGV 407

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
            V+PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    R G P  A+++S 
Sbjct: 408 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSA 467

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           LF  +A+   S     +FN+ + +  +  + +W  I + ++ F  A + QG    +  + 
Sbjct: 468 LFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFH 527

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKL 550
           +    YG+ +A    IL AL+  F V +      K D + F   Y+ +P+ I  + GYKL
Sbjct: 528 SQTGVYGSLYAATMMIL-ALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKL 586

Query: 551 IYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
            Y+     IK+  +DL + ++I+D  E   + +D+E +E+L++ 
Sbjct: 587 YYRDWKLYIKADKIDLISHRQIFD--ENILKQEDEEYKEKLRNG 628

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  212 bits (539), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 145/526 (27%), Positives = 250/526 (47%), Gaps = 17/526 (3%)

Query: 71  AVPDGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           AV D    +++L K+L  RH+                         P ++LIA+  +   
Sbjct: 98  AVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTC 157

Query: 131 VFYTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           +F  +  LGE+AS  P+  GF  Y +R+V+P+ GFA+  +YL ++ +L P +L AA++ I
Sbjct: 158 LFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITI 217

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW   +++N   W+                        LS  K                
Sbjct: 218 KYW--NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLIC 275

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309
              P    +G +YW DPGAF       T G  +F    +VFV + FSY+G EL G+  +E
Sbjct: 276 GGGPVGGFIGAKYWHDPGAF----VGDTPG-AQFKGLCSVFVTAAFSYSGTELVGVSAAE 330

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 369
           + NPR ++P+A K + + I   YL  + + G  V  NDPRLL+    S+  AASP V+AI
Sbjct: 331 SINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGM-SSVDVAASPLVIAI 389

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
           +N GI  +P + NA +L+ + S  NS +Y  SR + ++A  G  PK+F    R G P  A
Sbjct: 390 ENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVA 449

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 489
           ++ +++F  L+++  S     IF +   +  +  +  W  I I +I F +A  AQ     
Sbjct: 450 ILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLD 509

Query: 490 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWA 546
           +  Y++     G+++     + + ++  +T            ++F  GY+  P+++I + 
Sbjct: 510 ELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYI 569

Query: 547 GYKLIYKTK---VIKSTDVDLYTFKEIYDREE-EEGRMKDQEKEER 588
            +KL YK      I +  +D+ + +   D EE +E ++++Q +  +
Sbjct: 570 SHKL-YKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAETAK 614

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  212 bits (540), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 154/600 (25%), Positives = 266/600 (44%), Gaps = 40/600 (6%)

Query: 9   FTSTSPRNSSSLDSDHDAY--YSKQNPDNFPVKEQEIYNIDLEENNVXXXXXXXXXXXXX 66
           F      N+SS  +D +A   YS Q  DN           DLE                 
Sbjct: 85  FKRAETPNASSSTADENAVENYSMQEFDN-----------DLENKKSNLHIRDDELDYAT 133

Query: 67  XXXFAVP-DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYA 125
               + P + +DEN +L++ +K RH+ M                       P  ++I Y 
Sbjct: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYG 193

Query: 126 FVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLT 183
            +G  ++  +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++  + P +L 
Sbjct: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253

Query: 184 AAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXX 243
            +++ I+YW ++  V+P V++                       + +  K          
Sbjct: 254 TSSMTIKYWTTK--VDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIM 311

Query: 244 XXXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAV---FVYSLFSYTGI 300
                         +G +YW DPGAF+        G+ K   F  V   FV + F++   
Sbjct: 312 AICINTGAAGTDGYIGAKYWNDPGAFR--------GQTKIERFKGVMDTFVTAAFAFGAT 363

Query: 301 ELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSA 360
           E   +  +E  NPRK++P A K   YRI++ +L ++ L+G  V YN  +L+ +   S   
Sbjct: 364 EFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSS--SGGN 421

Query: 361 AASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT 420
           +ASP+V+A    G+ V+ H  NA +L+ V S  NS  Y SSR L  LA  G APK F   
Sbjct: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481

Query: 421 SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKA 480
            R G P  +++ + +   +A+   S     +F + + +  +  I +W  I + +I F + 
Sbjct: 482 DRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541

Query: 481 CRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYI 536
            + QG    +  + A     G+Y+A    + +AL+  F V L     H  D + F   Y+
Sbjct: 542 MQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYL 600

Query: 537 GLPVYIISWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594
            +P+ +  + G+KL  +     I++ ++DL + + I+D  EE  R +D+E +E+L++  K
Sbjct: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  211 bits (536), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/521 (27%), Positives = 240/521 (46%), Gaps = 22/521 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
            ++ L++ +K RH++M                       P  ++I YA V ++ +  M  
Sbjct: 79  SSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQA 138

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F +Y+S+ +    GFA  + Y  ++  + P +L  A+L I+YW   
Sbjct: 139 AGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW--N 196

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
           D +N  V+I                            K                    + 
Sbjct: 197 DSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDR 256

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G +YW DPGAF     A+  G  KF     V V   FSY G EL  +  +E  NPR+
Sbjct: 257 KYIGAKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRR 311

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++    K  +YRI++ Y+ T+ L+G  V +    L+ + GKS +  ASP+V+A+   G++
Sbjct: 312 AIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKS-ATHASPYVLAVSLHGVK 370

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           ++PHI NA +L+ V S  NS +Y   R L  LA  G AP+  A   R G P  ALI   +
Sbjct: 371 IVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSV 430

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  LA++  S     +F +   +  +  + +W  I++ ++ F +A R      S+  Y A
Sbjct: 431 FGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKA 490

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYKL 550
                G+   L F IL+  I  F V +       K D  +F   Y+  P++++ + GY +
Sbjct: 491 NTGVLGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMI 549

Query: 551 IYKT-KVIKS-TDVDLYTFKEIYDREEEEGRMKDQEKEERL 589
           +++  ++IK   D+DL  ++ IYD++    R+  ++ E ++
Sbjct: 550 VFRNWEIIKPLKDIDLDHYRSIYDQD----RLYQEDLEHKI 586

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  209 bits (531), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 143/504 (28%), Positives = 243/504 (48%), Gaps = 12/504 (2%)

Query: 84  KDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEMAS 143
           + L+ RH+ +                        V++L+ +A   + +        EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 144 YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGV 202
           Y+PL+  F   ASR V+ +L    G+ + F   +  P ++ A   +I YW  RD  +  +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAI 172

Query: 203 WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRY 262
            +                       WL+SFK                   P  DR GFRY
Sbjct: 173 TLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRY 232

Query: 263 WRDPGAFKEYSTA---ITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
             +   FK+YS     I+   G F  F+A  + + F+  G +   ++  E + PRK +P 
Sbjct: 233 IGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPV 291

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSGIEVLP 378
           A K    R+ V +L     +G+  + NDP L +    S   A +SP+V+A+ + GI++LP
Sbjct: 292 AFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILP 351

Query: 379 HIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCG 438
            I NA ++   FSA N+  Y SSR+LY LA+DG AP IF + +R+GVP  A+ +SV++  
Sbjct: 352 DIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSV 411

Query: 439 LAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQ 498
           L+ + ++S SA + N+ +++++   ++++  + +VY+YF +A  AQ  +  + ++ +  Q
Sbjct: 412 LSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQ 471

Query: 499 RYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY---KTK 555
            Y AY  L   +LI +++ +TVF    ++ K F+  Y+ + + I  + GY+ I+   K  
Sbjct: 472 PYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDA 531

Query: 556 VIKSTDVDLYT-FKEIYDREEEEG 578
           VI  T+VDL T   EI   E   G
Sbjct: 532 VIPPTEVDLTTGLLEIELHERHHG 555

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  213 bits (541), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 154/576 (26%), Positives = 259/576 (44%), Gaps = 61/576 (10%)

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
           G  ++  +++ L+ RHI M                       P   L+ ++  G +V  T
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 135 MACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
           +    E+++ IPL  GF+  ASR+V+ A GFA+G+TY F   I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYFD 374

Query: 194 SRDRVNPGV---WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXX 250
           S + +N G    + T                           K                 
Sbjct: 375 SLN-LNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 251 XXPNHDRLGFRYWRDP--------GAFKEY----------STAITGGKGKFVSFVAVFVY 292
               +DR+GFR+W           G F+            +  I G  G+F++  +  + 
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 293 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRL-- 350
           S F+YTG+E+  +   EA NPRK++P A K T   ++V Y+ T+F + + +   DPRL  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 351 ----------------------LSTKGKS---------MSAAASPFVVAIQNSGIEVLPH 379
                                 LS K  +         +   +SP+V+A+QN G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGL 439
           +FN  ++ F   A  S L+ SSR LY++A+  KAP IF + ++ GVPY ++I S +F  +
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 440 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQ----GIDKSKFAYVA 495
            Y+ V SG+ + FN   N+ S    + W+ + + ++ F  A + +      D+  + Y +
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK 555
           P Q Y A++ LF C L  +   FT F+ H ++ K+F + Y GL ++++ + GYK+I  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 556 VIKSTDVDLYTFKEIYDREE-EEGRMKDQEKEERLK 590
           + +   +D+ T +   DR    E R       ERLK
Sbjct: 794 IQRLDQLDMDTGRREMDRVIWNEYRQYSGPYRERLK 829

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  209 bits (531), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 141/530 (26%), Positives = 241/530 (45%), Gaps = 30/530 (5%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            E   L K +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQ 144

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+   Y  L G +T Y S  VDP+LGFA+   Y  ++  + P QL  AA+ ++YW S
Sbjct: 145 AAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS 204

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VN  +++                         +  K                    +
Sbjct: 205 ---VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGD 261

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G  YW +PG F        G KG       VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RKYIGTEYWHNPGPFAH------GFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS+P A K  VYRI++ Y+ T  L+   V YN   LL +   S S A SPFV+A+ + G+
Sbjct: 312 KSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHA-SPFVIAVASHGV 370

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ V S  NS LY   R L +LA  G  PK  A   R G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSL 430

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  + ++  S    ++F + + + S+  +  W+++ + +I F  A   QG   ++  Y 
Sbjct: 431 AFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYK 490

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           A    +G++ A+   +   L+  F V +       K + K F   Y+ +P+ ++++ G+K
Sbjct: 491 AQTGYWGSWLAVLIAVFF-LVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHK 549

Query: 550 LIYKTKV--IKSTDVDLYTFKEIY------DREEEEGRMKDQEKEERLKS 591
           + +K+    I +  +DL + + I+      + ++ +  +K+ E +E L++
Sbjct: 550 IYFKSWSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLEN 599

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  208 bits (529), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/504 (27%), Positives = 231/504 (45%), Gaps = 24/504 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            E   LRK +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+   Y  L G +T Y+S  VDP+LGFA+   Y  ++  + P QL  AA+ ++YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN 204

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VN  +++                         +  K                    +
Sbjct: 205 ---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGD 261

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G  YW +PG F        G KG       VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RRYIGTEYWHNPGPFAH------GFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           +S+P A K  VYRI++ Y+ T  L+G  V YN   LL +   S  + ASPFV+A+ + G+
Sbjct: 312 ESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSG-SSSGSHASPFVIAVSSHGV 370

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ V S  NS LY   R L +LA  G  PK  A   R G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSL 430

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  + ++  S+   ++F + + + S+  +  W+++ + +I F  A   QG    +  Y 
Sbjct: 431 AFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           A    +G++ A+   +   L+  F V +       K D K F   Y+ +P+ ++++ G+K
Sbjct: 491 AQTGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHK 549

Query: 550 LIYKTKV--IKSTDVDLYTFKEIY 571
           + +K+    I +  +DL + + +Y
Sbjct: 550 MYFKSWRFWIPAEKIDLDSHRNVY 573

>Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON}
           YDR160W (SSY1) - regulator of transporters [contig 399]
           PARTIAL
          Length = 565

 Score =  207 bits (526), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 154/544 (28%), Positives = 258/544 (47%), Gaps = 63/544 (11%)

Query: 117 PVAMLIAYAFVGLLVFYTMACLGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYF 175
           P   L+ ++  G +V  TM    E+A+ IPL  G +  ASR+V+ A GFA+G++Y   Y 
Sbjct: 25  PFGFLLGFSICGSIVLATMLSFTEIATLIPLSSGISGLASRFVEDAFGFALGWSYWLTYA 84

Query: 176 ILPPNQLTAAALVIQYWISRD-RVNPGV-WITXXXXXXXXXXXXXXXXXXXXXXWLSSFK 233
           I   NQ+ A+  ++ Y+ +   R    V ++T                        + FK
Sbjct: 85  ITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFLVFAIAGNLLDVNILAELAYGFTFFK 144

Query: 234 XXXXXXXXXXXXXXXXXXXPN-HDRLGFRYW---RDP-----GAFKEY----------ST 274
                               + H R+GFR+W   + P     G F+              
Sbjct: 145 IVITATMIFAMVILNAGAGRHKHPRVGFRFWDASKSPENLTYGLFRPTFDLQDVGDGAKN 204

Query: 275 AITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLC 334
            I G KG+F+S + V + S FS++G+E+  + C EA NPR+S+P A K T+  +I+ Y+ 
Sbjct: 205 GIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGEAANPRRSLPSATKRTIMTVIILYVV 264

Query: 335 TVFLLGMCVAYNDPRLL-----STKGKSMSA----------------------------A 361
           ++F++ + V   D RLL     +T+  + S+                            +
Sbjct: 265 SIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAFNNNWQTDQVCTAHEIVSTTDFTNGS 324

Query: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421
            SP+V+A+++ G+     +FNA +++F  ++  S LY SSR LY+++I GKAP IF   S
Sbjct: 325 QSPWVLALESFGLCTFSSVFNAMLVIFGVTSELSSLYASSRTLYSMSIQGKAPPIFKICS 384

Query: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481
           R GVPY A+I S LF  LAY+ V++ + +IF    N+      + W    + ++ F  A 
Sbjct: 385 RKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALANISGATISIIWFGFNLSFLRFYYAL 444

Query: 482 RAQ----GIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIG 537
           + +      +   F Y +P Q + A + LF   LI ++  F+ FL   ++ K F + Y G
Sbjct: 445 KRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLIVVLMGFSNFLDGFWNTKMFFSSYGG 504

Query: 538 LPVYIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDRE-EEEGRMKDQEKEERLKSNGKNM 596
           L V+I+ +AGY+L+  +K+ +   +DL + +   DR    E R       ER++   K +
Sbjct: 505 LIVFILCYAGYRLLGTSKIQRLDQLDLDSGRREMDRMIWTEHREYTNSVRERIR---KLV 561

Query: 597 EWFY 600
            W +
Sbjct: 562 TWMF 565

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 245/518 (47%), Gaps = 17/518 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           K   + L+  LK+RH+ M                       P  +LI +   G ++F  +
Sbjct: 82  KTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMV 141

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             LGE+A   P+ G F +YA+R++D + GFA  + Y+F++ +  P ++ AA++ + YW +
Sbjct: 142 MALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWET 201

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
             R   G ++                         S  K                   P 
Sbjct: 202 PVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPV 260

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G RYW DPGAF  +S        +F  F +VFV + FS+ G EL GI  +E++NPR
Sbjct: 261 GGYVGGRYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPR 315

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KSVP+A K   +RI++FY+  + L+G+ V Y DPRLL + G  + A+ASPFV+AI   GI
Sbjct: 316 KSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSG--VDASASPFVIAIVTHGI 373

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
             LP + N  +L+ V S  NS +Y  SR L AL+  G  PK  A   R G P   + +  
Sbjct: 374 SGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICS 433

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  +A++  S+   ++FN+ + +  +   L+W +I   +I F  A +  G    +  + 
Sbjct: 434 GFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFK 493

Query: 495 APGQRYGAYFALFFCILIALIKNFTVF--LGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           +P    G+Y+ +   +L+ + + +     +G   +   F + Y+  P+ +  +  +KL  
Sbjct: 494 SPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWK 553

Query: 553 KT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           +    +I   D+D+ T +    RE +   +K +  EE+
Sbjct: 554 RNWKLLIPLKDIDIDTGR----RETDINLLKQEIAEEK 587

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  206 bits (525), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 149/521 (28%), Positives = 239/521 (45%), Gaps = 30/521 (5%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           DEN  L K +++RH+ M                       P+ ++I Y    L+VF  + 
Sbjct: 80  DEN-DLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQ 138

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+   Y  + G FT Y +  VDPA GFAI + Y  ++ I+ P QL  AA+ IQ+W  
Sbjct: 139 AAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFW-- 196

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VN  V++                       + +  K                   PN
Sbjct: 197 NVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPN 256

Query: 255 HDR--LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
                +G +YWR+PG F             F    +VF Y+ FSY G+E   +  +E +N
Sbjct: 257 GPDGYIGGKYWRNPGLFAN----------GFKGVCSVFCYAAFSYGGVETLVLSAAEQKN 306

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           P KS+P A K  +YRI+  YL ++ ++   V Y  P L+ +      + +SPFV+AI + 
Sbjct: 307 PLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSS--GSGSHSSPFVIAIASH 364

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G+ V+PH+ NA +L+ V S  NS LYV+ R L +LA  G APK      + G P    ++
Sbjct: 365 GVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLV 424

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
            VLF  + ++  S     +F + +++  +  I  WI+I + +I F  A R QG   ++ A
Sbjct: 425 VVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIA 484

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAG 547
           Y A    +G+Y A+   + + L+  F V +       K D   F   Y+  PV + ++ G
Sbjct: 485 YKAQTGYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLG 543

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
           +K+ YK    +I +  ++L   + +Y  EE    ++D+  E
Sbjct: 544 FKVYYKQWQLLIPADKIELDNNRNVYVPEEA---LEDKPLE 581

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  207 bits (526), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 246/519 (47%), Gaps = 21/519 (4%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           ++ L++ LK RH+ M                       P A++IA+   G +V+  +  L
Sbjct: 86  SSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQAL 145

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
           GE+A  +P+ G + SY SR+++P+ GFAI Y YL    I  P +L AA++ + YW   D 
Sbjct: 146 GELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDS 204

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
                ++                         S  K                   P+ + 
Sbjct: 205 KYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEG 264

Query: 258 -LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G RYW +PG F             F  F A+FV S FS+ G E+  +  +E ENPRK 
Sbjct: 265 YIGARYWYNPGGFAH----------GFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKD 314

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376
           +P+A K   +RI +FY+ ++ L+G  V Y D  L +    S+ A+ASPFV+AI  +GI+ 
Sbjct: 315 LPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAAS--SVDASASPFVIAIARAGIKG 372

Query: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436
           LP + N  +L+ V S  N  +Y +SR + +LA  G  P+ F    R G P   ++L  +F
Sbjct: 373 LPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIF 432

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
             L++++ SS   ++F++ + +  +     W +I + ++ F +A   QG    + +Y A 
Sbjct: 433 GLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQ 492

Query: 497 GQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
              +G+ + +   I I L   F V L   G   +   F + Y+ LPV I  +  +KL  +
Sbjct: 493 TGIWGSLYGIGL-IFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTR 551

Query: 554 --TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
             T +IKS+D+D+ T +   D E  +  ++++++  R K
Sbjct: 552 SWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSK 590

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  208 bits (530), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 155/582 (26%), Positives = 254/582 (43%), Gaps = 48/582 (8%)

Query: 17  SSSLDSDHDAYYSKQNPDNFPVKEQEIY--NIDLEENNVXXXXXXXXXXXXXXXXFAVPD 74
           S+++D+ +D   ++ +P+N   K + IY  N DLE+                        
Sbjct: 108 STNIDTAYDMNSNEVDPNN--KKNENIYALNDDLEDGTTSI------------------- 146

Query: 75  GKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYT 134
              E+   +  +KARH+ M                       P  +++ Y  V  + ++ 
Sbjct: 147 AASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFV 206

Query: 135 MACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           +   GEMA   P    GF +Y S ++    GFA  + +   +  + P +L  +++ ++YW
Sbjct: 207 VQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYW 266

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
            +   +NP +++                       + +S K                   
Sbjct: 267 TTS--INPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGA 324

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
            +   +G +YW DPG F     A   G  +F     V + + FSY G EL  +  +E EN
Sbjct: 325 GHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQEN 379

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PRK+VP A K +VYR+ + YL T+ L+G  V YN P L+   G + S  ASP+V+A Q  
Sbjct: 380 PRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLM---GNANSKDASPYVLAAQIH 436

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
           G++++PH  NA +L+ V S  NS L+   R L  LA  G APK      R G P  AL +
Sbjct: 437 GVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCV 496

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
             LF  +A+   S    ++F +   +  +  + +W  IL+ +I F  A +  G    +  
Sbjct: 497 CSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVG 556

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIISWAG 547
           Y A    +G+Y+ LFF +L+ LI  F V L     G +    +F   Y+   +++  +  
Sbjct: 557 YKAITGIWGSYYGLFFNLLV-LIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYLC 615

Query: 548 YKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEE 587
           Y +  K  T +I   D+D+   + IYD +        QEKEE
Sbjct: 616 YMIYNKDWTILIPLKDIDVDYQRRIYDAD-----FLRQEKEE 652

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  207 bits (527), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 148/524 (28%), Positives = 253/524 (48%), Gaps = 25/524 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           +   L++D+  RH+                         P  +LI YA +G  V+  +  
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 138 LGEMA-SYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GE+  +Y  L  GF +Y +  V P+  F++G+ Y  ++  + P +L  A+L I+YW ++
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK 232

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             V+P V++                       + +  K                    + 
Sbjct: 233 --VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHD 290

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             LG +YW +PGAF+    AI   KG      +VFV S F++ G E   +  SE  NPRK
Sbjct: 291 GYLGGKYWHNPGAFRG-EKAIDHFKG----VSSVFVTSAFAFGGSEFVALSASEQANPRK 345

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLL-STKGKSMSAAASPFVVAIQNSGI 374
           S+P A KL +YRII  YL ++ +LG  V ++ P+L  S+ GK      SP+VVAI   G+
Sbjct: 346 SIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKK----TSPYVVAIAMHGV 401

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH+ NA +L+ V S  NS  + SSR L +L+  G APK F    R G P  A+++S 
Sbjct: 402 KVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISA 461

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           LF  + +   S     +F++ + +  +  I ++ +I + +I    A + QG    +  + 
Sbjct: 462 LFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFR 521

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKL 550
           +    YG+++A    +L +L+  F V L      K D ++F   Y+  P+ I+ + GY +
Sbjct: 522 SQVGTYGSFYACLLLVL-SLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGY-M 579

Query: 551 IYKTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591
           I+K      I+S D+DL   ++++D  E+  + +D+E  E++++
Sbjct: 580 IWKKDFRIFIRSKDIDLDFKRQVFD--EDLIKQEDEEYAEQMRN 621

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  205 bits (522), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 131/505 (25%), Positives = 236/505 (46%), Gaps = 9/505 (1%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T  R+ L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 75  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 134

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 135 AEMVCFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 192

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
            + G+ +                       WL+SFK                   P HDR
Sbjct: 193 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDR 252

Query: 258 LGFRYWRDPGAFKEY---STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
            GFRY+ +   FK+Y      +    G F  F+A  + + F+  G E   ++  E + PR
Sbjct: 253 YGFRYYGE-SPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPR 311

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSG 373
           K +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N  
Sbjct: 312 KVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMK 371

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I +LP + N  ++   FSA N+  Y SSR  Y +A+DG APKIF K ++ GVP  A+ +S
Sbjct: 372 IRILPDVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGIS 431

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +++  ++ + ++S SA + N+ +N+++   +++++ + I+Y++F +    Q     K  +
Sbjct: 432 LIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPF 491

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            + GQ Y A   L  C+ + +I+ +TVF    ++ + F+  Y+ + + I  + GYK I+K
Sbjct: 492 RSWGQPYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWK 551

Query: 554 TKVIKSTDVDLYTF-KEIYDREEEE 577
               K  D     F KE+ + E  E
Sbjct: 552 RGKDKVKDPYKIDFSKELIEIENHE 576

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/524 (27%), Positives = 242/524 (46%), Gaps = 20/524 (3%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
             T+L++ + +RH+ M                       P  + I YA +G  ++  +  
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA SY  L G F +Y S  +DPALGF++ + Y  ++  + P +L  A + I+YW + 
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             VNP V++                       + ++ K                    N 
Sbjct: 195 --VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGND 252

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             LG +YW DPGA   Y T        F   +A  V + F++   E   +  +E  NPR+
Sbjct: 253 GYLGGKYWHDPGAL--YGTKPIH---HFKGIIATMVTAAFAFGATEFIALTAAEQANPRR 307

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A K  VYR+++ +L  + LLG  V YN   L+ + G +  A  SP+V+AI + G++
Sbjct: 308 AIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHA--SPYVIAIASHGVK 365

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           V+PH  NA +L+ V S  NS  Y SSR L +L+    AP       R G P  A+++S +
Sbjct: 366 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCI 425

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  +A++  S     +F + + +  +  + +WI I + +I F KA   QG    +  Y +
Sbjct: 426 FGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKS 485

Query: 496 PGQRYGAYFA--LFFCILIALIKNFTVFLG-HKFDYKTFITGYIGLPVYIISWAGYKLIY 552
                G+Y+A  +  C+L          +G  K D   F   Y+ +P+ I  + GY+ ++
Sbjct: 486 QTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYR-VW 544

Query: 553 KTK---VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
           K      I    +DL + ++++D  E+  + +D E EE ++++G
Sbjct: 545 KRDWKLYIPLEQIDLVSHRKVFD--EDLLKQEDAEYEESIRNSG 586

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  203 bits (516), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 232/523 (44%), Gaps = 31/523 (5%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           D ++ +++ LK RHIS+                       P+A+L+ +  +GL+ F  M 
Sbjct: 37  DPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIME 96

Query: 137 CLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            +GE+ +  P  G F + A R+    L    GY Y+  +F +  N+    + ++Q+W   
Sbjct: 97  SIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFW--- 153

Query: 196 DRVNPGVWITXXXXXX----XXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
               P V I                           WL+ FK                  
Sbjct: 154 ---GPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGG 210

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
            P    +GF+YW++PGA              F     VFV+    Y+G E   +  +E+ 
Sbjct: 211 IPGKPPIGFQYWKNPGALSH----------GFRGIAVVFVFCSTFYSGTESVALAATESR 260

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NPRK+VP A++ T +RI++ YL   F  G+ V YNDP L    G    +  SP  +A+  
Sbjct: 261 NPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL----GAQTKSLKSPISIALSR 316

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +G     H+ NA +L+   SA NS LY+ SR L  LA +G AP+I A T + GVP  ALI
Sbjct: 317 AGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALI 376

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +      ++ MNVS G++  +NY VN+  +   + W  I I ++ F KA  AQG   S+ 
Sbjct: 377 VFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSEL 436

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y A    +   F+L   I +ALI+ +T  +   F  K F+  YI LP   + + G    
Sbjct: 437 PYRALFYPWTTIFSLAANIFLALIQGWTSLV--PFVAKDFVDAYILLPAAGLLYVGINF- 493

Query: 552 YKTKVIKSTDVDLYTFKEIYDR---EEEEGRMKDQEKEERLKS 591
           +K +  K+ ++     +E   R   E+ +       K  R+K+
Sbjct: 494 WKNRNFKTVNIHGINLEEGQRRDLDEDSDDETGTAPKSTRMKA 536

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 244/531 (45%), Gaps = 19/531 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
           +  +  L+  LK RH+ M                       P  +LI +   G +++  +
Sbjct: 75  RTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMV 134

Query: 136 ACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             +GE++   P+ G FT+YA+R++D + GFA  + Y+ ++  + P ++ AA++ + YW +
Sbjct: 135 MAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGT 194

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
             +   G ++                         S  K                   P 
Sbjct: 195 DPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPE 253

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +Y+ DPGAF       T G  +F    +VFV + FS+ G EL GI  +E+  PR
Sbjct: 254 GGYIGGKYFHDPGAF----VGDTAG-ARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPR 308

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KSVPKA K   +RI +FY+ ++ ++G+ V Y D RL+     S+ AAASPFV+AI + GI
Sbjct: 309 KSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGAS--SVDAAASPFVIAITSHGI 366

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
             LP + N  +L+ V S  NS +Y  SR L ALA     PKIF    R G P   +  + 
Sbjct: 367 RGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTS 426

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  +A++  S    ++F + + +  +  + +W  I   +I F  A  AQG    +  + 
Sbjct: 427 AFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFK 486

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL--GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           AP   YG+ + LF  +L+ + + +      G K   + F   Y+  PV +  + G+KL  
Sbjct: 487 APAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYA 546

Query: 553 KT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYE 601
           +    +I  + +D+ T +    RE +   ++ +  EE+   + +   W+Y 
Sbjct: 547 RNWKLLIPLSKLDIDTGR----REMDLDVLRQEIAEEKQMMSTR--PWWYR 591

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  204 bits (518), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 149/530 (28%), Positives = 246/530 (46%), Gaps = 24/530 (4%)

Query: 78  ENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMAC 137
           + T+L++ ++ RH+ M                       P  +LI Y  V ++ +  M  
Sbjct: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118

Query: 138 LGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            GEMA +Y  L G F +Y+S ++    GFA  + +  ++  + P +L  A +VI+YW  +
Sbjct: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW--K 176

Query: 196 DRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNH 255
             VN  V++                         +  K                    + 
Sbjct: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236

Query: 256 DRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRK 315
             +G RYWR+PG+F    T +   KG       V V + FS+ G+EL  +  +E  NP+ 
Sbjct: 237 GYIGDRYWRNPGSFVS-GTPLDKLKGT----AYVLVTAYFSFGGMELYALSVNELPNPKT 291

Query: 316 SVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIE 375
           ++P A K  VYRI++ YL T+ ++G  V ++  RL+ +   S     SP+V+AI+  G++
Sbjct: 292 AIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSG--SNDVHPSPYVLAIEMHGVK 349

Query: 376 VLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVL 435
           VLPHI NA +L+ V S  NS +Y + R L ALA  G APK      R G P  +LIL  +
Sbjct: 350 VLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAI 409

Query: 436 FCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVA 495
           F  +A+   S    KIF +   +  +  + +W +I + +  F +A + QG       Y A
Sbjct: 410 FGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRA 469

Query: 496 PGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKLI 551
              ++G+ +A+FF +L+  I  F V L      K D  +F   Y+  P+++I + GY + 
Sbjct: 470 ITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVY 528

Query: 552 YKT-KVIKSTD-VDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWF 599
            +   ++   D +DL T + +YD E     +K +E E   K   +N  W+
Sbjct: 529 SRNWTLLNPLDKMDLDTHRRVYDVEV----LKQEEYE--FKERMRNSPWY 572

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 152/521 (29%), Positives = 242/521 (46%), Gaps = 24/521 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L++ +K RH+ M                       P  ++  YA +G  V+  +   GEM
Sbjct: 110 LKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEM 169

Query: 142 AS-YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           A  Y  L+G F +Y +  V+P          LF         +       +YW +R  V+
Sbjct: 170 AVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTR--VD 227

Query: 200 PGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLG 259
           P V++                       + +  K                    N   LG
Sbjct: 228 PDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLG 287

Query: 260 FRYWRDPGAFKEYSTAITGGKG--KFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
             YWR+PGAF+       G KG   F   VA  V + F++ G E   +  +E  NPRK++
Sbjct: 288 NIYWRNPGAFR-------GDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAI 340

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           P A K  +YRI++ YL ++ L+G  V +  P LL +   S + AASP+V+A+ + G+ V+
Sbjct: 341 PSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSG--SAATAASPYVIAVASHGVRVV 398

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           PH  NA +L+ V S  NS  Y SSR L +L+  G APK F    R G P  A+I+S LF 
Sbjct: 399 PHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFG 458

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            +A+   S    ++F + + +  +  I +WI+I + +I F  A +AQG    +  + A  
Sbjct: 459 VIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQT 518

Query: 498 QRYGAYFALFFCILIALIKNFTVFLG----HKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
             +G+Y+++F  IL  LI  F V +      +   + F   Y+ +P+ I  + GYK+  K
Sbjct: 519 GIWGSYYSIFLMIL-TLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKK 577

Query: 554 --TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
             T  IK+ D+DL + ++I+D  EE  + +D E +E+LK+ 
Sbjct: 578 DWTLYIKAEDIDLISHRQIFD--EELLKQEDYELKEKLKNG 616

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  203 bits (517), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 146/538 (27%), Positives = 247/538 (45%), Gaps = 29/538 (5%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DG      L++ LKARH+ M                       P+A++I ++  G  +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           T+  LGE+    P+ G F +Y++R++DP++ F I   Y+ ++F + P ++ A+A+ IQYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                ++P VW+                         SS K                   
Sbjct: 197 --NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGG 254

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
           P+HD +G RYW DPG               F   ++V V + +S  G E+  +   E  N
Sbjct: 255 PDHDFVGARYWHDPGCLSH----------GFPGVLSVLVVASYSLGGTEMVCLASGET-N 303

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
           PR+ +P AIK T +RI+ F+L ++ L+G  V Y +P LL       S   SPFV+AI+  
Sbjct: 304 PRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGS----SVNNSPFVIAIKLH 358

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I+ LP I NA +L+ + S  NS ++ SSR L ++A  G  PK F    R G P   ++ 
Sbjct: 359 HIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILT 418

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + LF  LA++  SS   ++F++ + +  +   + W++I I +I F  A +AQG    +  
Sbjct: 419 NSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELE 478

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVF--LGHKFD----YKTFITGYIGLPVYIISWA 546
           +V+    +G+ ++     LI + + +     +G   D     KTF   Y+   +    + 
Sbjct: 479 FVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFV 538

Query: 547 GYKLIYKTKVIKSTDV-DLYTFKEIYDREEEEGRMKDQEKEER---LKSNGKNMEWFY 600
            +K+ Y+ K  K   + DL       DR+  +  +  QE  ER   L+++   + W++
Sbjct: 539 CHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYH 596

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  202 bits (514), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 239/523 (45%), Gaps = 27/523 (5%)

Query: 71  AVPDGKDEN---TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFV 127
           AV D +D +     L + L  RHI+M                       P ++ I Y  +
Sbjct: 43  AVTDLEDHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIM 102

Query: 128 GLLVFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAA 186
           G +V+ TM CLGEM++++P+ G F SYA ++   +  FA+   Y F   +   + LTA  
Sbjct: 103 GGVVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQ 162

Query: 187 LVIQYWISRDRVNPGVWITXXX--XXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXX 244
           LV+ YW S     P  W                          WL+  K           
Sbjct: 163 LVLDYWKSSQHNFP-YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILA 221

Query: 245 XXXXXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTG 304
                   P+H+ +GF+YW    ++KE +  + G KG    FV +FV S FSY G E   
Sbjct: 222 IVVNVGHNPDHEYIGFKYW----SYKE-APFVNGFKG----FVTIFVSSAFSYGGTESIT 272

Query: 305 IVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASP 364
           +   EA NP ++ P+ +K   +RI++FY+ T+F + M + Y+ P  LSTK    S   SP
Sbjct: 273 LTAGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPN-LSTK----SVMTSP 327

Query: 365 FVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKA-PKIFAKTSRW 423
           F +  Q +G +      NA +L  + SA N  L+  SR LY + ++G   PK+  KT+R+
Sbjct: 328 FTIIFQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRY 387

Query: 424 GVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRA 483
             PY A+IL+    GL +     G+  ++ +  N+V +   ++W++I +  I F K    
Sbjct: 388 RAPYVAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQ 447

Query: 484 QGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
           QG    +  +      YG YF + F  LI L++ ++ F    +    F + Y+ L V+  
Sbjct: 448 QG-KTQELQFKNWTYPYGPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPT 504

Query: 544 SWAGYKLIYKTKVIKSTDVDLYTFKEIYDRE--EEEGRMKDQE 584
            W  + +  + + +K  D+D  T + I   +  EE  R+ + E
Sbjct: 505 CWLIWWIFKRDRFVKPEDMDFITDRYIQSPQEIEENERLDNLE 547

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  203 bits (516), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 145/544 (26%), Positives = 249/544 (45%), Gaps = 41/544 (7%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DG  +   L++ LKARH+ M                       P+A++I +A  G  +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           T+  LGE+    P+ G F +Y++R++DP+L F I   Y+ ++F + P ++ ++A+ +QYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
                ++P VW+                         SS K                   
Sbjct: 197 --NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGG 254

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
           P+HD +G +YW DPG               F   ++V V + +S  G E+  +  +  E 
Sbjct: 255 PDHDFVGAKYWHDPGCLAH----------GFPGVLSVLVVASYSLGGTEM--VCLASGET 302

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
             K +P AIK T +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+AI+  
Sbjct: 303 DPKELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGS----SVNNSPFVIAIKLH 358

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I+VLP I NA +L+ + S  NS ++ SSR L ++A  G  P+ F    R G P   +I 
Sbjct: 359 QIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIIT 418

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + LF  LA++  SS  +++F++ + +  +   + W++I I +I F  A +AQG    +  
Sbjct: 419 NSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELE 478

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYIISW 545
           +V+    +G+ ++     LI L+  F   L             K F   Y+   + I+ +
Sbjct: 479 FVSAVGIWGSAYSAVINSLI-LVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLF 537

Query: 546 AGYKLIYKTK------VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER---LKSNGKNM 596
            G+K+ Y+ K      ++    +DL T     DR+  +  +  QE  ER   L+++   +
Sbjct: 538 VGHKIFYRYKTGKWWSMLPLNKIDLET-----DRKNIDIEILKQEIAERNRHLRASPWYV 592

Query: 597 EWFY 600
            W++
Sbjct: 593 RWYH 596

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 132/508 (25%), Positives = 236/508 (46%), Gaps = 15/508 (2%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T  R+ L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 82  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 141

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD 
Sbjct: 142 AEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 199

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
            + G+ +                       WL+SFK                   P HDR
Sbjct: 200 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDR 259

Query: 258 LGFR-YWRDPGAFKEY---STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
            GFR Y   P  FK+Y      +    G F  F+A  + + F+  G E   ++  E + P
Sbjct: 260 YGFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRP 317

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 372
           RK +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N 
Sbjct: 318 RKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNL 377

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I +LP I N  ++   FSA N+  Y SSR  Y +A+DG APK+F + +R GVP  ++ +
Sbjct: 378 KIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGI 437

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S+++  ++ + ++S SA + N+ +N+++   +++++ + I+Y++F +A R Q     +  
Sbjct: 438 SLIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLP 497

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + + GQ Y A   L  C  + LI+ +TVF    +  + F+  Y+ + + I  + GYK I+
Sbjct: 498 FRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIW 557

Query: 553 ---KTKVIKSTDVDLYTFKEIYDREEEE 577
              K  +    D+D    KE+ + E  E
Sbjct: 558 KRGKDSLKNPHDIDFS--KELTEIENHE 583

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 128/480 (26%), Positives = 225/480 (46%), Gaps = 10/480 (2%)

Query: 80  TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLG 139
           T  R+ L+ RH+ +                       P ++L+A+A   + +        
Sbjct: 82  TETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTA 141

Query: 140 EMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 198
           EM  + P+   F   A++ VD +L     + + F   +  P ++ +   +I YW  RD  
Sbjct: 142 EMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDY 199

Query: 199 NPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRL 258
           + G+ +                       WL+SFK                   P HDR 
Sbjct: 200 SAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRY 259

Query: 259 GFR-YWRDPGAFKEY---STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
           GFR Y   P  FK+Y      +    G F  F+A  + + F+  G E   ++  E + PR
Sbjct: 260 GFRNYGESP--FKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPR 317

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSG 373
           K +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N  
Sbjct: 318 KVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLK 377

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I +LP I N  ++   FSA N+  Y SSR  Y +A+DG APKIF + +R GVP  ++ +S
Sbjct: 378 IRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAIS 437

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +++  ++ + ++S SA + N+ +N+++   +++++ + IVY++F +A   Q     K  +
Sbjct: 438 LVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPF 497

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553
            + GQ Y A   L  C  + LI+ +TVF    ++ + F+  Y+ + + I  + GYK I+K
Sbjct: 498 RSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWK 557

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  200 bits (509), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 153/528 (28%), Positives = 232/528 (43%), Gaps = 34/528 (6%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           D NT +++ LK RHIS+                       P+++L+ +  +G++ F  M 
Sbjct: 39  DPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVME 98

Query: 137 CLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            +GEM +  P   GF++ + R+   AL    GY Y+  +F +  N+    + ++Q+W   
Sbjct: 99  SIGEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW--- 155

Query: 196 DRVNPGV----WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
               P V    +I                       WL+ FK                  
Sbjct: 156 ---GPQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGG 212

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             N    GF YW +PGA  +           F     VFV+    Y+G E   +  +E+ 
Sbjct: 213 IKNRPAFGFHYWNNPGALAD----------GFKGIAVVFVFCSSFYSGTESVALAATESR 262

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NP K+VP AIK T +RII+ YL      G  V YND  L    G    A  SP  +AI  
Sbjct: 263 NPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITR 318

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +G E   H+ NA +L+   SA N  LY+ SR L  LA +G APK    T + GVP  A+ 
Sbjct: 319 AGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAIT 378

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           L      ++ MNVS G++  ++Y VN+  +   + W  I + ++ F KA   QG   S+ 
Sbjct: 379 LFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASEL 438

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y +    +G  F+L   I + LI+ +T F+   F  K F+  YI LP  +I    Y +I
Sbjct: 439 PYKSLLFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVIL---YIVI 493

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEE---EGRMKDQEKEER-LKSNGKN 595
              K+     VDL T      R E+   +G  +D E ++R ++S  +N
Sbjct: 494 SLVKIGGFKLVDLRTVDLEEGRREDLDSDGTDEDSEGKDRSVRSAKRN 541

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  202 bits (514), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 148/532 (27%), Positives = 239/532 (44%), Gaps = 22/532 (4%)

Query: 74  DGKDENTR--LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLV 131
           +G  E  R  L+K +K+RH+ M                       P  ++I Y  V ++ 
Sbjct: 133 NGHREKPRAQLKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIIT 192

Query: 132 FYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           +  +   GEM  +Y  L G F +Y S ++   +GFA  +    ++  + P +L AA++ I
Sbjct: 193 YLLIQAAGEMGVAYPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTI 252

Query: 190 QYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXX 249
           +YW +   ++P V++                         +  K                
Sbjct: 253 KYWTTS--ISPDVFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINC 310

Query: 250 XXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSE 309
               +   +G +YW  PGAF   ++A      +F     + V + FSY G EL  +  +E
Sbjct: 311 GGAGHDGYIGGKYWHTPGAFVGKNSA-----SRFKDVCYILVTAFFSYGGTELFVLTINE 365

Query: 310 AENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS-TKGKSMSAAASPFVVA 368
             NPRKS P A K T+YRI++ YL T+ LLG  V Y++  L S T     S + SP+V+A
Sbjct: 366 QPNPRKSTPTAAKTTIYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLA 425

Query: 369 IQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYN 428
               G++V+PH  NA VL+ + S  NS  Y + R + +LA  G APK  A   R G P  
Sbjct: 426 ASIHGVKVVPHFINAVVLIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIY 485

Query: 429 ALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDK 488
            L++  L   + +   S    ++F +   +  +  +  W    + +I F  A + QG D 
Sbjct: 486 GLLICSLLGVIGFAAASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDI 545

Query: 489 SKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYII 543
           ++  Y A    +G+     F +L+ LI NF V L     G     K F    + LP++I 
Sbjct: 546 NEVGYKAACGIWGSIIGACFNVLV-LIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIF 604

Query: 544 SWAGYKLIYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
              GY +I K  VI +    +DL   ++IYD E+   + +D+E  ER+++ G
Sbjct: 605 FAVGYMVIKKDWVIWNPIESIDLDYCRKIYDPEQL--KREDEENRERIRNAG 654

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  201 bits (511), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 141/542 (26%), Positives = 240/542 (44%), Gaps = 30/542 (5%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            E   L + +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+   Y  L G +T Y+S  VDP+LGFA+   Y  ++  + P QL  AA+ I+YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWTN 204

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VN  +++                         +  K                    +
Sbjct: 205 ---VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGD 261

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW +PG F             F     VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RKFIGTKYWHNPGPFAH----------GFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS+P A K  VYRI+  Y+ T  L+   V YN   LL +   S  + ASPFV+A+ + G+
Sbjct: 312 KSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSG-SSSGSHASPFVIAVASHGV 370

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ V S  NS LY + R L +LA  G  PK  A   R G P    ++S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSI 430

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  + ++  S    ++F + + + S+  +  W+++ + +I F  A   QG    +  Y 
Sbjct: 431 IFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 495 APGQRYGAYF----ALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKL 550
           A    +G++     ALFF +    +    V    K D   F   Y+ +P+ + ++ G+K+
Sbjct: 491 AQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKI 550

Query: 551 IYKTKV--IKSTDVDLYTFKEIY-------DREEEEGRMKDQEKEERLKS-NGKNMEWFY 600
             K+    I +  +DL + + IY         + ++  +K+ E  E  ++ NG     F+
Sbjct: 551 YTKSWKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYETSESSENPNGSGSRKFF 610

Query: 601 EK 602
           ++
Sbjct: 611 KR 612

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  200 bits (508), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 225/482 (46%), Gaps = 29/482 (6%)

Query: 117 PVAMLIAYAFVGLLVFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYF 175
           P ++LI +  VG  +   + C  E++   P+ G +  +ASR++DP++GF+IG  YL  + 
Sbjct: 103 PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWL 162

Query: 176 ILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXX 235
           I  P++L   +L I YW     VNP  W+                       ++S FK  
Sbjct: 163 ISYPSELVGCSLTISYW--APSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIV 220

Query: 236 XXXXXXXXXXXXXXXXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSL 294
                            P+    +G +YW DPG+F             F +    FV + 
Sbjct: 221 ALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGSF---------AVPVFKNLCNTFVSAA 271

Query: 295 FSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK 354
           +S++G E+  +  +EA +   SV +A K T +RII+FY+ TV ++G  V YNDPRL+S  
Sbjct: 272 YSFSGTEMVVLTSTEARSV-SSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGS 330

Query: 355 GKSMSAAASPFVVAIQNSGI--EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 412
             S    ASPFV+A+ N+G     + H  NA +L+ VFS CNS +Y SSR +  LA  G+
Sbjct: 331 -SSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQ 389

Query: 413 APKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 472
            PKI A   R G P   + +   F  L ++ VS     +F +   + S+    +W  I  
Sbjct: 390 LPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICF 449

Query: 473 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVF-----LGHKFD 527
             + F  A +AQG  K    Y +     G Y  +F CIL  L+    ++     +G    
Sbjct: 450 CQVRFRMAMKAQGRSKDDIIYRS---TLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPSS 506

Query: 528 YKTFITGYIGLPVYIISWAGYKLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQE 584
              F    + +P+ I  + G+++    ++   IK  D+DL +   + D E  +   +D++
Sbjct: 507 AANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFEATKLE-RDED 565

Query: 585 KE 586
           K+
Sbjct: 566 KK 567

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  200 bits (509), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/539 (26%), Positives = 242/539 (44%), Gaps = 34/539 (6%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           D + ++T+L K +KARH+ M                       P  ++I Y    ++++ 
Sbjct: 82  DLEMQDTQLSKTIKARHLLMISLGTGIATGLLVGNGQVLSKAGPGGLVIGYFISSVMIYC 141

Query: 134 TMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            +   GE+   Y  L G FT Y+S  +DP+LGFA+   Y F++  + P QL  AA+ I++
Sbjct: 142 MIQSAGELGICYRGLVGNFTRYSSLLIDPSLGFALSILYTFQWLTVLPLQLVTAAITIEF 201

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W     +NP +++                       + +  K                  
Sbjct: 202 WTD---LNPDIFVAIIFIVVIVVNLFGARGYAEAEFFCNLCKILMIIGFIILSIIIISGG 258

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             N   +G +YW++PGAF             F     VF Y+ FSY GIE+  +   E E
Sbjct: 259 AGNDGYIGAKYWKNPGAFAN----------GFKGVCTVFTYAAFSYGGIEVLVLSIDEQE 308

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLST--KGKSMSAAASPFVVAI 369
           NP K VP   K   YRI+  YL T  L+   V Y  P+LL +  KG++  + ASPFV+A+
Sbjct: 309 NPIKVVPNCCKKVAYRILFIYLLTTILVCFLVPYTSPQLLGSLNKGENSGSHASPFVIAV 368

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
           ++ G++V+PH  NA +L+ V S  NS +Y S R L +L+  G  P+      + G P   
Sbjct: 369 ESHGVKVVPHFINAVILISVISVANSSVYSSGRLLLSLSEQGTFPQFLNYIDQRGRPIRC 428

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 489
            ++S+ F  + ++  S     +F + + +  +  +  W+ I + +I F  A + Q     
Sbjct: 429 FVISLTFGLIGFVASSEKRQDVFTWLLAISGLSQLFIWLAICLSHIRFRDAMKTQKKSMD 488

Query: 490 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIIS 544
           +  Y A    +G++ A+    L +L+  F V +       K D  +F   Y+  P+ +++
Sbjct: 489 EVGYKAQTGYWGSWVAVLIG-LFSLVTQFWVAIAPVDKNGKLDVMSFFQNYLAFPIVLVA 547

Query: 545 WAGYKLIYKT--KVIKSTDVDLYTFKEIYDREE---------EEGRMKDQEKEERLKSN 592
           + G+KL Y     +I  + +DL + ++IY  EE          E   +   KEE L  N
Sbjct: 548 YFGHKLYYGNWCPLIPLSKIDLDSHRKIYSPEEITEIELQTSGETIFEKSGKEEGLNDN 606

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  199 bits (506), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/570 (25%), Positives = 252/570 (44%), Gaps = 18/570 (3%)

Query: 31  QNPDNFP-VKEQEIYNIDLEENNVXXXXXXXXXXXXXXXXFAVPDGKDENTRLR------ 83
           +NP N   VK Q++   DL+                      V D +D ++ L       
Sbjct: 4   KNPKNISEVKFQQLDTNDLDSVRTTIVESSVKPAKKTDWLGCVTDDEDSSSDLLYSTQTF 63

Query: 84  KDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEMAS 143
           + LK RH+ +                       P  +LIA+A   + +        EM  
Sbjct: 64  RRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVC 123

Query: 144 YIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGV 202
           ++P+   F   A+R  D +L     + + F   +  P ++ +   +I YW  RD  +  +
Sbjct: 124 FLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAI 181

Query: 203 WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGFRY 262
            +                       WL+SFK                   P HDR GFRY
Sbjct: 182 PLVVQIVLYFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRY 241

Query: 263 WRDPGAFKEY----STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVP 318
           + +   FK+Y            G F  F+A  + + F+  G E   ++  E + PRK +P
Sbjct: 242 YGET-PFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLP 300

Query: 319 KAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSGIEVL 377
           +A K   YR+   +L +   +G+  + NDP L +   +S   A +SP+V+A+ N GI+VL
Sbjct: 301 RAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVL 360

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFC 437
           P I NA ++   FSA N+  Y SSR LY +A+DG AP+IF + ++ GVP  ++++S+L+ 
Sbjct: 361 PDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWG 420

Query: 438 GLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 497
            ++ + ++  SA + N+ +N+++   ++++  + I+Y++F +A         K  + + G
Sbjct: 421 LISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWG 480

Query: 498 QRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVI 557
           Q Y A   L     + LI+ +TVF    +  + F+  Y+ + + I  + GYK I++    
Sbjct: 481 QPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRD 540

Query: 558 KSTDVDLYTFKEIYDREEEEGRMKDQEKEE 587
           K  D     F +  D +E E    D   E+
Sbjct: 541 KFKDPKTVDFSK--DLKEIESHEVDHSFEK 568

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  199 bits (507), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 143/516 (27%), Positives = 244/516 (47%), Gaps = 25/516 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L++ LK RH+ M                       P A+++A+   G +V+  +  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 142 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 200
              +P+ G + SY SR++DP+ GFAI Y YL    +  P ++ AA++ + YW    +   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 201 GVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR-LG 259
           G ++                         S  K                    N+   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 260 FRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPK 319
            +YW +PG F             F  F A+FV S FS++G E+  +  +E++NPR+ +PK
Sbjct: 263 TKYWHNPGGFAH----------GFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 320 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPH 379
           A K   +RI +FYL ++ L+G  V Y +  L ++   S+ A+ASPFV+AI+ +GI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFAS--SSVDASASPFVIAIKEAGISGLPS 370

Query: 380 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGL 439
           + N  +LV V S  N+ ++ SSR   +LA  G  PK FA   R G P   LILS++F  L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 440 AYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 499
           ++++ S     +F + + V  +    +W +I + ++ F +  RAQG    + A+ A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 500 YGAYFALFFCILIALIKNFTVF-----LGHKFDYKTFITGYIGLPVYIISWAGYKLIYKT 554
           +G+ + +    LI+++  F  +     L        F   Y+ LPV I+ + G+K+  + 
Sbjct: 491 WGSIYGI---TLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN 547

Query: 555 --KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
              VI + ++DL T +   D E  +  +K++ +  R
Sbjct: 548 WRLVIPAKELDLDTGRREVDLELLKQEIKEENESIR 583

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  198 bits (504), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 147/527 (27%), Positives = 243/527 (46%), Gaps = 33/527 (6%)

Query: 73  PDGKDE--NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLL 130
           P+ +D     RL + L  RH++M                       P ++LI Y  +G +
Sbjct: 51  PESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGV 110

Query: 131 VFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 189
           ++ TM  LGEM++++P+ G + +Y+ ++V  +  FA+     +   +   + LTA  LV+
Sbjct: 111 IYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVL 170

Query: 190 QYWISRDRVNPGVWITXXXX--XXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXX 247
            YW +     P  W                          WL+  K              
Sbjct: 171 DYWKTNTHHFP-YWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIA 229

Query: 248 XXXXXPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVC 307
                  H+ +GF+ W    A       + G KG    FV +FV S FSY G E   +  
Sbjct: 230 NCGHNQQHEYIGFKNWSHGDA-----PFVQGFKG----FVTIFVTSSFSYGGTETVTLTG 280

Query: 308 SEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVV 367
            EA+NP ++ PK IK   +RI+VFY+ T+F +GM + Y+ P L     K+ S   SPF +
Sbjct: 281 GEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL-----KTKSVLTSPFTI 335

Query: 368 AIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAP--KIFAKTSRWGV 425
             Q +G +      NA ++    SACN  L+  SR LY + ++G  P  + F KT+R   
Sbjct: 336 VFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKA 395

Query: 426 PYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 485
           PY A+I +    GL +     G+ ++F++  N+V +   +SW++I ++ I F K   AQG
Sbjct: 396 PYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG 455

Query: 486 -IDKSKFA-YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYII 543
            + + KF  +  P   YG +F + F  LI L++ ++ F    +   +F + Y+ L V+  
Sbjct: 456 KVHELKFRNWTYP---YGPWFCIIFISLIILVQGWSAF--DPWSTSSFFSFYLELIVFPA 510

Query: 544 SWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK 590
            W  + +I + +  K+ D+D  T K  Y + EEE  +   E+ + LK
Sbjct: 511 CWIFWWVIKRDRFKKAKDMDFITDK--YVQSEEESLL--NERLDNLK 553

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  199 bits (505), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 138/518 (26%), Positives = 236/518 (45%), Gaps = 24/518 (4%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L + LK RH+ M                       P  +LI +     ++      LGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 142 ASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 200
           A   P+ G + +YA+R++D + GFA  + Y+ +  ++ P ++ AA++ + YW +  +   
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 201 GVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRLGF 260
             ++                         S  K                   P+H+ +G 
Sbjct: 203 A-FVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 261 RYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 320
           +YW DPG F   + +      KF    +VFV + FS+ G EL G+  +E   PRKS+PKA
Sbjct: 262 KYWNDPGPFVGNAPS-----DKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKA 316

Query: 321 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHI 380
            K   +RI +FY+ ++ ++G+ V  N+  LL+ +   + AA SPFV+A+    I VLP I
Sbjct: 317 AKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQ--QIDAAHSPFVIAMDMHRIRVLPSI 374

Query: 381 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLA 440
            N  +L  V S  NS +Y SSR + ALA  G  PKIF    R G P  A+  + LF  L 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 441 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 500
           ++  +    +IF++ + +  +    +W+TI + ++ F  A +AQG   ++ ++ +P    
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 501 GAYFALFFCILIALIKNFTVFL--------GHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           G+ +A+   I + L+  F V L          K     F   Y+   V I+ +  +K+  
Sbjct: 495 GSCYAVGL-ICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWS 553

Query: 553 KTK--VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           +     IK+ ++D+ T +   D E      K++  +ER
Sbjct: 554 RNWKFFIKAKEMDIDTGRRELDLE----LFKEELAQER 587

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  198 bits (504), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 131/506 (25%), Positives = 232/506 (45%), Gaps = 11/506 (2%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           +T  R+ L+ RH+ +                       P ++L+A+A   + +       
Sbjct: 83  STETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVST 142

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            EM  + P+   F   A++ VD +      + + F   +  P ++ +   +I YW  RD 
Sbjct: 143 AEMVCFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDD 200

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
            + G+ +                       WL+SFK                   P HDR
Sbjct: 201 YSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDR 260

Query: 258 LGFR-YWRDPGAFKEY---STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
            GFR Y   P  FK+Y      +    G F  F+A  + + F+  G E   ++  E + P
Sbjct: 261 YGFRNYGESP--FKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRP 318

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNS 372
           RK +PKA K    R+   +L +   +G+  + NDP L +   ++   A +SP+V+A+ N 
Sbjct: 319 RKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNL 378

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I +LP I N  ++   FSA N+  Y SSR  Y +A+DG APK+F + +R GVP  ++ +
Sbjct: 379 KIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAI 438

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           S+++  ++ + ++S SA + N+ +N+++   +++++ + I Y++F +A   Q     K  
Sbjct: 439 SLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLP 498

Query: 493 YVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY 552
           + + GQ Y A   L  C  + LI+ +TVF    +  + F+  Y+ + + I  + GYK I+
Sbjct: 499 FRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIW 558

Query: 553 KTKVIKSTDVDLYTF-KEIYDREEEE 577
           K    K  +     F KE+ + E  E
Sbjct: 559 KRGKDKFKNPHEIDFSKELVEIENHE 584

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  198 bits (504), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 144/584 (24%), Positives = 261/584 (44%), Gaps = 42/584 (7%)

Query: 18  SSLDSDHDAYYSKQNPDNFPVKEQEIYNI-DLEENNVXXXXXXXXXXXXXXXXFAVPDGK 76
           S  D   D  + ++  D+F   E E+ N  DLE+  V                       
Sbjct: 28  SGGDGHRDGLF-QRIVDSFKRVEGEVRNSSDLEDGEVT---------------------S 65

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
             +T+L++++K RH+ +                       P  +LI Y FV ++ +  M 
Sbjct: 66  AHSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQ 125

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GEMA +Y  L G F +Y+S ++    GFA  + +  ++  + P +L  +++V++YW +
Sbjct: 126 AAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTT 185

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
           +  +N  +++                         +S K                    +
Sbjct: 186 K--INADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGD 243

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G +YW +PGAF     A   G  +F     V V + FSY G+EL  +  +E  NPR
Sbjct: 244 DGYIGGKYWHEPGAF-----AAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPR 298

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           K++P A    VYRI++ Y+ T+ ++G  V ++  +LL +   S     SP+V+A+   GI
Sbjct: 299 KAIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSG--SSGVHPSPYVLALSLHGI 356

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +++PHI NA +L+ V S  NS +Y   R L +LA  G APKI     R G P  ALI+  
Sbjct: 357 KIVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICS 416

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  +A++  S     IF +   +  +  + +W  I + +  F +A + QG       Y 
Sbjct: 417 VFGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYR 476

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIGLPVYIISWAGYKL 550
           +    +G+ +A+ F + + + + +   +    G KF  K+     + LP+++    GY +
Sbjct: 477 STTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMI 536

Query: 551 IYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSN 592
           + K   I +  + + + + +  YD E    + +D E ++++K +
Sbjct: 537 VTKNWTILNPLSSISVDSHRRSYDVEVM--KQEDLEYKQKMKRS 578

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  198 bits (504), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 185/334 (55%), Gaps = 19/334 (5%)

Query: 261 RYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKA 320
           +YW DPGAF  +     G   +F    +VFV + FS+ G EL GI  +EA NPRKS+P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 321 IKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHI 380
            K  V+RI++FY+ T+ ++G+ V YND RL+     S+ AAASPFV+AI   GI+ LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGAS--SVDAAASPFVIAIVTHGIKGLPSV 394

Query: 381 FNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLA 440
            N  +L+ V S  NS ++  SR + AL+  G  PK+F    R G P   + ++  F  LA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 441 YMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRY 500
           ++  S    ++FN+ + +  +  + +W  I + +I F  A +AQG D ++  +V+P    
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 501 GAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKLIYKTK-- 555
           G+Y+ LF  +L+  I  F V L   G K D + F   Y+  P+ + ++ G+K IYK    
Sbjct: 515 GSYWGLFMIVLM-FIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHK-IYKRNWK 572

Query: 556 -VIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
             I   D+D+ T +    RE +   +K +  EE+
Sbjct: 573 LFIPLEDMDIDTGR----RETDMELLKQEIMEEK 602

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 57/121 (47%), Gaps = 1/121 (0%)

Query: 82  LRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGEM 141
           L+  LK R  +M                       P  ++I +     +++  +  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 142 ASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNP 200
           A   P+  GFT+YA+R+VD + G+A  + Y  ++ ++ P ++ +A++ + YW +  R   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 201 G 201
           G
Sbjct: 223 G 223

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  197 bits (500), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 141/509 (27%), Positives = 236/509 (46%), Gaps = 13/509 (2%)

Query: 80  TRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLG 139
           T   + L+ RH+ +                       PV +L+ ++   + +        
Sbjct: 42  TSTHRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPILCITVSTA 101

Query: 140 EMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRV 198
           EM  Y+P    F   ASR VD +L     + + F   +  P ++ A   +I YW  RD  
Sbjct: 102 EMVCYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHYW--RDDY 159

Query: 199 NPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDRL 258
           +  + +                       WL+SFK                   P HDR 
Sbjct: 160 SAAIPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGGNPKHDRY 219

Query: 259 GFRYWRDPGAFKEY----STAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
           GFR ++D   FKEY       +    G F  F+A  + + F+  G +   ++  E   PR
Sbjct: 220 GFRNFKDL-PFKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETLLPR 278

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM-SAAASPFVVAIQNSG 373
           K +P A K    R+ V +L     +G+  + NDP L +   +    A ASP+V+A+ N G
Sbjct: 279 KVLPIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPYVIAMNNLG 338

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           I+VLP I NA ++   FSA N+  Y SSR LY +A+DG APK+F++ +R GVP  A+ +S
Sbjct: 339 IKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGVPIFAVAVS 398

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +L+  L+ + +   SA + N+ VN+++   ++++  + +VY++F +A  AQ  +  +  +
Sbjct: 399 LLWALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQRDNLPELPF 458

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIY- 552
            +  Q Y A   L    ++ +++ +TVF    ++Y++F+  Y+ + V I  + G+K +  
Sbjct: 459 KSWWQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIYLGHKFVIN 518

Query: 553 --KTKVIKSTDVDLYT-FKEIYDREEEEG 578
             K  V +  DVDL T   EI   E E G
Sbjct: 519 YGKDPVKRPQDVDLITGLYEIEIHELENG 547

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  197 bits (500), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 138/479 (28%), Positives = 221/479 (46%), Gaps = 23/479 (4%)

Query: 117 PVAMLIAYAFVGLLVFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYF 175
           P ++LI +  VG  +   + C  E++   P+ G +  +ASR++DP+ GF++G  YL  + 
Sbjct: 103 PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSAGFSVGINYLLMWL 162

Query: 176 ILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXX 235
           I  P++L   +L + YW     VNP VW+                       ++S FK  
Sbjct: 163 ISFPSELVGCSLTMTYW--APSVNPAVWVAIAFTLSMLLNLFGARGFAESEFYMSIFKIV 220

Query: 236 XXXXXXXXXXXXXXXXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSL 294
                            P     +G +YW DPG+F   +         F +F   FV + 
Sbjct: 221 ALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSFAPPA---------FKNFCNTFVSAA 271

Query: 295 FSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK 354
           +S++G E+  +  +EA +   SV +A K T +RI VFY+ TV ++G  V YNDPRL++  
Sbjct: 272 YSFSGTEMVVLTSAEARDV-SSVSRAAKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGS 330

Query: 355 GKSMSAAASPFVVAIQNSGI--EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 412
             S    ASPFV+A+ N+G     +    NA +L+ VFS CNS +Y SSR +  LA  G+
Sbjct: 331 -SSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQ 389

Query: 413 APKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 472
            PKI     R G P   + +   F  L ++ VS     +F +   + S+    +W  I  
Sbjct: 390 LPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSISFFTTWFCICF 449

Query: 473 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNF--TVFLGHKFDYKT 530
             I F  A +AQG       Y +P   YG        +L+ + + +     +G       
Sbjct: 450 CQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVSAAPVGMPSSAAN 509

Query: 531 FITGYIGLPVYIISWAGYKLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKE 586
           F    + +P+ I  + G+++    ++   IK  D+DL +   + D E  + R +DQEKE
Sbjct: 510 FFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLEATKLR-RDQEKE 567

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  196 bits (499), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/526 (26%), Positives = 231/526 (43%), Gaps = 21/526 (3%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           +E+T L+K +K+RH+ M                       P  ++I Y  V  + ++ + 
Sbjct: 92  NESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQ 151

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+  +Y  L G F  Y    V    GFA  +    ++  + P +L   A+ I+YW  
Sbjct: 152 AAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELITCAITIKYW-- 209

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
            ++VN  +++                         ++ K                    N
Sbjct: 210 TEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSIVINVGGAGN 269

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G  YW +PGAF   + A      +F S   + V   FSY G EL  +  +E ENPR
Sbjct: 270 DGYIGGSYWNNPGAFASDNAA-----SRFKSICYILVTGYFSYGGTELFVLSVNEQENPR 324

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS P+A K ++YRI+V YL T+ L+G  V ++  +L+ + G S  A ASP+V+A    G+
Sbjct: 325 KSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSS--AHASPYVLAASLHGV 382

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ + S  NS LY + R + +LA  G APK      R G P   + +  
Sbjct: 383 KVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAVCA 442

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  + +   S     +F +   +  +  + +W    + +I F +A + QG +  +  Y+
Sbjct: 443 VFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECGYL 502

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           +    +G+   L F IL+  I  F V L       K D + F   Y+  P+++  + G  
Sbjct: 503 SVTGIWGSIIGLCFNILV-FIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWLAFYFGCM 561

Query: 550 LIYKTKVIKS--TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNG 593
             YK   + +    +DL   + IYD EE   + +D   +  LK  G
Sbjct: 562 FYYKDYTLLNPLESIDLDDHRRIYDPEEL--KKEDLATKAELKRRG 605

>KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {ON}
           Anc_8.342 YDR160W
          Length = 834

 Score =  199 bits (506), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 143/552 (25%), Positives = 244/552 (44%), Gaps = 60/552 (10%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            +++ L  RHI M                       P   L+ +   G ++  T+    E
Sbjct: 258 HIQRRLTVRHIQMLSVGPCLSVGLFLTSGRAFSIAGPFGTLLGFCLSGCVILATLLSFTE 317

Query: 141 MASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           +++ IP+  GF+  ASR+V+ A GFAIG+TY F   I  P +  ++   + Y+ S   +N
Sbjct: 318 LSTLIPVSSGFSGLASRFVEDAFGFAIGWTYTFSCIIAFPAEAASSTFFLTYY-SHPLLN 376

Query: 200 PGV---WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX-XPNH 255
             V   ++T                      +  + K                     +H
Sbjct: 377 KSVISGFVTLFLSFPIVSNLLQVNYLGEVVFFFGAVKLIVSILIILVMIILNAGHGHRDH 436

Query: 256 DRLGFRYWRDPGAFKEYS------------------TAITGGKGKFVSFVAVFVYSLFSY 297
            R+GFR+W    +F   +                    I G  G+F+S V+V + S F+Y
Sbjct: 437 HRVGFRFWDSSKSFDNLTYGLFRPTYDLRDEGTGSRNGIGGSTGRFLSVVSVMLISTFAY 496

Query: 298 TGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS----- 352
           +G+E+T +   EA NPRK++P +IK T   I++ Y+  +  +G+ +   DPRLL+     
Sbjct: 497 SGVEMTFLASGEAVNPRKTIPSSIKRTFSSILLIYVLAILTVGINIYSGDPRLLAYLSKP 556

Query: 353 TKGKSMSAA---------------------------ASPFVVAIQNSGIEVLPHIFNACV 385
           T  +S +A                            +SP+V+A+Q+ G+      FN  +
Sbjct: 557 TSNRSEAARNGVGTQWQLDVSCNPRSHISGPLENGYSSPWVLALQSFGMCAFASAFNGLL 616

Query: 386 LVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVS 445
           +VF  ++  S LY SSR LYA++I  KAP IF   +R+GVPY A++++  F  +AY+ V+
Sbjct: 617 IVFTATSAISSLYNSSRTLYAMSIQRKAPYIFQLCNRYGVPYVAVLVASSFGVIAYIAVN 676

Query: 446 SGSAKIFNYFVNVVSMFGILSW----ITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 501
             S   F+   N+ S    + W    ++ L  Y   ++   +   D   + + +P Q Y 
Sbjct: 677 EQSQNNFSILTNMSSASTSIIWFGMNLSFLRFYYALNRRTDSLSRDDEAYPFRSPFQPYL 736

Query: 502 AYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTD 561
           A+F LF C +  L   +  FL H +  + F + Y GL +  + + GYK+   +K+ +   
Sbjct: 737 AFFGLFGCFIFVLFMGYPNFLTHFWSARGFFSAYGGLLICGVCYLGYKIFCTSKIQRLDQ 796

Query: 562 VDLYTFKEIYDR 573
           +D+ T +   DR
Sbjct: 797 LDMDTGRRELDR 808

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  195 bits (495), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 152/541 (28%), Positives = 238/541 (43%), Gaps = 36/541 (6%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
           D  T +++ LK RHIS+                       P+A+L+ ++ +G++ F  M 
Sbjct: 44  DPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVME 103

Query: 137 CLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISR 195
            +GEM +  P  G FT+ A R+   AL    GY Y+  +F +  N+    + ++Q+W   
Sbjct: 104 SIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW--- 160

Query: 196 DRVNPGV----WITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
               P V    +I                       WL+  K                  
Sbjct: 161 ---GPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGD 217

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAE 311
             N    GF YW  PGA              F     VFV+    Y+G E   +  +E++
Sbjct: 218 IRNRPAFGFHYWNSPGALSH----------GFKGIAIVFVFCSTFYSGTESVALAATESK 267

Query: 312 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 371
           NP K+VP A++ T++RI+V Y+      G  V ++DP L      S     SP  +AI  
Sbjct: 268 NPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISR 323

Query: 372 SGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALI 431
           +G     H+ NA +L+   SA N  LY+ SR L  LA +G APKI A T R GVP  A+ 
Sbjct: 324 AGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAIT 383

Query: 432 LSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 491
           +      ++ MNVS G+A  ++Y VN+  +   + W  I   ++   KA  AQG    + 
Sbjct: 384 VFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEEL 443

Query: 492 AYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLI 551
            Y A    +    +L   I +ALI+ ++ F+   FD   F+  YI LPV I+ + G   +
Sbjct: 444 PYEALFYPWTPVLSLAANIFLALIQGWSYFV--PFDAGNFVDAYILLPVGILLYIGI-CV 500

Query: 552 YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQE----KEERLKSNGKNMEWFYEKFLGNI 607
           +K+   ++ D+      E   R++ E  + DQE      E +K + K+  +F  ++L NI
Sbjct: 501 FKSNHFRTVDLRSINLDE-GRRKDMEADLSDQESSLASSETMK-DYKSATFF--RYLSNI 556

Query: 608 F 608
           F
Sbjct: 557 F 557

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  194 bits (494), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 136/482 (28%), Positives = 222/482 (46%), Gaps = 29/482 (6%)

Query: 117 PVAMLIAYAFVGLLVFYTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYF 175
           P ++LI +  VG  +   + C  E++   P+ G +  +ASR++DP++GF+IG  YL  + 
Sbjct: 103 PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWL 162

Query: 176 ILPPNQLTAAALVIQYWISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXX 235
           I  P++L   +L I YW     VNP  W+                       ++S FK  
Sbjct: 163 ISYPSELVGCSLTISYW--APSVNPAAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIV 220

Query: 236 XXXXXXXXXXXXXXXXXPNHDR-LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSL 294
                            P+    +G +YW DPG+F             F +    FV + 
Sbjct: 221 ALFIFIIIGIILIAGGGPDSTGYIGTKYWHDPGSF---------APPVFKNLCNTFVSAA 271

Query: 295 FSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTK 354
           +S++G E+  +  +EA N   SV +A K T +RI++FY+ TV ++G  V YND RL++  
Sbjct: 272 YSFSGTEMVVLTSTEARNV-SSVSRAAKGTFWRIVIFYIVTVIIIGCLVPYNDSRLINGS 330

Query: 355 GKSMSAAASPFVVAIQNSGI--EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 412
             S    ASPFV+A+ N+G   + + H  NA +L+ VFS CNS +Y SSR +  LA  G+
Sbjct: 331 -SSEDITASPFVIALSNTGTMGKRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQ 389

Query: 413 APKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 472
            P+I A   R G P   + +   F  L ++ VS     +F +   + S+    +W  I  
Sbjct: 390 LPRICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICF 449

Query: 473 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVF-----LGHKFD 527
             + F  A +AQG  K    Y +     G Y  +  CIL  L+    ++     +G    
Sbjct: 450 CQVRFRMAMKAQGRSKDDIIYRSS---LGIYGGIVGCILNVLLVIGEIYVSAAPVGSPSS 506

Query: 528 YKTFITGYIGLPVYIISWAGYKLI---YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQE 584
              F    + +P+ I  + G+++    ++   IK  D+DL +   + D E  +   +D +
Sbjct: 507 AANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDLDSGHSLEDFEATKLE-RDHD 565

Query: 585 KE 586
           K 
Sbjct: 566 KR 567

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  195 bits (495), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 228/504 (45%), Gaps = 24/504 (4%)

Query: 77  DENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMA 136
            E   L K +K+RH+ M                       P  +++ Y    ++++  + 
Sbjct: 85  QEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 137 CLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWIS 194
             GE+   Y  L G +T Y S  VDP+LGFA+   Y  ++  + P QL  AA+ ++YW S
Sbjct: 145 AAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS 204

Query: 195 RDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPN 254
              VN  +++                         +S K                    +
Sbjct: 205 ---VNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGD 261

Query: 255 HDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPR 314
              +G  YW +PG F        G KG       VF Y+ FSY GIE+  +  +E ENP 
Sbjct: 262 RRYIGAEYWHNPGPFAH------GFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 315 KSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI 374
           KS+P A K  VYRI++ Y+ T  L+   V YN   LL +   S  + ASPFV+A+ + G+
Sbjct: 312 KSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSS-DSSGSHASPFVIAVASHGV 370

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
           +V+PH  NA +L+ V S  NS LY   R L +LA  G  PK  A   R G P     +S+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSL 430

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  + ++  S    ++F + + + S+  +  W+++ + +I F  A   QG   ++  Y 
Sbjct: 431 VFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYK 490

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           A    +G++ A+   I   L+  F V +       K + K F   Y+ +P+ + ++ G+K
Sbjct: 491 AQTGYWGSWLAVLIAIFF-LVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHK 549

Query: 550 LIYKTKV--IKSTDVDLYTFKEIY 571
           + +K+    I +  +DL + + I+
Sbjct: 550 IYFKSWSFWIPAEKIDLDSHRNIF 573

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  194 bits (494), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 147/545 (26%), Positives = 248/545 (45%), Gaps = 41/545 (7%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
           DG  + + L++ LK RH+ M                       P+ +++ +   G  +  
Sbjct: 71  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIG 130

Query: 134 TMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYW 192
           T+  LGE+    P+ G F +Y +R++DP++ F +   Y+ ++F + P ++ AAA+ +QYW
Sbjct: 131 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 190

Query: 193 ISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXX 252
            S   ++P +W+                         S+ K                   
Sbjct: 191 NSS--IDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGG 248

Query: 253 PNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAEN 312
           P+H+ +G +YW DPG               F   +AV V + +S  GIE+T +  +  E 
Sbjct: 249 PDHEFIGAKYWHDPGCLAN----------GFPGVLAVLVVASYSLGGIEMTCL--ASGET 296

Query: 313 PRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNS 372
             K +P AIK   +RI+ F+L ++ L+G  V Y +  LL       S   SPFV+A++  
Sbjct: 297 DPKGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGS----SVDNSPFVIAMKLH 352

Query: 373 GIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALIL 432
            I+VLP I NA +L+ V S  NS ++ SSR L ++A  G  P  F    R G P   ++ 
Sbjct: 353 HIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 412

Query: 433 SVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFA 492
           + LF  LA++  S   A +FN+ + +  +   + W++I + +I F  A +AQG    +  
Sbjct: 413 NSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELE 472

Query: 493 YVAPGQRYG-AYFALFFCILIALIKNFTVFL-------GHKFDYKTFITGYIGLPVYIIS 544
           +V+    +G AY AL  C++  LI  F   L         K   K F   Y+   + +  
Sbjct: 473 FVSAVGIWGSAYSALINCLI--LIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFI 530

Query: 545 WAGYKLIYKTKV-----IKS-TDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEW 598
           +  +K+ YK +      +KS  D+DL T     DR++ +  +  QE  ER K +  +  W
Sbjct: 531 FVVHKIYYKCQTGKWWGVKSLKDIDLET-----DRKDIDIEIIKQEIMER-KMHLDSRPW 584

Query: 599 FYEKF 603
           +  +F
Sbjct: 585 YVRQF 589

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  194 bits (493), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 228/520 (43%), Gaps = 30/520 (5%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N  L+K L  RH+ M                       P ++LI +  VGL++F  +   
Sbjct: 82  NQPLQKTLSQRHL-MMIAIGGTLGTGLFIGIGYSLSSGPGSLLIGFLIVGLMMFCVVQSA 140

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            E+A   P+ G +  + SR+++P++GF +   Y   + I  P++L   A+ +QYW     
Sbjct: 141 AELACQYPVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYW--NKS 198

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
           VNP VW+                       W+S FK                   PN   
Sbjct: 199 VNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTG 258

Query: 258 -LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPG+F          K  F      FV + FS+ G EL  +  SE+    +S
Sbjct: 259 YIGTKYWHDPGSF---------AKPVFKGLCNTFVSAAFSFGGAELVVLTASESRKV-ES 308

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI-- 374
           V +A K T +RI +FY+ TV ++G  V Y + +LL          ASPFV+A+   G   
Sbjct: 309 VSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDE-DITASPFVIALSGQGSMG 367

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
               H  N  +L+ V S CNS +Y SSR + AL + G+ PKI     + G P   + +  
Sbjct: 368 TKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICG 427

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
           +F  L ++  S     +F +   + S+    +W  I    + F  A RAQG    + A+ 
Sbjct: 428 VFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHK 487

Query: 495 APGQRYGAYFALFFCILIALIKNFTVF-----LGHKFDYKTFITGYIGLPVYIISWAGYK 549
           +    YG +     C+L AL+    ++     LG     K F    + +P+ I  + G+K
Sbjct: 488 SMLGIYGGFLG---CLLNALLIAGEIYVSIFPLGGDPSAKQFFQYCLSIPIMIAVYIGHK 544

Query: 550 LI---YKTKVIKSTDVDLYTFKEIYDREE-EEGRMKDQEK 585
           L     K  +I + ++DL T ++I D E+ +   ++D+EK
Sbjct: 545 LFANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEK 584

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  194 bits (492), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 149/522 (28%), Positives = 235/522 (45%), Gaps = 32/522 (6%)

Query: 79  NTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACL 138
           N   +K L  RH+SM                       P A+LI Y  VG  +F  +   
Sbjct: 67  NQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAALTSG-PAALLIGYLLVGTSMFCVIQSA 125

Query: 139 GEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDR 197
            E+A   P+ G + S+ SR+VD +LGF +   Y   + +L P++L   +L I YW S   
Sbjct: 126 AELACQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNSS-- 183

Query: 198 VNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
           +NP VW++                       LS  K                   P+   
Sbjct: 184 INPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGG 243

Query: 258 -LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316
            +G +YW DPG F          K  F +    FV + FS+ G E+  +  +E++N   S
Sbjct: 244 YIGTKYWHDPGPF---------AKPVFKNLCQTFVAAAFSFGGTEMVLLTGTESKNV-SS 293

Query: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGI-- 374
           + +A K T YRI +FY+ TV ++G  V YNDPRLLS    S   +ASPFV+A+ N+G   
Sbjct: 294 IARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSAS-SSEDISASPFVIALSNTGSMG 352

Query: 375 EVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSV 434
             + H  NA +LV V S CNS +Y SSR + AL   G+ PKIF    R G P   + +S 
Sbjct: 353 AKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSA 412

Query: 435 LFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYV 494
            F  L ++  +   +++F +   + S+   ++W +I +  + +  A RA+   K     +
Sbjct: 413 TFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRAR---KRSLDSI 469

Query: 495 APGQRYGAYFALFFCILIALIKNFTVFLG-----HKFDYKTFITGYIGLPVYIISWAGYK 549
           A     G +  +  CI+  L+    V++       K   + F    + +P+ I+ + G+K
Sbjct: 470 AYKSILGIWGGVVGCIVNFLLVAGEVYVSAFPANAKSSAEGFFKYTLSIPIMIVVFLGHK 529

Query: 550 LI---YKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEER 588
           +    +    +K  D+DL T   I D E  + +   +E E+R
Sbjct: 530 IHRNDWGNWYVKRKDMDLDTGCSIEDFELFQAQ---KEAEKR 568

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  193 bits (491), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/519 (26%), Positives = 241/519 (46%), Gaps = 25/519 (4%)

Query: 74  DGKDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFY 133
            GK E   LR+ ++ RH+ M                           LI Y  +G+++  
Sbjct: 35  QGKKE--VLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVC 92

Query: 134 TMACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 191
            M  +GE+    P    GF SY  R++DP+LGF++ + +  ++ I+ P +L   ++ I+Y
Sbjct: 93  CMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKY 152

Query: 192 WISRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXX 251
           W     ++P ++++                        +S K                  
Sbjct: 153 W--NASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGC 210

Query: 252 XPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEA- 310
                 +GFRY  DPG F +    I    G  V+       + FS  G+E   +  +E  
Sbjct: 211 VGTSGTIGFRYLIDPGMFNKNYNIIKATAGTLVN-------AAFSCGGVEFLALSAAEQN 263

Query: 311 -ENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAI 369
            +N  KS+ +A      RI VFYL ++ ++G+ V +N P L+ + G +M   +SP+V A+
Sbjct: 264 RDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGS-GSNM-IHSSPYVAAV 321

Query: 370 QNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNA 429
             +GI V+PHI NA +L+ V S  NS +Y SSR L++LA    APK F K ++ G P   
Sbjct: 322 AMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRC 381

Query: 430 LILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 489
           L +S LF  ++++        IF + +++  +  I +W TI I +I F  A +++G    
Sbjct: 382 LFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLE 441

Query: 490 KFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFITGYIGLPVYIIS 544
              Y +     G+Y A    ++I L+  F V L       K +   F   Y+ +PV ++ 
Sbjct: 442 TLGYKSITGVAGSYIATVINLVI-LVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLF 500

Query: 545 WAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMK 581
           + G+K+  K  + +I++++VD+ T ++IY    E+ ++K
Sbjct: 501 YIGHKVYTKNWSLLIRASNVDITTDRDIYCPTIEDPKIK 539

>Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C
           (ALP1) - Basic amino acid permease [contig 55] FULL
          Length = 544

 Score =  192 bits (489), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/499 (27%), Positives = 225/499 (45%), Gaps = 22/499 (4%)

Query: 81  RLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTMACLGE 140
            L + L  RHI+M                       P +++I Y+ +GL+V+ TM CLGE
Sbjct: 39  HLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPASLVINYSIIGLVVYLTMLCLGE 98

Query: 141 MASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVN 199
           M++++P+ G F SYA ++   +L F +   Y F   +   + LTA  L++ +W + D   
Sbjct: 99  MSTFMPISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDFWKTSDAHF 158

Query: 200 PGVWITXXXX--XXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXPNHDR 257
           P  W                          WL+  K                    +H  
Sbjct: 159 P-YWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLKVIAIIIFFIISIVVNAGHNQDHSY 217

Query: 258 LGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSV 317
           +GF+ W    A       + G KG    F ++FV S F+Y G E   +   EA+NP ++ 
Sbjct: 218 IGFKNWSVGEA-----PFVNGFKG----FASLFVSSSFAYGGTESITLTAGEAKNPIRNT 268

Query: 318 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVL 377
           PK IK   +RI++FY+ T F +GM V YN P+L        S   SPF +  Q  G +  
Sbjct: 269 PKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKL-----SEKSVMTSPFTIVFQMVGTKAA 323

Query: 378 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK-APKIFAKTSRWGVPYNALILSVLF 436
               NA +L  V SA N  L+  SR L+ L ++G   P I  KT+R+ +PY A++++   
Sbjct: 324 ASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIITKTNRYQIPYVAVLITWAA 383

Query: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496
            GL + +   G+  ++ +  N+V +   ++W+ I IV I F +    QG    +  +   
Sbjct: 384 GGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFRRGLAKQG-KTHELQFSNW 442

Query: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556
              YG YF + F   I L++ ++ F    ++   F + YI L V++  +  + L  +   
Sbjct: 443 TYPYGPYFLVLFVSFIILVQGWSSF--APWNVTDFFSYYIELIVFVALYVFWWLWKRDAF 500

Query: 557 IKSTDVDLYTFKEIYDREE 575
           ++S D+D  T K I   EE
Sbjct: 501 VRSEDMDFVTDKYISPHEE 519

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  194 bits (492), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 241/528 (45%), Gaps = 20/528 (3%)

Query: 76  KDENTRLRKDLKARHISMXXXXXXXXXXXXXXXXXXXXXXXPVAMLIAYAFVGLLVFYTM 135
            +++ +L++ ++ RH+ M                       P  + + +  +G  V+  +
Sbjct: 83  NNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVI 142

Query: 136 ACLGEMASYIPL--DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193
              GEMA   P    GF +Y S  VDP  GFA  + Y  ++  + P +L  A++ I+YW 
Sbjct: 143 QAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWT 202

Query: 194 SRDRVNPGVWITXXXXXXXXXXXXXXXXXXXXXXWLSSFKXXXXXXXXXXXXXXXXXXXP 253
           +   +NP +++                       + ++ K                    
Sbjct: 203 TA--INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAG 260

Query: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313
           N   +G +YWR+PG+F  + TAI   KG     V+  V + FS    E   +  +E  NP
Sbjct: 261 NDGYIGAKYWREPGSFGGH-TAIDHFKG----VVSTLVNAAFSLGCSEFVALTAAEQANP 315

Query: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373
           RKSVP A K  +Y++ V +L +V L+G  V  N   L+ +   S+    SP+V+A+ + G
Sbjct: 316 RKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHV--SPYVIAVASHG 373

Query: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433
           + V+PH  NA +L+ V S  NS  Y SSR L +LA  G AP +F    R G P  A+++S
Sbjct: 374 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVS 433

Query: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493
           +    L ++  S     +F + + +  +  + +W +I I +I F KA   QG       +
Sbjct: 434 ITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGF 493

Query: 494 VAPGQRYGAYFALFFCILIALIKNFTVFL---GHKFDYKTFITGYIGLPVYIISWAGYKL 550
            A    +G+Y++    IL  + + +T  +     K + ++F  GY+  P+++  + GYK+
Sbjct: 494 KAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKI 553

Query: 551 IYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNM 596
             K     I +  +DL   ++I+D +     +K ++ E R K    +M
Sbjct: 554 YNKNWQLFIPAEKIDLDLHRKIFDAD----VLKQEDAEYRAKLRDSSM 597

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,572,209
Number of extensions: 2299850
Number of successful extensions: 13114
Number of sequences better than 10.0: 398
Number of HSP's gapped: 11951
Number of HSP's successfully gapped: 577
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)