Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YPL263C (KEL3)6.10ON65161427780.0
Smik_6.4716.10ON65159826590.0
Suva_16.426.10ON65460126050.0
Skud_16.146.10ON65261625890.0
NCAS0D021906.10ON64560515460.0
TPHA0M002006.10ON63460415430.0
ZYRO0F00484g6.10ON64360315400.0
Kpol_1045.776.10ON65061315390.0
ACR016W6.10ON64060815100.0
TBLA0G011106.10ON63860514940.0
CAGL0A01067g6.10ON64160614920.0
TDEL0G046106.10ON63360414830.0
SAKL0E00880g6.10ON63660314820.0
KLLA0D00836g6.10ON64060614740.0
NDAI0I027506.10ON66361814730.0
KAFR0B065006.10ON63660414590.0
KNAG0E027806.10ON65060514290.0
Kwal_56.223506.10ON65860314170.0
KLTH0C11528g6.10ON64260413850.0
Kpol_1050.695.88ON10842591565e-10
NCAS0F005205.88ON10862601549e-10
KLTH0C01474g5.88ON10562631476e-09
Smik_8.2425.88ON11682621477e-09
KNAG0K005605.88ON11042591441e-08
Skud_8.2225.88ON11692511432e-08
Kwal_14.10195.88ON9782651432e-08
KAFR0B043205.88ON9862591413e-08
TPHA0H010805.88ON8282671404e-08
YHR158C (KEL1)5.88ON11642521396e-08
YGR238C (KEL2)5.88ON8822481387e-08
Suva_15.3575.88ON11722531388e-08
Smik_16.685.88ON8942921371e-07
CAGL0F07997g5.88ON9362651342e-07
Skud_7.5725.88ON8831941333e-07
Suva_7.5305.88ON8941951306e-07
SAKL0H02618g5.88ON10852061306e-07
KLLA0E15511g5.88ON9052591271e-06
NDAI0D026005.88ON11671491271e-06
Ecym_20615.88ON13622061262e-06
ZYRO0B08228g5.88ON12932671252e-06
Kpol_1010.625.88ON9732571218e-06
CAGL0I02090g5.88ON11362591182e-05
TBLA0C065305.88ON11722541182e-05
TDEL0G011205.88ON10092651153e-05
ADL149W5.88ON12112061136e-05
TPHA0A051705.88ON10162601128e-05
YOL141W (PPM2)3.15ON69577910.025
SAKL0C13530g3.15ON697112910.027
TBLA0D021208.157ON1479118910.032
KAFR0C049107.9ON87871830.22
Smik_15.133.15ON71977830.24
Suva_15.193.15ON70880830.24
Suva_8.1755.440ON45394810.32
ZYRO0C00550g7.9ON84859781.0
SAKL0D14740g7.9ON84090771.2
ADR414C7.9ON784120761.4
Suva_1.107.9ON89258761.6
KAFR0I029103.15ON691110752.0
Smik_1.97.9ON87457752.2
TBLA0A043207.9ON83859752.2
NDAI0A088607.9ON85689752.3
Skud_15.133.15ON69581742.4
ZYRO0G19426g8.157ON1594118742.9
CAGL0K02101g8.157ON1633116734.3
Kpol_495.28.157ON151179724.6
TBLA0F004208.157ON1673154724.7
NDAI0B019058.157ON160795725.1
KNAG0E041807.9ON81928715.9
KAFR0C028908.157ON1451147716.0
KLLA0F00374g7.9ON79551716.0
NCAS0C043703.15ON68866699.2
NDAI0H020207.9ON106452699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YPL263C
         (651 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...  1074   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...  1028   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...  1008   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...  1001   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   600   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   598   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   597   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   597   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   586   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   580   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   579   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   575   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   575   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   572   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   572   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   566   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   555   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   550   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   538   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    65   5e-10
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    64   9e-10
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    61   6e-09
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    61   7e-09
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    60   1e-08
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    60   2e-08
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    60   2e-08
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    59   3e-08
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    59   4e-08
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    58   6e-08
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    58   7e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    58   8e-08
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    57   1e-07
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    56   2e-07
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    56   3e-07
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    55   6e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    55   6e-07
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    54   1e-06
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    54   1e-06
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    53   2e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    53   2e-06
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    51   8e-06
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    50   2e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    50   2e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    49   3e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    48   6e-05
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    48   8e-05
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    40   0.025
SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]...    40   0.027
TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8....    40   0.032
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    37   0.22 
Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W (...    37   0.24 
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    37   0.24 
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...    36   0.32 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    35   1.0  
SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]...    34   1.2  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    34   1.4  
Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)    34   1.6  
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    33   2.0  
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     33   2.2  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    33   2.2  
NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa] ...    33   2.3  
Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W (...    33   2.4  
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    33   2.9  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    33   4.3  
Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 151...    32   4.6  
TBLA0F00420 Chr6 complement(104477..109498) [5022 bp, 1673 aa] {...    32   4.7  
NDAI0B01905 Chr2 (457444..462267) [4824 bp, 1607 aa] {ON}              32   5.1  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    32   5.9  
KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8....    32   6.0  
KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON...    32   6.0  
NCAS0C04370 Chr3 (896632..898698) [2067 bp, 688 aa] {ON} Anc_3.1...    31   9.2  
NDAI0H02020 Chr8 complement(493786..496980) [3195 bp, 1064 aa] {...    31   9.9  

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/614 (86%), Positives = 532/614 (86%)

Query: 38  SLNGXXXXXXXXXXXXILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFI 97
           SLNG            ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFI
Sbjct: 38  SLNGEEDDESDQDLDEILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFI 97

Query: 98  FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGE 157
           FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGE
Sbjct: 98  FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGE 157

Query: 158 FSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD 217
           FSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD
Sbjct: 158 FSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD 217

Query: 218 LGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNN 277
           LGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNN
Sbjct: 218 LGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNN 277

Query: 278 KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD 337
           KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD
Sbjct: 278 KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD 337

Query: 338 LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQD 397
           LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQD
Sbjct: 338 LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQD 397

Query: 398 LLNSILAKSNLXXXXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNA 457
           LLNSILAKSNL          STTGP                     TISNQLPHPRFNA
Sbjct: 398 LLNSILAKSNLNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNA 457

Query: 458 ATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXX 517
           ATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLG    
Sbjct: 458 ATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDS 517

Query: 518 XXXXXXXXXXXXXXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFE 577
                                 AGPL             KQAQMEIPDERSWLPHPKPFE
Sbjct: 518 DEDEFEYEDDEEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFE 577

Query: 578 TLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG 637
           TLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG
Sbjct: 578 TLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG 637

Query: 638 IIERDTTTKPSKRR 651
           IIERDTTTKPSKRR
Sbjct: 638 IIERDTTTKPSKRR 651

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/598 (84%), Positives = 517/598 (86%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           ILSSF+KKQ ELEHVDIT+VE+PSCRTHPLMFANPQHNKHELFIFGGEFTD ETKLTHFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           LFDCVERKF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 234 ISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
           IS YKW+K+ETNSKPDARSGHCFIPTDNSAILMGGYCK IAKNNKNLMKGKILNDAWKLN
Sbjct: 234 ISNYKWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLN 293

Query: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353

Query: 354 YMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXXXXX 413
           YMFHLELNKWSKLRIK QRQT+++NSPATSKRKSNKDQEKELQDLLNSILAKSNL     
Sbjct: 354 YMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDD 413

Query: 414 XXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYSGVW 473
                + TG                      TISNQLPHPRFNAATCVVGDSLFIYSGVW
Sbjct: 414 ENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVW 473

Query: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXXXXX 533
           ELGEKDYPINSFYSIDLNKLDGVKVYWE+LSAIEEAKRLG                    
Sbjct: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQ 533

Query: 534 XXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 593
                 AG L              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW
Sbjct: 534 SEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 593

Query: 594 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKRR 651
           SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD TTKPSKRR
Sbjct: 594 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/601 (82%), Positives = 510/601 (84%), Gaps = 3/601 (0%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           ILSSF+KKQ ELEHVDIT+VE+PSCR HPLMFANPQHNKHELFIFGGEFTDPETKLTHFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDLYSYSIKNNSWKKYVSQNAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           LFDC E+KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFD
Sbjct: 174 LFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFD 233

Query: 234 ISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
           IS YKWTKLETN+KPDARSGHCF+PTDNSAILMGGYCK IAKNNKNLMKGKILND+WKL 
Sbjct: 234 ISNYKWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLT 293

Query: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDL 353

Query: 354 YMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNL--XXX 411
           YMFHLELNKWSKLRIKPQR TN++N+PATSKRKSNKDQEKELQDLLNSILAKSNL     
Sbjct: 354 YMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEED 413

Query: 412 XXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYSG 471
                  +TTG                      TISNQLPHPRFNAATCVV DSLFIYSG
Sbjct: 414 DNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSG 473

Query: 472 VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXXX 531
           VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLS +EEAKRLG                  
Sbjct: 474 VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDE 533

Query: 532 XXXXXXXXAGPLXXXXXXXXXXXXXK-QAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                      L               QAQMEIPDERSWLPHPKPFETLRAFYLREGANF
Sbjct: 534 DDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 593

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKR 650
           LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERD T KPSKR
Sbjct: 594 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKR 653

Query: 651 R 651
           R
Sbjct: 654 R 654

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/616 (81%), Positives = 514/616 (83%), Gaps = 3/616 (0%)

Query: 38  SLNGXXXXXXXXXXXXILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFI 97
           +L+G            ILSSF+KKQ ELEHVDIT+VE+ SCRTHPLMFANPQHNK ELFI
Sbjct: 38  ALDGDDEDESDQDLDEILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFI 97

Query: 98  FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGE 157
           FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVS+NAPLPRSSAAVAVHPSGIALLHGGE
Sbjct: 98  FGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGE 157

Query: 158 FSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD 217
           FSSPKQSKFYHYSDTWLFDC ERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD
Sbjct: 158 FSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRD 217

Query: 218 LGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNN 277
           LGNGQTSYLNDLWCFDIS YKWTKLETN+KP+ARSGHCFIPTDNSAILMGGYCKIIAKNN
Sbjct: 218 LGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNN 277

Query: 278 KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD 337
           KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD
Sbjct: 278 KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYD 337

Query: 338 LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQD 397
           LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTN+KN+P TSKRKSNKDQEKELQD
Sbjct: 338 LQETEESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQD 397

Query: 398 LLNSILAKSNLXXXXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNA 457
           LLNSILAKSNL          + +                       TISNQLPHPRFNA
Sbjct: 398 LLNSILAKSNLNDDDDDDNTTTGSN-SIDGDDEGEDDDSDLDNPENITISNQLPHPRFNA 456

Query: 458 ATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXX-- 515
           ATCVV DSLFIYSGVWELGEKDYPINSFYSIDLNKLDGV VYWEDLS IEEAKRLG    
Sbjct: 457 ATCVVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDS 516

Query: 516 XXXXXXXXXXXXXXXXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKP 575
                                      L              QAQMEIPDERSWLPHPKP
Sbjct: 517 DEDDFEYEDDDDDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKP 576

Query: 576 FETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT 635
           FETLRAFYLREGANFLTWSISNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDT
Sbjct: 577 FETLRAFYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDT 636

Query: 636 GGIIERDTTTKPSKRR 651
           GGIIERDTTTK SKRR
Sbjct: 637 GGIIERDTTTKISKRR 652

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/605 (51%), Positives = 394/605 (65%), Gaps = 18/605 (2%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F  +Q + EHV++ S+ KP+ R +  M   P H+K EL IFGGEFT+PET +THFY
Sbjct: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           N+L +YS  N  W+K  SQN+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L D   +++TK++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCFD
Sbjct: 172 LLDTHTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFD 227

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+TYKW ++E    +  PDARSGH +IPT+   IL GGYCK+  K  K L KGKILND W
Sbjct: 228 ITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDCW 285

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+FY
Sbjct: 286 YLKMKSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIFY 344

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ +++E N+W  L ++  ++   K    +S  KS+K++EKELQDLLN IL K+NL  
Sbjct: 345 NDLFSYNVESNRWFSLSLRKAQKF--KKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKD 402

Query: 411 XXXXXX-XXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIY 469
                     T                        T+ +QLPHPRFNAAT VV DSLFIY
Sbjct: 403 DDDDDEISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIY 462

Query: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXX 529
            G+WE+GEKDY I+S YSIDLNKLDGV  YWEDL  IE+AK +G                
Sbjct: 463 GGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEED 522

Query: 530 XXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589
                        +             +  +MEIPD R WLPHPKPFE+LRAFY+REGA 
Sbjct: 523 DDEEEIEDKKL--VAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAA 580

Query: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDTTTK 646
           FL W+ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+DT+  
Sbjct: 581 FLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVP 640

Query: 647 PSKRR 651
            SKRR
Sbjct: 641 TSKRR 645

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/604 (51%), Positives = 391/604 (64%), Gaps = 27/604 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F K+Q + E +++ SV+KP+ R +  M ANP H K EL +FGGE T  E  +THFY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDLY+++  N+ WKK  SQN+P+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  R++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FD
Sbjct: 172 LLDCTTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFD 227

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I++YKW ++E    +  PDARSGH  IPT   A+L GGYCK+  K  K L KGKIL D W
Sbjct: 228 ITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKV--KAGKGLQKGKILGDCW 285

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 286 YLKMKADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFY 344

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ + +E N+W  L+++ QR+            KS+K++E ELQ++LN IL K+NL  
Sbjct: 345 NDLFSYQIESNRWYALQLRSQRK-----KVVRLNNKSSKEKELELQNILNEILEKANLKD 399

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                   S                          + NQLPH RFNA+T VV D+LFIY 
Sbjct: 400 DDEDANELSN----GLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYG 455

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           GVWELGEKDY I+S YSIDLNKLDGV VYWE+L  IE+AK LG                 
Sbjct: 456 GVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDD 515

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                                         MEIPD R WLPHPK FE+LR FY+R GA+F
Sbjct: 516 DEEETVDQKL----VAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASF 571

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKP 647
           L W+ISNN++ +GK LKTKSFELC+DRWWERRDQV +EE++LE+ GG   +IE+D TTK 
Sbjct: 572 LEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKD-TTKS 630

Query: 648 SKRR 651
           +KRR
Sbjct: 631 TKRR 634

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/603 (49%), Positives = 388/603 (64%), Gaps = 18/603 (2%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L+SF K+Q + E V + SV+KPS R +P + +NP H K EL +FGGE+T+     THFY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           N+L++++  N+ W+K  SQNAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  +++TKL+   + + P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FD
Sbjct: 173 LLDCTTKEWTKLD---QKNGPASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFD 228

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+T+KWT++E    +  PDARSGH FIP    AIL GGYCK+  K  K L KGKIL D W
Sbjct: 229 ITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKV--KAGKGLQKGKILTDCW 286

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +   P   +WE+ K    QPSPRVG S  +  + + V FGGVYD +ETEESL+S FY
Sbjct: 287 YLKMNSTPSAIRWERRKKQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFY 345

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ F ++ N+W  L ++PQR+   K S     + S KDQEKELQD LN IL ++ L  
Sbjct: 346 NDLFTFQIKTNRWYSLSLRPQRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYD 400

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                                             TIS QLPHPRFN +  VV D+LFIY 
Sbjct: 401 QDEDKEDDKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYG 460

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           G+WELG+KDY I+SFY IDLNK+DGV VYWE+L+ IE+AK+L                  
Sbjct: 461 GLWELGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDED 520

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                       L             ++ +MEIPD R WLPHPK FE+LRAFY+R G  F
Sbjct: 521 EDDDEEEVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQF 580

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKP 647
           L W+ISNNR+ +GK LK KSF+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K 
Sbjct: 581 LEWAISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKT 640

Query: 648 SKR 650
            +R
Sbjct: 641 KRR 643

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/613 (50%), Positives = 393/613 (64%), Gaps = 28/613 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F K+Q   E ++I SVE+PS R +P M  NP H K EL +FGGE T+ +T  T F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDLYSY+ +N+ W++Y S+N+P+PRSSAA+A HPSG+AL+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  +++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG   T+YLND W FD
Sbjct: 171 LLDCSTKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLFD 226

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+ YKW ++E    +  PDARSGH FIPT   A+L GGYCK+  K  K L KGKIL D W
Sbjct: 227 ITNYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKV--KAGKGLQKGKILTDCW 284

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FY
Sbjct: 285 YLKMKADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFY 343

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ + +E+N+W  L+++PQR+   + +      KS+KD+EKELQDLLN IL K+NL  
Sbjct: 344 NDLFSYQIEINRWFALQLRPQRKKVVRLN-----NKSSKDKEKELQDLLNQILEKANLND 398

Query: 411 XXXXXXXXSTTGPXXX--------XXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVV 462
                                                      +  QLPHPRFNA   VV
Sbjct: 399 KDDKDQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVV 458

Query: 463 GDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXX 522
            D+LFIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS IE AK  G         
Sbjct: 459 NDTLFIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDD 518

Query: 523 XXXXXXXXXXXXXXXXXAGPLXXXXXXXXXXXXXKQA-QMEIPDERSWLPHPKPFETLRA 581
                               +             +Q  +MEIPD   WLPHPKPFE+LR 
Sbjct: 519 EFGDSDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRV 578

Query: 582 FYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI--- 638
           FY+R GA FL W+ISNNR+ +GK LK KSF+LC+DRWW+RRDQV +EE+++E+ GGI   
Sbjct: 579 FYVRTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEV 638

Query: 639 IERDTTTKPSKRR 651
           IE+D T+K +KRR
Sbjct: 639 IEKD-TSKSTKRR 650

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/608 (49%), Positives = 391/608 (64%), Gaps = 28/608 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F ++Q E E V++ +VE+P  R+   + ANP HNK EL +FGGE+T+  T +THFY
Sbjct: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDL+ YS+  + WKKY SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           LFDC   ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W FD
Sbjct: 171 LFDCATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGTS-TTYLNDCWLFD 226

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+TYKW +L+    +  PDARSGH  +PT   AIL GGYCK+  K  K L KGKIL D W
Sbjct: 227 ITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKV--KAGKGLQKGKILTDCW 284

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S+FY
Sbjct: 285 YLKMKSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFY 343

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ +H+E N+W  + ++ QR +  K++P     KSN+D++KEL+D+LN+IL K+NL  
Sbjct: 344 NDLFTYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKANL-- 396

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                     T                        I  +LPHPRFNA+T +V D+LFI+ 
Sbjct: 397 DDDDGDEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFG 456

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           GVWE GEKDY I+SFYSID+NK+DGVKVYWED++A+E AK LG                 
Sbjct: 457 GVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSED 516

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                                      +   EIPD R WLPHPK FE+LRAFY+R GA+F
Sbjct: 517 DDEEEHSDRK---LVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASF 573

Query: 591 LTWSISNNRN----LKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDT 643
           L W+I+N  N     KGK LK  SF+LC++RWWERR+QV +EE++LE+ GG   +IE+D 
Sbjct: 574 LEWAITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKD- 632

Query: 644 TTKPSKRR 651
            TKP+KRR
Sbjct: 633 FTKPTKRR 640

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/605 (50%), Positives = 390/605 (64%), Gaps = 25/605 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           IL +F K+Q + E ++I +V KP+ R +  M +NP H K+EL +FGGE T   +  T FY
Sbjct: 52  ILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFY 108

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDL++Y+ +N+ WKKY SQN+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 109 NDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTW 168

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD
Sbjct: 169 LLDCATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFD 224

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           ++ YKWT++E    ++ PDARSGH  IPT + A+L GGYCK+  K  K L KGKIL+D W
Sbjct: 225 VTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKV--KAGKGLQKGKILSDCW 282

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FY
Sbjct: 283 YLKMKSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFY 341

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ + +E+N+W  L ++ QR+   K  P T+     KD+EKELQD+LNSIL K+NL  
Sbjct: 342 NDLFTYQIEINRWFSLSMRSQRKKTIKIGPKTT-----KDKEKELQDILNSILKKNNLTD 396

Query: 411 XXXXX-XXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIY 469
                                               + NQLPH RFNA T VV D+L+I+
Sbjct: 397 DDSEDPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIF 456

Query: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXX 529
            G WELGEKDY I+SFYSIDLNKLDGV VYWED+  IE AK LG                
Sbjct: 457 GGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDE 516

Query: 530 XXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589
                        L              + +MEIPD R WLPHPKPFETLRAFY+R GA 
Sbjct: 517 DDGEEEIVDQK--LVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGAT 574

Query: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTK 646
           FL W+ISNNR+ KGK LK KSFEL EDRWWERRDQV +EE+++E+ GG   I+ERD TT+
Sbjct: 575 FLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-TTQ 633

Query: 647 PSKRR 651
            +KRR
Sbjct: 634 VNKRR 638

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/606 (50%), Positives = 390/606 (64%), Gaps = 21/606 (3%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQ--HNKHELFIFGGEFTDPETKLTH 111
           +L++F K+Q + E V + SV+K + R +P M  NP    +K EL +FGGEFT+P+T  T 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 112 FYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSD 171
           FYNDL++++ +NN WK+Y SQNAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 172 TWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWC 231
           TW+ DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W 
Sbjct: 169 TWILDCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGTS-TTYLSDCWL 224

Query: 232 FDISTYKWTKLETNSK---PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILND 288
           FDI+TYKW ++E  S    PDARSGH FIPT   AIL GGYCK+ A N K   KGKIL+D
Sbjct: 225 FDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSD 283

Query: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
            W L +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES 
Sbjct: 284 CWYLKMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESN 342

Query: 349 FYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNL 408
           F+NDL+ +H+E N+W  L I+ ++  N  N+ A    K++K+QEKEL+ LL+SIL K+NL
Sbjct: 343 FFNDLFSYHIESNRWYSLSIRSRKSNN--NAVAKKSGKNSKEQEKELKMLLDSILEKANL 400

Query: 409 XXXXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFI 468
                                               TI  QLPHPRFNA T V+ D+LFI
Sbjct: 401 QDKSDDDEDDEEIN--TALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFI 458

Query: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXX 528
           + G+WELG+K++ I+S YSIDLNKLDGV +YWEDL  IE AK LG               
Sbjct: 459 FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDD 518

Query: 529 XXXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588
                                        + ++E PD R WLPHPKPFETLRAFY+REGA
Sbjct: 519 EDDDEEDDNEKD--EGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGA 576

Query: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTT 645
            FL W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD + 
Sbjct: 577 AFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSA 636

Query: 646 KPSKRR 651
             SKRR
Sbjct: 637 -SSKRR 641

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/604 (50%), Positives = 380/604 (62%), Gaps = 28/604 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F K+Q + E V + ++E+PS R +P M ANP H K EL +FGGE T   T  THF+
Sbjct: 52  VLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFF 111

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDL  +S  N  WK+  SQN+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 112 NDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTW 171

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLND W FD
Sbjct: 172 LLDCATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFD 227

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+TYKW ++E    +  PDARSGH  I     AIL GGYCK+  K  K L KGKIL D W
Sbjct: 228 ITTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKV--KAGKGLQKGKILTDCW 285

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L ++ +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETEESLES FY
Sbjct: 286 YLKMSSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFY 344

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           ND++ + + +N+W  L ++PQR+   K        +S KDQEKEL+DLLN IL  + L  
Sbjct: 345 NDVFTYQINMNRWYSLSLRPQRKKQVK-----LNNRSTKDQEKELEDLLNKILRNAQLDD 399

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                   +                          I N+LPHPRFNAAT VV D+LFI+ 
Sbjct: 400 QGEEEEIDAAE----ESTAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFG 455

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           GVWE GEKDY I+SFY IDLNK DGV VYWEDL+A+E AK                    
Sbjct: 456 GVWEFGEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDEDDSDEDEGEEDDDDEEDS 515

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                                     ++ +MEIPD R WLPHPK FE+LR+FY+R GA F
Sbjct: 516 EEEQVDQKLVA-----EDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATF 570

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKP 647
           L W+ISNNR++KGK LKTKSFE+CE RWWERRDQV LEE++LE+ GG   IIERD TTK 
Sbjct: 571 LEWAISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERD-TTKT 629

Query: 648 SKRR 651
            KRR
Sbjct: 630 KKRR 633

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/603 (49%), Positives = 387/603 (64%), Gaps = 24/603 (3%)

Query: 55  LSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114
           L++F ++Q + E V +++V++P+ R +  M ANP H K EL +FGGE T+     T FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174
           DL++YS+  + W+K  SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 175 FDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234
            DC  +++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI
Sbjct: 172 LDCNTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDI 227

Query: 235 STYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291
           +TYKW +++    +  PDARSGH  +PT + A+L GGYCK+  K  K L KGKIL D W 
Sbjct: 228 TTYKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKV--KAGKGLQKGKILTDCWY 285

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
           L +  D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYN
Sbjct: 286 LKMKSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYN 344

Query: 352 DLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXXX 411
           DL+ F +E N+W    ++PQR    K + ATSK   NKD  KEL+D+LN IL K+NL   
Sbjct: 345 DLFTFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEKANLNDD 398

Query: 412 XXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYSG 471
                                             I  QLPHPRFNA+T VV D+LFI+ G
Sbjct: 399 ENEKETIGDV-LKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGG 457

Query: 472 VWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXXX 531
           VWE+GEKDY I+SFY+IDLN+LDG+K+YWEDL  IE AK LG                  
Sbjct: 458 VWEIGEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDD 517

Query: 532 XXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 591
                                     + + EIPD R WLPHPKPFETLR FY+R GA+FL
Sbjct: 518 DEEEITDQK---LVAEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFL 574

Query: 592 TWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGI---IERDTTTKPS 648
            W+IS+NR+ +GK LK KSF+LC+DRWWERRDQV +EE++LE+ GGI   +E+D T+K  
Sbjct: 575 EWAISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKD-TSKSK 633

Query: 649 KRR 651
           KRR
Sbjct: 634 KRR 636

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/606 (49%), Positives = 389/606 (64%), Gaps = 25/606 (4%)

Query: 55  LSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN 114
           L++F ++Q   E +++ +V++P  R +P MF NP H K EL +FGGE T  ET  THFYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 115 DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL 174
           DL+ YS+  ++WK+Y SQN+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 175 FDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234
           FDC  +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI
Sbjct: 171 FDCSSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDI 226

Query: 235 STYKWTKLETNSK---PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291
           + YKW ++E  +    PDARSGH  I T   A+L GGY K+  K  K L KGKIL+D W 
Sbjct: 227 TNYKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKV--KAGKGLQKGKILSDCWY 284

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
           L +  D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN
Sbjct: 285 LKMKSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYN 343

Query: 352 DLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXXX 411
           +LY + +E N+W  + ++PQR+  +       + KSN++++KEL+D+LN IL K+NL   
Sbjct: 344 ELYTYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDA 398

Query: 412 X---XXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFI 468
                                               T+S  LPH RFNAAT VV D+LFI
Sbjct: 399 EDDDESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMST-LPHARFNAATAVVDDTLFI 457

Query: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXX 528
           + G  E+GEKDYPI+SFYSID+NKLDGVKVYWE+L  +E A++LG               
Sbjct: 458 FGGTVEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDD 517

Query: 529 XXXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588
                         L              + + EIPD R WLPHPK FETLRAFY+R G 
Sbjct: 518 EDDGEEEIVD--SKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGP 575

Query: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTT 645
            FL  +IS+NR+ KGK LKTKSFELC+DRWWERR+QV +EE++LE+ GG   +IE+D T+
Sbjct: 576 TFLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TS 634

Query: 646 KPSKRR 651
           K  +RR
Sbjct: 635 KTQRRR 640

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/618 (48%), Positives = 386/618 (62%), Gaps = 27/618 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKP-----SCRTHPLMF-ANPQHNKH--ELFIFGGEFTDP 105
           +L++F  +Q + E +++  + +      S R++  M  A   HNK   EL +FGGE+T P
Sbjct: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112

Query: 106 ETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSK 165
           ET +THFYNDL SY+     W+K  SQN+P+PRSSAA+  HPSGIA+LHGGEFSSPKQ+ 
Sbjct: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172

Query: 166 FYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSY 225
           FYHYSDTW+ D   +++TK++      SP ARSGHRI+ WKNYF+LFGGF+D+GN QT+Y
Sbjct: 173 FYHYSDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229

Query: 226 LNDLWCFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMK 282
            ND+WCFDI  YKWT++E    +  PD RSGH +IP +   IL GGY K+ +K      K
Sbjct: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQK 289

Query: 283 GKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETE 342
           GKILND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  ETE
Sbjct: 290 GKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETE 348

Query: 343 ESLESVFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSI 402
           ESLES+FYNDL+ +++E N+W  L ++  ++ N   S   S  K++K++EKELQDLLN I
Sbjct: 349 ESLESLFYNDLFSYNVETNRWFALNLRKNQKGNK--SLKRSNNKNSKEKEKELQDLLNQI 406

Query: 403 LAKSNLXXXXXXXXXX------STTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFN 456
           L K+NL                 +T                       TI NQLPHPR+N
Sbjct: 407 LEKNNLKDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYN 466

Query: 457 AATCVVGDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXX 516
            A  VV D LFIY G WELGEKDY INSFYSIDLN++DGV  YWEDL  IE+AK LG   
Sbjct: 467 VAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQD 526

Query: 517 XXXXXXXXXXXXXXXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPF 576
                                     L              Q +MEIPD R WLPHPKPF
Sbjct: 527 SDEEDDEDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQ-EMEIPDLRPWLPHPKPF 585

Query: 577 ETLRAFYLREGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED-- 634
           E+LRAFY+REG  FL W+ISNN++++GK LK KSFELCEDRWWERRDQ+ +EE++LE+  
Sbjct: 586 ESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELG 645

Query: 635 -TGGIIERDTTTKPSKRR 651
             G +IE+DT+   SKRR
Sbjct: 646 VVGDVIEKDTSKGASKRR 663

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/604 (50%), Positives = 391/604 (64%), Gaps = 24/604 (3%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           IL +F K+Q   E ++I SVEKPS R +  + ++    K EL +FGGE T  E + T FY
Sbjct: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKFY 108

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDLY++S  NN WK+  SQN+P+PRSSAA+A HPSGIALL+GGEFSSPKQS FYHYSDTW
Sbjct: 109 NDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTW 168

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           + D   +++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DLG+  T+Y ND+W FD
Sbjct: 169 ILDLTTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGH-STTYYNDVWLFD 224

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+TYKW ++E    ++ PDARSGH  IPT    I+ GGYCKI AK  K L KGK+L+  W
Sbjct: 225 ITTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAK--KGLQKGKLLSGCW 282

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESLES+FY
Sbjct: 283 NLKMKADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIFY 341

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ +++E N+W  + +K  +++N+  + +++K KS+K++E+ELQDLLN IL K+NL  
Sbjct: 342 NDLFTYNIESNRWFNVTLK--KRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKP 399

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                   S                         T++ QLPHPRFNA T V+ D L+IY 
Sbjct: 400 DDEEEEESSDI-----FGSDDEDDEEQKNKIDIKTVT-QLPHPRFNATTTVIDDMLYIYG 453

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           G WE GE DY I+SFYSIDLNKLDGV VYWEDL+ IE AK LG                 
Sbjct: 454 GAWEFGEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEE 513

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                       +             +  +MEIPD R WLPHPK FE+LRAFYLREG  F
Sbjct: 514 DGEEEVEDTK-LIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAF 572

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDTTTKP 647
           L W+ISNNR+ +GK LK KSFELC+DRWWERRDQ+++EE++LE+    G ++ERDT+   
Sbjct: 573 LEWAISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAV 632

Query: 648 SKRR 651
           SKRR
Sbjct: 633 SKRR 636

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/605 (47%), Positives = 378/605 (62%), Gaps = 15/605 (2%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           IL +F  +Q + E V +  V  P+ R +  +  N   +K EL +FGGE T+ ET +T FY
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFY 110

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           NDL+ Y+ +NN WKK+ SQN+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L D   R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F+
Sbjct: 171 LLDNTTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFN 226

Query: 234 ISTYKWTKLETNSK--PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291
           +  +KWTK ET +K  PD RSGH +I ++   I+ GGYCK+ AKNNK+L KGK L D W 
Sbjct: 227 VVDFKWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWI 286

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
           L ++ +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YN
Sbjct: 287 LKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYN 346

Query: 352 DLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXXX 411
           DLY +++E N+W  L+++   Q ++ N   +S    +K+QEKELQDLLN IL +++L   
Sbjct: 347 DLYSYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDE 406

Query: 412 XXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTIS--NQLPHPRFNAATCVVGDSLFIY 469
                  S T P                      +   NQLPH RFNA T V+ D+ +IY
Sbjct: 407 ETNSYSGSNT-PHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIY 465

Query: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXX 529
            G+WE  + DY I+SFYSIDLNKLDG+  Y+E+L  IEE KRLG                
Sbjct: 466 GGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDE 525

Query: 530 XXXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589
                                         +MEIPD R WLPHPK FE+LR FY+REG  
Sbjct: 526 DDGEAEPTNERL-EAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPK 584

Query: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDT---GGIIERDTTTK 646
           FL W+ISNN++ KGK LK KSFELC+DRWWERRDQ+ +EE++L++    G IIERD  + 
Sbjct: 585 FLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSP 644

Query: 647 PSKRR 651
           P+ RR
Sbjct: 645 PTARR 649

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/603 (48%), Positives = 382/603 (63%), Gaps = 27/603 (4%)

Query: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFY 113
           +L++F K+Q   + V +T VE+PS R +  M ANP H K EL IFGGE T+    LT FY
Sbjct: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFY 136

Query: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173
           N+L++YS+ ++ W+K  S+N+P+PRSSAA A H SG+AL+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 137 NELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTW 196

Query: 174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
           L DC  +++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW FD
Sbjct: 197 LLDCTTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFD 252

Query: 234 ISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAW 290
           I+TYKW ++E    +  PDARSGH  IPT + A+L GGYCK+  K  K L KGK L D W
Sbjct: 253 ITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKV--KAGKGLQKGKTLTDCW 310

Query: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            L +  D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F+
Sbjct: 311 YLKMKSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFF 369

Query: 351 NDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXX 410
           NDL+ + +E N+W  ++++PQ+    K + A S+   NKD+  EL+++LN IL ++NL  
Sbjct: 370 NDLFSYQVEANRWYSVKMRPQK----KKTVAISRNNRNKDE--ELENILNDILQQANL-- 421

Query: 411 XXXXXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYS 470
                                              +  QLPHPRFNA T VV D LFI+ 
Sbjct: 422 ---ADDTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFG 478

Query: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXX 530
           GVWE GE+D+ I+SFYSIDLNKLDGVKVYWE+LS +E+AK LG                 
Sbjct: 479 GVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDD 538

Query: 531 XXXXXXXXXAGPLXXXXXXXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590
                       L             ++ + EIPD R WLPHPKPFETLRAFY+R GA F
Sbjct: 539 EEEETADQK---LVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEF 595

Query: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKP 647
           L W+ISNNR+ KGK LK +SF+LC+DRWWERR+Q+ +EE++LE+ GG   ++ERD     
Sbjct: 596 LKWAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTM 655

Query: 648 SKR 650
            +R
Sbjct: 656 KRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/604 (46%), Positives = 370/604 (61%), Gaps = 25/604 (4%)

Query: 57  SFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116
           +F K+Q   + V +T V++PS R++  M  NP H K EL IFGGE+T+  +  T FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176
           ++YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL D
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 177 CVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIST 236
           C  +++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+T
Sbjct: 174 CSSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITT 229

Query: 237 YKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
           YKW ++E    +  PDARSGH  IPT   AI+ GGYCKI AK  K L KGKIL D W L 
Sbjct: 230 YKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAK--KGLQKGKILTDCWYLR 287

Query: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           +  D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL
Sbjct: 288 MKSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDL 346

Query: 354 YMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLXXXXX 413
             + +E N+W  ++++PQ++         +  KS K ++ EL  +LN IL K+NL     
Sbjct: 347 LSYQVEANRWYSIKMRPQKKK------IVAASKSAKSKDDELVGILNDILQKANLADEEN 400

Query: 414 XXXXXSTTGPXXXXXXXXXXXXXXXXXXXXXTISNQLPHPRFNAATCVVGDSLFIYSGVW 473
                 +                         +  QLPH RFNAAT VV D+LFI+ G W
Sbjct: 401 EENESDSE--IEKELHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSW 458

Query: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGXXXXXXXXXXXXXXXXXXXX 533
           E GE+D+ I+SFYSIDLN+ DGV+V+WEDL  IE+AK  G                    
Sbjct: 459 EYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEE 518

Query: 534 XXXXXXAGPLXXXXX----XXXXXXXXKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589
                                      ++A  EIPD R WLPHPK FETLRAFY+R GA 
Sbjct: 519 ETLDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAE 578

Query: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTK 646
           FL W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD++  
Sbjct: 579 FLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHS 638

Query: 647 PSKR 650
             +R
Sbjct: 639 TKRR 642

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 102/259 (39%), Gaps = 50/259 (19%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC--VER 180
           W +   QN+P PR    S+A A   + I +L G    S        Y DTW+  C     
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISCNPDAT 191

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           +F+       +++P  R GH      N FI+FGG     N +    +D++ F+I++YKWT
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 241 KLE-TNSKPDARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH  C + T        L GG                  ND    +L
Sbjct: 252 IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQ-----------FDDTYFNDLAVFDL 300

Query: 295 TP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           +        W++ K K F   P      V Y  +LW       +GG     +T++ L   
Sbjct: 301 SSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLW------IYGG-----DTQQGL--- 346

Query: 349 FYNDLYMFHLELNKWSKLR 367
             ND++ F    N W+K+ 
Sbjct: 347 -INDIFKFSPNTNTWTKVE 364

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 85/193 (44%), Gaps = 42/193 (21%)

Query: 92  KHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQN-APLPRSSAAVAVH 146
           K +L++FGG+F D     T+F +    DL S+  +++ W+   S+   P P ++  +  +
Sbjct: 277 KTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTY 331

Query: 147 PSGIALLHGGEFSSPKQSKFYHYS---DTWLFDCVERKFTKLEFGGRDSSPSARSGHRII 203
            S +  ++GG+      +  + +S   +TW         TK+E  G  + P     H  +
Sbjct: 332 GSDL-WIYGGDTQQGLINDIFKFSPNTNTW---------TKVETTG--TKPPPMQEHAAV 379

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPD-------ARSGHCF 256
            +KN   + GG     +    YLN ++ F+  + KW        PD        RSGH  
Sbjct: 380 VYKNIMCVVGG----KDENDMYLNSVYLFNFDSSKWYTF-----PDFKSGIIQGRSGHSV 430

Query: 257 IPTDNSAIL-MGG 268
              +N  +L MGG
Sbjct: 431 TLLNNDKLLIMGG 443

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 122/295 (41%), Gaps = 57/295 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNA---PLPRSSAAVAVHPSGIA 151
             +FGG+ T    K     +D+Y ++I  NS+K  +       PL R    + +  +   
Sbjct: 220 FIVFGGD-THKVNKEGLMDDDIYLFNI--NSYKWTIPNPIGPRPLGRYGHKICILATSTV 276

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFD--CVERKFTKLEF-GGRDSSPSARSGHRIIA 204
                L GG+F         +++D  +FD     R+ +  EF   +   P   + H ++ 
Sbjct: 277 KTKLYLFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 205 WKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETN-SKPDARSGHCFIPTDNSA 263
           + +   ++GG     + Q   +ND++ F  +T  WTK+ET  +KP     H  +   N  
Sbjct: 331 YGSDLWIYGG-----DTQQGLINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIM 385

Query: 264 ILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFN 322
            ++GG        ++N M    LN  +  N   D  KW      +FK+     R G+S  
Sbjct: 386 CVVGG-------KDENDM---YLNSVYLFNF--DSSKWYT--FPDFKSGIIQGRSGHSVT 431

Query: 323 LWKQNKSVAFG---------GVYDLQ--ETEESLESVFYNDLYMFHLELNKWSKL 366
           L   +K +  G         G YDL   E +E + ++ Y       L+L++ S L
Sbjct: 432 LLNNDKLLIMGGDKYDFARPGDYDLHTSEIDEGVGTILYT------LDLSRLSNL 480

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 102/260 (39%), Gaps = 58/260 (22%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFT 183
           W +   QN+P PR    A+  +  +    + GG      QS    Y DTW+  C E   T
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHD---QSV---YGDTWVLTC-EDPQT 183

Query: 184 KLEFGGR-----DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYK 238
              F  R     +++P  R GH      N F++FGG     N      +D++ F+I++YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 239 WT-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKN----LMKGKI----LNDA 289
           WT       +P  R GH                 IIA+        L  G+      ND 
Sbjct: 244 WTIPHPIGPRPKGRYGHKI--------------SIIARKQMQTKLYLFGGQFDDNYFNDL 289

Query: 290 WKLNLTP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEE 343
              +L+    D   W++ K ++F   P      V Y F LW       FGG        +
Sbjct: 290 VVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLW------VFGG--------D 335

Query: 344 SLESVFYNDLYMFHLELNKW 363
           +LE +  N ++M+   +N W
Sbjct: 336 TLEGLL-NQVFMYDPAVNDW 354

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 115/280 (41%), Gaps = 41/280 (14%)

Query: 68  VDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           VDIT    P    H           +   IFGG+ T  + ++    +D+Y ++I  NS+K
Sbjct: 192 VDITETTPPPRVGHASTLCG-----NAFVIFGGD-THKKNEMGEMDDDIYLFNI--NSYK 243

Query: 128 KYVSQNAPL-PRSSAAVAVHPSGIA--------LLHGGEFSSPKQSKFYHYSDTWLFD-- 176
             +    P+ PR         S IA         L GG+F         +++D  +FD  
Sbjct: 244 WTIPH--PIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDD------NYFNDLVVFDLS 295

Query: 177 CVERKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
              R  +  EF   R   P   + H ++++     +FGG  D   G    LN ++ +D +
Sbjct: 296 SFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--DTLEG---LLNQVFMYDPA 350

Query: 236 TYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
              W  +ET  + D          +++ ++  G   I+   ++   +   LND + LNL 
Sbjct: 351 VNDWCVVETTCQDDDLENMPPPMQEHATLIYKGLMCIVGGKDE---QDHYLNDVYFLNL- 406

Query: 296 PDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKSVAFGG 334
              K  +W +L  F +  P  R G+S  L K +K +  GG
Sbjct: 407 ---KSLKWFRLPRFMDGIPQGRSGHSVTLLKNDKLLIMGG 443

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 104/263 (39%), Gaps = 58/263 (22%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +    N+P PR    ++A A   + + ++ G    S        Y DTW+    +   
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           KF+       D++P  R GH      N F++FGG     N      +D++ F+I++YKWT
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 241 -KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNN---KNLMKGKILNDAWKLNLT- 295
                  +P  R GH                 IIA +    K  + G   +D +  +LT 
Sbjct: 191 IPRPVGPRPLGRYGHKI--------------SIIATSQMRTKLYVFGGQFDDTYFNDLTV 236

Query: 296 --------PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEES 344
                   PD   WQ+ K   F   P      + Y + LW       FGG     +T + 
Sbjct: 237 FDLSSFRRPD-SHWQFIKPNTFTPPPLTNHTMISYDYKLW------VFGG-----DTPQG 284

Query: 345 LESVFYNDLYMFHLELNKWSKLR 367
           L     ND++MF  ++N W  ++
Sbjct: 285 L----INDVFMFDPQINDWKVMQ 303

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 83/194 (42%), Gaps = 22/194 (11%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPE-TKLTHFYNDLYSYSIKNNSWKKYVSQN--APLP 137
           H +        + +L++FGG+F D     LT F  DL S+   ++ W +++  N   P P
Sbjct: 205 HKISIIATSQMRTKLYVFGGQFDDTYFNDLTVF--DLSSFRRPDSHW-QFIKPNTFTPPP 261

Query: 138 RSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSAR 197
            ++  +  +   + +  G    +P+       +D ++FD     +  ++  G    P   
Sbjct: 262 LTNHTMISYDYKLWVFGG---DTPQG----LINDVFMFDPQINDWKVMQTTG--DKPPPL 312

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLET--NSKPDARSGHC 255
             H  + + +   + GG     + Q  Y N ++  ++ + KW KL +  +  P  RSGH 
Sbjct: 313 QEHAAVLYGDLMCVVGG----KDEQDVYSNSVFFLNLISLKWFKLPSYRSGIPQGRSGHS 368

Query: 256 FIPTDNSAIL-MGG 268
                N  +L MGG
Sbjct: 369 LTLLPNHKLLIMGG 382

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 103/262 (39%), Gaps = 64/262 (24%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +   Q++P PR    S+A     + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI-----------LND 288
                  +P  R GH                 IIA N    MK K+            ND
Sbjct: 226 VPAPVGPRPLGRYGHKI--------------SIIATNQ---MKTKLYVFGGQFDDTYFND 268

Query: 289 AWKLNLT----PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQET 341
               +L+    PD   W++ K K F   P      + Y   LW       FGG       
Sbjct: 269 LAVYDLSSFRRPD-SHWEFLKPKTFSPPPITNFTMISYDSKLW------VFGG------- 314

Query: 342 EESLESVFYNDLYMFHLELNKW 363
            ++L+ +  ND++M+   LN W
Sbjct: 315 -DTLQGLV-NDVFMYDPALNDW 334

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 92/223 (41%), Gaps = 36/223 (16%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSQN-A 134
           H +        K +L++FGG+F D       ++NDL  Y +      ++ W+    +  +
Sbjct: 240 HKISIIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKTFS 293

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSP 194
           P P ++  +  + S + +  G              +D +++D     +  +E  G    P
Sbjct: 294 PPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPP 346

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARS 252
                H  + + +   + GG     +   +YLN ++  ++ + KW KL   T   P  RS
Sbjct: 347 VQE--HATVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSNKWFKLPVFTAGIPQGRS 400

Query: 253 GHCFIPTDNSAIL-MGG----YCKI----IAKNNKNLMKGKIL 286
           GH      N  IL MGG    Y ++    +  ++ ++ KG I+
Sbjct: 401 GHSLTLLKNDKILIMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 120/314 (38%), Gaps = 61/314 (19%)

Query: 68  VDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCVERKFT 183
                  P P     +  +   I+++   +     ++K Y     + DT+  D      +
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATNQM----KTKLYVFGGQFDDTYFNDLAVYDLS 275

Query: 184 KLEFGGRDS----------SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
              F   DS          SP   +   +I++ +   +FGG  D   G    +ND++ +D
Sbjct: 276 S--FRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYD 328

Query: 234 ISTYKWTKLETN-SKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKL 292
            +   W  +ET   KP     H  +  ++   ++GG  +  A           LN  + L
Sbjct: 329 PALNDWFIIETTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFL 378

Query: 293 NLTPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEESLESVFY 350
           NL    K  +W KL  F    P  R G+S  L K +K +  GG  +D    EES      
Sbjct: 379 NL----KSNKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEES------ 428

Query: 351 NDLYMFHLELNKWS 364
            DL+   +++ K +
Sbjct: 429 -DLHTSDIDMQKGT 441

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 107/259 (41%), Gaps = 38/259 (14%)

Query: 123 NNSWKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           N  W +   +++P PR    +++ A     + ++ G       QS F    D W+   +E
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH----DQSVF---GDVWIIKSLE 246

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237
              KFT       +++P  R GH      N F++FGG     N      +DL+ F+I++Y
Sbjct: 247 NGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSY 306

Query: 238 KWTKLE-TNSKPDARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291
           KWT       +P  R GH        P      L GG       NN  +       D  +
Sbjct: 307 KWTIPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFNNLAVF------DLSQ 360

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
               PD   W++ K K+F   P P   ++   + QNK   FGG        ++L+ +  N
Sbjct: 361 FR-RPD-SHWEFLKPKSF--MPPPLTNHTMVSY-QNKLWIFGG--------DTLQGLI-N 406

Query: 352 DLYMFHLELNKWSKLRIKP 370
            ++M+  E+N W+ +   P
Sbjct: 407 KIFMYDPEVNDWTVVETFP 425

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 112/282 (39%), Gaps = 45/282 (15%)

Query: 68  VDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DIT    P    H           +   +FGG+ T    K     +DLY ++I +  W 
Sbjct: 256 IDITENTPPPRVGHAATLCG-----NAFVVFGGD-THKVNKDGLMDDDLYLFNINSYKW- 308

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTW-----LFDCV 178
                  P P     +  +   ++++     ++P ++K Y     + DT+     +FD  
Sbjct: 309 -----TIPNPIGPRPLGRYGHKVSII----ATTPMKTKLYLFGGQFDDTYFNNLAVFDLS 359

Query: 179 E--RKFTKLEFGGRDS-SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
           +  R  +  EF    S  P   + H +++++N   +FGG    G      +N ++ +D  
Sbjct: 360 QFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGGDTLQG-----LINKIFMYDPE 414

Query: 236 TYKWTKLETNSKPDARSGHCFIP--TDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
              WT +ET   P       F P   ++++++ G    ++   ++   +   LN  + L 
Sbjct: 415 VNDWTVVET--FPANNDQENFPPPMQEHASVMYGDLMVVMGGKDE---QDNYLNTVYFLK 469

Query: 294 LTPDPKKWQWEKLKNFK-NQPSPRVGYSFNLWKQNKSVAFGG 334
           +       +W KL       P  R G+S  L K NK +  GG
Sbjct: 470 I----NTLEWYKLPFLSVGIPQGRSGHSITLLKGNKLLIMGG 507

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 100/251 (39%), Gaps = 42/251 (16%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +   QN+P PR    ++A     + I ++ G    S        Y DTW+   ++   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     K               ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   W++ K K F   P      + Y   LW       FGG        ++L+ +  ND
Sbjct: 280 PD-SHWEFLKPKAFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLI-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   +N W
Sbjct: 324 VFMYDPAINDW 334

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 96/223 (43%), Gaps = 36/223 (16%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKN----NSWKKYVSQNA-- 134
           H +        K +L++FGG+F D       ++NDL  Y + +    +S  +++   A  
Sbjct: 240 HKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKAFT 293

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSP 194
           P P ++  +  + S + +  G              +D +++D     +  +E  G    P
Sbjct: 294 PPPITNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPP 346

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARS 252
                H  + + +   + GG     +   +YLN ++  ++ ++KW KL   T   P  RS
Sbjct: 347 VQE--HASVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSHKWFKLPVFTAGIPQGRS 400

Query: 253 GHCF-IPTDNSAILMGG----YCKI----IAKNNKNLMKGKIL 286
           GH   +  D+  ++MGG    Y ++    +  ++ +L +G I+
Sbjct: 401 GHSLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDLQRGTIV 443

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 111/293 (37%), Gaps = 54/293 (18%)

Query: 68  VDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCVERKFT 183
                  P P     +  +   I+++   +     ++K Y     + DT+  D      +
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATTQM----KTKLYVFGGQFDDTYFNDLAVYDLS 275

Query: 184 KLEFGGRDS----------SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233
              F   DS          +P   +   +I++ +   +FGG  D   G    +ND++ +D
Sbjct: 276 S--FRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--DTLQG---LINDVFMYD 328

Query: 234 ISTYKWTKLETNS-KPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKL 292
            +   W  +ET   KP     H  +  ++   ++GG  +  A           LN  + L
Sbjct: 329 PAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDEHDA----------YLNSVYFL 378

Query: 293 NLTPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
           NL    K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 379 NL----KSHKWFKLPVFTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEE 427

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 53/129 (41%), Gaps = 19/129 (14%)

Query: 239 WTKLETNSKPDARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++  + P  R  H    ++   N   ++GG           L    +  D W L   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGG-----------LHDQSVYGDTWILTAL 161

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  K+    +   +  P PRVG++  L   N  V FGG  D  +  +  E +  +D+Y+
Sbjct: 162 DNATKFSTTTIDISEATPPPRVGHAAVLCG-NAFVVFGG--DTHKVNK--EGLMDDDIYL 216

Query: 356 FHLELNKWS 364
            ++   KW+
Sbjct: 217 LNINSYKWT 225

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 103/265 (38%), Gaps = 52/265 (19%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W++    N+P PR    ++A A   + + ++ G    S        Y DTW+    E   
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQSV-------YGDTWIVTSHENGA 128

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           +FT       D++P  R GH      N F++FGG     N      +D++ F+I++YKWT
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 241 -KLETNSKPDARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH        P      + GG                  ND    +L
Sbjct: 189 IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ-----------FDDTYFNDLAVFDL 237

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
           +    PD   WQ+    +F   P      + Y + LW       FGG     +T + L  
Sbjct: 238 SSFRRPD-SSWQFITPNSFTPPPLTNHAMISYDYKLW------VFGG-----DTPQGL-- 283

Query: 348 VFYNDLYMFHLELNKWSKLRIKPQR 372
              +D+++F  ++N W  ++   Q+
Sbjct: 284 --IDDVFVFDPQVNDWKFIQTTGQK 306

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 83/186 (44%), Gaps = 28/186 (15%)

Query: 92  KHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQNA--PLPRSSAAVAV 145
           K +L++FGG+F D     T+F +    DL S+   ++SW ++++ N+  P P ++ A+  
Sbjct: 214 KTKLYVFGGQFDD-----TYFNDLAVFDLSSFRRPDSSW-QFITPNSFTPPPLTNHAMIS 267

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  G    +P+        D ++FD     +  ++  G+   P     H  + +
Sbjct: 268 YDYKLWVFGG---DTPQGL----IDDVFVFDPQVNDWKFIQTTGQ--KPPPLQEHASVLY 318

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGHCFIPTDNSA 263
            +   + GG     + Q  Y N ++  ++ + KW K        P  RSGH      N  
Sbjct: 319 GDLMCIVGG----KDEQDVYSNGVYFLNLISLKWFKFPFFRAGIPQGRSGHSLTLLPNHK 374

Query: 264 IL-MGG 268
           +L MGG
Sbjct: 375 LLIMGG 380

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 101/259 (38%), Gaps = 52/259 (20%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER-- 180
           W +    N+P PR    ++A A     I ++ G    S        Y DTW+        
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSENNAS 186

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           +F        D++P  R GH      N FI+FGG     N      +DL+ F+I+++KWT
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

Query: 241 KLE-TNSKPDARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH    I T NS     L GG                  ND    +L
Sbjct: 247 IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ-----------FDDAYFNDLVVFDL 295

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
           +    PD  +W++ K K+F   P      V Y   LW       FGG        ++L+ 
Sbjct: 296 SSFRRPD-SRWEFVKPKSFVPPPLTNHTMVSYDNKLW------VFGG--------DTLQG 340

Query: 348 VFYNDLYMFHLELNKWSKL 366
           +  N ++M+   +N W+ +
Sbjct: 341 L-TNRVFMYDPMINDWTTI 358

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 96/225 (42%), Gaps = 36/225 (16%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSQN-A 134
           H +      ++K  L++FGG+F D       ++NDL  + +      ++ W+    ++  
Sbjct: 261 HKISIIATANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDSRWEFVKPKSFV 314

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSP 194
           P P ++  +  + + + +  G          F       ++D +   +T +E    + + 
Sbjct: 315 PPPLTNHTMVSYDNKLWVFGGDTLQGLTNRVF-------MYDPMINDWTTIETSSDNPNN 367

Query: 195 SA--RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSK--PDA 250
            A     H  I +K+   +FGG     + Q +YLN ++  ++ T KW KL   +   P  
Sbjct: 368 IAPPMQEHAAIVYKDLMCIFGG----KDEQDTYLNGVYFLNLRTLKWYKLPIFAPGIPQG 423

Query: 251 RSGHCFIPTDNSAIL-MGG----YCKI----IAKNNKNLMKGKIL 286
           RSGH      N  +L MGG    Y ++    +  +  N+ KG IL
Sbjct: 424 RSGHSITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 104/257 (40%), Gaps = 46/257 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIAL-- 152
             IFGG+ T    K     +DLY ++I ++ W      N   PR         S IA   
Sbjct: 215 FIIFGGD-THKVNKDGLMDDDLYLFNINSHKW---TIPNPVGPRPLGRYGHKISIIATAN 270

Query: 153 ------LHGGEFSSPKQSKFYHYSDTWLFD--CVERKFTKLEFGGRDS-SPSARSGHRII 203
                 L GG+F         +++D  +FD     R  ++ EF    S  P   + H ++
Sbjct: 271 SKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMV 324

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSA 263
           ++ N   +FGG  D   G T   N ++ +D     WT +ET+S             +N A
Sbjct: 325 SYDNKLWVFGG--DTLQGLT---NRVFMYDPMINDWTTIETSSDN----------PNNIA 369

Query: 264 ILMGGYCKIIAKNNKNLMKGK-----ILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRV 317
             M  +  I+ K+   +  GK      LN  + LNL    +  +W KL  F    P  R 
Sbjct: 370 PPMQEHAAIVYKDLMCIFGGKDEQDTYLNGVYFLNL----RTLKWYKLPIFAPGIPQGRS 425

Query: 318 GYSFNLWKQNKSVAFGG 334
           G+S  L K +K +  GG
Sbjct: 426 GHSITLLKNDKLLIMGG 442

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 105/267 (39%), Gaps = 47/267 (17%)

Query: 126 WKKYVSQNAPLPRSSAAVA--VHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER--- 180
           W K   +  P PR     +  ++PS    ++GG F S        Y DTW  +  E    
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 181 --------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLND-LWC 231
                       ++  G  ++P  R GH      N  I+FGG     N     ++D L+ 
Sbjct: 76  NDLERWHYSCNIIDIMG--TTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 232 FDISTYKWTKLETNS-KPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILN--D 288
            ++ T KWT       +P  R GH     +++  L GG       N+  L+K  +LN  D
Sbjct: 134 LNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFND--LVKFDLLNFKD 191

Query: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           A          +W++ K K F   P P   +S   + +NK   FGG             V
Sbjct: 192 A--------NSQWEFIKPKGFI--PPPLSNFSMCTF-ENKLYVFGG---------DTYQV 231

Query: 349 FYNDLYMFHLELNKWSKLRIKPQRQTN 375
             N+ +++  ELN+WS L    Q  TN
Sbjct: 232 LTNETFVYDPELNEWSILETFGQEDTN 258

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 100/252 (39%), Gaps = 44/252 (17%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL---FDCVE 179
           W +   QN+P PR    ++A     + I ++ G    S        Y DTW+   FD   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 180 RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKW 239
           R F+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW
Sbjct: 166 R-FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW 224

Query: 240 T-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT--- 295
           T       +P  R GH        +I+     K               ND    +L+   
Sbjct: 225 TVPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFR 278

Query: 296 -PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
            PD   W++ K + F   P      + Y   LW       FGG        ++L+ +  N
Sbjct: 279 RPD-SHWEFLKPRTFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLV-N 322

Query: 352 DLYMFHLELNKW 363
           D++M+   +N W
Sbjct: 323 DVFMYDPAINDW 334

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 77/186 (41%), Gaps = 28/186 (15%)

Query: 92  KHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSQN-APLPRSSAAVAV 145
           K +L++FGG+F D       ++NDL  Y +      ++ W+    +   P P ++  +  
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAW 205
           + S + +  G              +D +++D     +  ++  G    P     H  + +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQE--HATVVY 355

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGHCFIPTDNSA 263
            +   + GG     +   +YLN ++  ++ + KW KL   T   P  RSGH      N  
Sbjct: 356 NDLMCVVGG----KDEHDAYLNSVYFLNLKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDK 411

Query: 264 IL-MGG 268
           IL MGG
Sbjct: 412 ILIMGG 417

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 112/291 (38%), Gaps = 50/291 (17%)

Query: 68  VDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK 127
           +DI+    P    H  +        +   +FGG+ T    K     +D+Y  +I +  W 
Sbjct: 172 IDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNKEGLMDDDIYLLNINSYKW- 224

Query: 128 KYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----HYSDTWLFDCV----- 178
                  P P     +  +   I+++   +     ++K Y     + DT+  D       
Sbjct: 225 -----TVPAPVGPRPLGRYGHKISIIATTQM----KTKLYVFGGQFDDTYFNDLAVYDLS 275

Query: 179 --ERKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
              R  +  EF   R  +P   +   +I++ +   +FGG  D   G    +ND++ +D +
Sbjct: 276 SFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--DTLQG---LVNDVFMYDPA 330

Query: 236 TYKWTKLETN-SKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
              W  ++T   KP     H  +  ++   ++GG  +  A           LN  + LNL
Sbjct: 331 INDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDEHDA----------YLNSVYFLNL 380

Query: 295 TPDPKKWQWEKLKNF-KNQPSPRVGYSFNLWKQNKSVAFGG-VYDLQETEE 343
               K  +W KL  F    P  R G+S  L K +K +  GG  +D    EE
Sbjct: 381 ----KSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGGDKFDYARVEE 427

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 101/248 (40%), Gaps = 44/248 (17%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGG 189
           + QN P PR   A  +  +   +  GG+     ++      D +LF+    K+T  +  G
Sbjct: 134 IDQNTPPPRVGHASTICGNAYVVF-GGDTHKLNKNGLLD-DDLYLFNINSYKWTIPQPIG 191

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYK-----W 239
           R   P  R GH+I  IA    +    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 R--RPLGRYGHKISIIASNPMQTKLYLFGGQVD-----ETYFNDLVVFDLSSFRRPNSHW 244

Query: 240 TKLE-TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
             LE     P   + H  +  DN   + GG                I ND ++     DP
Sbjct: 245 EFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETP-----------KTISNDTYRY----DP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHL 358
            + +W K+K    +P P   ++  ++K    V  GG        +   + + ND+Y  +L
Sbjct: 290 AQSEWSKVKTTGEKPPPIQEHASVVYKHLMCV-LGG--------KDTHNAYSNDVYFLNL 340

Query: 359 ELNKWSKL 366
              KW KL
Sbjct: 341 LSLKWYKL 348

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 109/270 (40%), Gaps = 53/270 (19%)

Query: 96  FIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHG 155
            +FGG+ T    K     +DLY ++I +  W        P P     +  +   I+++  
Sbjct: 155 VVFGGD-THKLNKNGLLDDDLYLFNINSYKW------TIPQPIGRRPLGRYGHKISII-- 205

Query: 156 GEFSSPKQSKFY---------HYSDTWLFD--CVERKFTKLEF-GGRDSSPSARSGHRII 203
              S+P Q+K Y         +++D  +FD     R  +  EF       P   + H ++
Sbjct: 206 --ASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMV 263

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNS-KPDARSGHCFIPTDNS 262
           A+ N   +FGG         +  ND + +D +  +W+K++T   KP     H  +   + 
Sbjct: 264 AYDNKLWVFGG-----ETPKTISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHL 318

Query: 263 AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSF 321
             ++GG      K+  N       ND + LNL       +W KL   K   P  R G+S 
Sbjct: 319 MCVLGG------KDTHNAYS----NDVYFLNLL----SLKWYKLPRMKEGIPQERSGHSL 364

Query: 322 NLWKQNKSVAFGG---------VYDLQETE 342
            L K  K +  GG         ++DLQ +E
Sbjct: 365 TLMKNEKLLIMGGDKTDYASPNIHDLQTSE 394

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 99/254 (38%), Gaps = 40/254 (15%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVER 180
           W +   +N+P PR   SS+ +  + + I +  G    S        Y D W    +    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
            FT        ++P  R GH      N +++FGG     N      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 241 KLE-TNSKPDARSGHCFI-----PTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
             +    +P  R GH        P      L GG            +     ND    +L
Sbjct: 186 IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQ-----------VDETYFNDLVVFDL 234

Query: 295 TPDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           +   +    WE L+   + P P   ++   +  NK   FGG     ET +++     ND 
Sbjct: 235 SSFRRPNSHWEFLEPVGDLPPPLTNHTMVAY-DNKLWVFGG-----ETPKTIS----NDT 284

Query: 354 YMFHLELNKWSKLR 367
           Y +    ++WSK++
Sbjct: 285 YRYDPAQSEWSKVK 298

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 17/130 (13%)

Query: 237 YKWTKLETNSKPDARSGHC--FIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           Y W +++  + P  R  H   FI T+++ I + G           L    +  D W++  
Sbjct: 71  YIWNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTG----------GLHDQSVYGDVWQIAA 120

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D   +  +++   +N P PRVG++  +   N  V FGG  D  +  ++   +  +DLY
Sbjct: 121 NADGTSFTSKRIDIDQNTPPPRVGHASTICG-NAYVVFGG--DTHKLNKN--GLLDDDLY 175

Query: 355 MFHLELNKWS 364
           +F++   KW+
Sbjct: 176 LFNINSYKWT 185

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 98/253 (38%), Gaps = 46/253 (18%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE--R 180
           W +   QN+P PR    ++A A   + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  ++++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 241 -KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     K               ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
           PD     W+ LK     P P      + Y   LW       FGG        ++L+ +  
Sbjct: 280 PD---SHWDFLKPMTFTPPPMTNFTMISYDSKLW------VFGG--------DTLQGLI- 321

Query: 351 NDLYMFHLELNKW 363
           ND++M+    N W
Sbjct: 322 NDVFMYDPAKNDW 334

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 80/188 (42%), Gaps = 32/188 (17%)

Query: 92  KHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQ--------NAPLPRSSAAV 143
           K +L++FGG+F D       ++NDL  Y +  +S+++  S           P P ++  +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDL--SSFRRPDSHWDFLKPMTFTPPPMTNFTM 302

Query: 144 AVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRII 203
             + S + +  G              +D +++D  +  +  +E  G    P     H  +
Sbjct: 303 ISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQE--HATV 353

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSK--PDARSGHCFIPTDN 261
            + +   + GG     +   +YLN ++  ++ T+KW KL   +   P  RSGH      N
Sbjct: 354 VYNDLMCVVGG----KDEHDAYLNTVYFLNLKTHKWFKLPIFAAGIPQGRSGHSLTLLKN 409

Query: 262 SAIL-MGG 268
             +L MGG
Sbjct: 410 DKVLIMGG 417

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 119/309 (38%), Gaps = 55/309 (17%)

Query: 54  ILSSFSKK-QIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112
           ILS+F    +     +DI+    P    H  +        +   +FGG+ T    +    
Sbjct: 157 ILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCG-----NAFVVFGGD-THKVNREGLM 210

Query: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFY----H 168
            +D+Y  ++ +  W        P P     +  +   I+++   +     ++K Y     
Sbjct: 211 DDDIYLLNVNSYKW------TVPAPVGPRPLGRYGHKISIIATTQM----KTKLYVFGGQ 260

Query: 169 YSDTWLFDCVERKFTKLEFGGRDS----------SPSARSGHRIIAWKNYFILFGGFRDL 218
           + DT+  D      +   F   DS          +P   +   +I++ +   +FGG  D 
Sbjct: 261 FDDTYFNDLAVYDLSS--FRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--DT 316

Query: 219 GNGQTSYLNDLWCFDISTYKWTKLETN-SKPDARSGHCFIPTDNSAILMGGYCKIIAKNN 277
             G    +ND++ +D +   W  +ET+  KP     H  +  ++   ++GG  +  A   
Sbjct: 317 LQG---LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGKDEHDA--- 370

Query: 278 KNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYSFNLWKQNKSVAFGG-V 335
                   LN  + LNL    K  +W KL  F    P  R G+S  L K +K +  GG  
Sbjct: 371 -------YLNTVYFLNL----KTHKWFKLPIFAAGIPQGRSGHSLTLLKNDKVLIMGGDK 419

Query: 336 YDLQETEES 344
           +D    EES
Sbjct: 420 FDYARAEES 428

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 52/129 (40%), Gaps = 19/129 (14%)

Query: 239 WTKLETNSKPDARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++  + P  R  H    +    N   ++GG           L    +  D W L+  
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGG-----------LHDQSVYGDTWILSAF 161

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            D  K+    +   +  P PRVG++  L   N  V FGG  D  +     E +  +D+Y+
Sbjct: 162 DDATKFSTTTIDISEATPPPRVGHAAVLCG-NAFVVFGG--DTHKVNR--EGLMDDDIYL 216

Query: 356 FHLELNKWS 364
            ++   KW+
Sbjct: 217 LNVNSYKWT 225

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 118/292 (40%), Gaps = 55/292 (18%)

Query: 91  NKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNN-----SWKKYVSQNAPLPRSSAAVAV 145
           N + +F+ GG +          Y D++  +   N     S +  +  N P PR   A  +
Sbjct: 96  NDNRIFVTGGLYDQ------SVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTM 149

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRI--I 203
             +   +  GG+     +++     D +LF+    K+T     G  S P  R GH+I  I
Sbjct: 150 CGNAYVVF-GGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIG--SRPLGRYGHKISII 205

Query: 204 AWKNY---FILFGGFRDLGNGQTSYLNDLWCFDISTYK-----WTKLE-TNSKPDARSGH 254
           A K       LFGG  D      +Y NDL  FD+S+++     W  LE  ++ P   + H
Sbjct: 206 ASKQMHTELYLFGGQID-----ETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNH 260

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPS 314
             +  DN   + GG                I ND +      DP +  W K++    +P 
Sbjct: 261 TMVTFDNKLWVFGGETP-----------KTISNDTY----CYDPIQNAWSKVETTGEKPP 305

Query: 315 PRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKL 366
           P   ++  ++K    V FGG        + + + + ND+Y  +L   KW KL
Sbjct: 306 PVQEHASVVYKHLMCV-FGG--------KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 112/289 (38%), Gaps = 46/289 (15%)

Query: 56  SSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYND 115
           +SF+ K+I+++H    +   P       M  N         +FGG+ T    K     +D
Sbjct: 125 TSFTSKRIQIDH----NTPPPRVGHASTMCGNA------YVVFGGD-THKLNKNRLLDDD 173

Query: 116 LYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSP-----KQSKFYHYS 170
           LY ++I +  W        P P  S  +  +   I+++   +  +       Q    +++
Sbjct: 174 LYLFNINSYKW------TIPHPIGSRPLGRYGHKISIIASKQMHTELYLFGGQIDETYFN 227

Query: 171 DTWLFDC--VERKFTKLEFGGRDSS-PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLN 227
           D  +FD     R  +  EF    S+ P   + H ++ + N   +FGG         +  N
Sbjct: 228 DLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTISN 282

Query: 228 DLWCFDISTYKWTKLETN-SKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKIL 286
           D +C+D     W+K+ET   KP     H  +   +   + GG      K+  N       
Sbjct: 283 DTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG------KDIHNTYS---- 332

Query: 287 NDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKSVAFGG 334
           ND + LNL       +W KL   K   P  R G+S  L    K V  GG
Sbjct: 333 NDVYFLNLL----SLKWFKLPCVKEGIPQERSGHSLTLMNNEKLVIMGG 377

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 100/256 (39%), Gaps = 46/256 (17%)

Query: 126 WKKYVSQNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVER 180
           W +   +++P PR   SS+ +  + + I  + GG +          Y D W    +    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT 240
            FT        ++P  R GH      N +++FGG     N      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 241 -KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKN----LMKGKI----LNDAWK 291
                 S+P  R GH                 IIA    +    L  G+I     ND   
Sbjct: 186 IPHPIGSRPLGRYGHKI--------------SIIASKQMHTELYLFGGQIDETYFNDLAV 231

Query: 292 LNLTPDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            +L+   +    WE L+     P P   ++   +  NK   FGG     ET +++     
Sbjct: 232 FDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTF-DNKLWVFGG-----ETPKTIS---- 281

Query: 351 NDLYMFHLELNKWSKL 366
           ND Y +    N WSK+
Sbjct: 282 NDTYCYDPIQNAWSKV 297

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 17/130 (13%)

Query: 237 YKWTKLETNSKPDARSGHC--FIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           Y W +++    P  R  H   FI T+++ I + G           L    +  D W++  
Sbjct: 71  YIWNRIKLKDSPFPRYRHSSSFITTNDNRIFVTG----------GLYDQSVYGDVWEITA 120

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             +   +  ++++   N P PRVG++  +   N  V FGG  D  +  ++   +  +DLY
Sbjct: 121 NANGTSFTSKRIQIDHNTPPPRVGHASTMCG-NAYVVFGG--DTHKLNKN--RLLDDDLY 175

Query: 355 MFHLELNKWS 364
           +F++   KW+
Sbjct: 176 LFNINSYKWT 185

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 97/265 (36%), Gaps = 51/265 (19%)

Query: 126 WKKYVSQNAPLPRSS--AAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVERK 181
           W +    ++PLPR    A+    P     + GG            Y DTW+   +     
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWT- 240
           FT        ++P  R GH      N  ++FGG     N +    +DL+ F++ +++WT 
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTI 275

Query: 241 KLETNSKPDARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
                ++P  R GH        P      L GG            +     ND    +L+
Sbjct: 276 PTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQ-----------LDDNYFNDLAMYDLS 324

Query: 296 P--DP-KKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              +P  +WQ+ K K F   P      V Y + LW       FGG         S     
Sbjct: 325 DFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLW------VFGG---------SSRGEL 369

Query: 350 YNDLYMFHLELNKWSKLRI---KPQ 371
            N LY++  +LN+W  L     KPQ
Sbjct: 370 QNQLYVYIPDLNEWRCLETEGDKPQ 394

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 106/261 (40%), Gaps = 58/261 (22%)

Query: 95  LFIFGGEFTDPETKLTHFYN-------DLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHP 147
           L IFGG+        TH  N       DLY +++ ++ W        P P  +  +  + 
Sbjct: 243 LVIFGGD--------THKLNSEGLLDDDLYLFNVDSHRW------TIPTPIGTRPLGRYG 288

Query: 148 SGIALLHGGEFSSPKQSKFY---------HYSDTWLFDCVERK--FTKLEF-GGRDSSPS 195
             ++++     ++PK++K Y         +++D  ++D  + +   ++ +F   +  +P 
Sbjct: 289 HQVSVI----ATTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPP 344

Query: 196 ARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLET-NSKPDARSGH 254
             + H ++A+     +FGG     + +    N L+ +     +W  LET   KP     H
Sbjct: 345 PLTNHTMVAYDYKLWVFGG-----SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEH 399

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQP 313
                 N   + GG  K            +  N  + LNL    +  +W +L     N+P
Sbjct: 400 SATIYKNLMCVFGGKNK----------DDEYQNTMYFLNL----QTLKWYRLDTSHCNEP 445

Query: 314 SPRVGYSFNLWKQNKSVAFGG 334
            PR G S +L + +K +  GG
Sbjct: 446 LPRSGQSMSLMQNDKILIMGG 466

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 89/194 (45%), Gaps = 28/194 (14%)

Query: 83  LMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQNAPLPR 138
           ++  NP   K  L++FGG+        T+F +    DL S+  +N+ W+ ++     +P 
Sbjct: 202 IIAYNPMQTK--LYLFGGQLDK-----TYFNDLAMFDLSSFRRRNSHWE-FLEPATTVPP 253

Query: 139 SSAAVAVHPSGIAL-LHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSAR 197
             A   +   G  L + GGE  +PK       ++T+ +D ++  ++K+E  G    P   
Sbjct: 254 PLANHTMVTYGNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQE 307

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGHC 255
             H  + +K+   +FGG         +Y ND++  D+ ++KW KL       P  RSGH 
Sbjct: 308 --HASVVYKHIMCVFGG----KYTHNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHS 361

Query: 256 FIPTDNSAIL-MGG 268
                N  IL MGG
Sbjct: 362 LTLMKNEKILIMGG 375

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 98/252 (38%), Gaps = 38/252 (15%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCVERK 181
           W +   +++P PR   S++  V       + GG ++         Y D W    +     
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYNQSV------YGDVWQITANADGTS 124

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTK 241
           FT        ++P  R GH      N +++FGG     N      +D++ F++++YKWT 
Sbjct: 125 FTPKAIQIDRNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWTI 184

Query: 242 LE-TNSKPDARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
            +   S+P  R GH      + P      L GG            +     ND    +L+
Sbjct: 185 PQPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQ-----------LDKTYFNDLAMFDLS 233

Query: 296 PDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
              ++   WE L+     P P   ++   +  NK   FGG     ET +++     N+ Y
Sbjct: 234 SFRRRNSHWEFLEPATTVPPPLANHTMVTYG-NKLWVFGG-----ETPKTVS----NETY 283

Query: 355 MFHLELNKWSKL 366
            +    N WSK+
Sbjct: 284 CYDPIQNDWSKI 295

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 103/254 (40%), Gaps = 46/254 (18%)

Query: 96  FIFGGEFTD-PETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLH 154
            +FGG+     E KL    +D+Y +++ +  W        P P  S  +  +   I+++ 
Sbjct: 153 VVFGGDTHKLNEDKL--LDDDIYLFNVNSYKW------TIPQPIGSRPLGRYGHKISIIA 204

Query: 155 GGEFSSPKQSKFY---------HYSDTWLFDC--VERKFTKLEF-GGRDSSPSARSGHRI 202
                +P Q+K Y         +++D  +FD     R+ +  EF     + P   + H +
Sbjct: 205 ----YNPMQTKLYLFGGQLDKTYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPPLANHTM 260

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSK-PDARSGHCFIPTDN 261
           + + N   +FGG         +  N+ +C+D     W+K+ET  + P     H  +   +
Sbjct: 261 VTYGNKLWVFGG-----ETPKTVSNETYCYDPIQNDWSKIETTGEIPPPVQEHASVVYKH 315

Query: 262 SAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYS 320
              + GG      K   N       ND + L+L      ++W KL + K   P  R G+S
Sbjct: 316 IMCVFGG------KYTHNAYS----NDVYFLDLL----SFKWYKLPHIKEGIPRERSGHS 361

Query: 321 FNLWKQNKSVAFGG 334
             L K  K +  GG
Sbjct: 362 LTLMKNEKILIMGG 375

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 93/195 (47%), Gaps = 30/195 (15%)

Query: 83  LMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK--KYVSQNAPL 136
           ++  NP   K  LF+FGG+  +     T+F +    DL S+   N+ W   K VS   P 
Sbjct: 204 IIANNPMQTK--LFLFGGQIDE-----TYFNDLAMFDLSSFRRPNSHWVFLKPVSI-VPP 255

Query: 137 PRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSA 196
           P ++  +    + + +  G    +P        ++T+ +D V+  ++K++  G    P A
Sbjct: 256 PLTNHTMVTFDNKLWVFGG---KTPNTLS----NETFCYDPVQNDWSKIQTTGE--RPPA 306

Query: 197 RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSK--PDARSGH 254
              H  + +K+   +FGG +D+   Q +Y ND++  ++ T+KW KL    +  P  RSGH
Sbjct: 307 VQEHASVVYKHLMCIFGG-KDI---QNAYSNDVYFLNLITFKWYKLPRIKEGLPKERSGH 362

Query: 255 CFIPTDNSA-ILMGG 268
                 N   ++MGG
Sbjct: 363 SLTLIKNDKLVIMGG 377

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 101/252 (40%), Gaps = 45/252 (17%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGG 189
           + QN P PR   A  +  +   +  GG+      ++     D +LF+    K+T  +  G
Sbjct: 134 IGQNTPPPRVGHASTICGNAYVVF-GGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 190 RDSSPSARSGHRIIAWKN-----YFILFGGFRDLGNGQTSYLNDLWCFDISTYK-----W 239
             + P  R GH+I    N        LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 --TRPLGRYGHKISIIANNPMQTKLFLFGGQID-----ETYFNDLAMFDLSSFRRPNSHW 244

Query: 240 TKLETNS-KPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
             L+  S  P   + H  +  DN   + GG               K  N         DP
Sbjct: 245 VFLKPVSIVPPPLTNHTMVTFDNKLWVFGG---------------KTPNTLSNETFCYDP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHL 358
            +  W K++    +P P V    ++  ++    FGG        + +++ + ND+Y  +L
Sbjct: 290 VQNDWSKIQTTGERP-PAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNL 340

Query: 359 ELNKWSKL-RIK 369
              KW KL RIK
Sbjct: 341 ITFKWYKLPRIK 352

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 83/206 (40%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVER--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+        +FT       D++P  R GH      N F++FGG     N +    
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 227 NDLWCFDISTYKWT-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++ F+I++YKWT       +P  R GH        +++     K              
Sbjct: 172 DDVYLFNINSYKWTIPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTY 225

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W++ K ++F   P      V Y + LW       FGG    
Sbjct: 226 FNDLCVYDLSSFRRPD-SHWEFLKPQSFVPPPLTNHTMVSYDYKLW------IFGG---- 274

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+++M+   +N W+
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDWT 295

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 80/171 (46%), Gaps = 27/171 (15%)

Query: 92  KHELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSQN-APLPRSSAAVAV 145
           K +L++FGG+F D       ++NDL  Y +      ++ W+    Q+  P P ++  +  
Sbjct: 211 KTKLYVFGGQFDDT------YFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVS 264

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  GG+ +          ++ +++D     +T +E  G  S P A   H  + +
Sbjct: 265 YDYKLWIF-GGDTAQGL------INEVFMYDPTVNDWTVVETTG--SKPPAIQEHAAVVY 315

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGH 254
           K+   + GG     + Q SY ND++  ++ ++KW KL    N  P  RSGH
Sbjct: 316 KDLMCVTGG----KDEQDSYSNDVYFLNLKSFKWFKLPFFKNGVPQGRSGH 362

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 98/259 (37%), Gaps = 58/259 (22%)

Query: 126 WKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVER--K 181
           W +   + +P PR    A+     SG   + GG      QS    Y DTW+   ++    
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHD---QSV---YGDTWIIKSLDNATS 146

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTK 241
           F  +     D++P  R GH      N F++FGG     N      +D++ F+I+++KWT 
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 242 LETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI-----------LNDAW 290
                          IPT      +G Y   I+    N MK K+            ND  
Sbjct: 206 ---------------IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFDDTYFNDLA 250

Query: 291 KLNLTPDPKK-WQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           + +L+   +    WE +K     P P      + +   LW       FGG     +T + 
Sbjct: 251 EFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLW------VFGG-----DTPQG 299

Query: 345 LESVFYNDLYMFHLELNKW 363
           L     N+++MF    N W
Sbjct: 300 LT----NEVFMFDPAANDW 314

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 93/200 (46%), Gaps = 34/200 (17%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKYVSQNAPL 136
           H +        K +L++FGG+F D       ++NDL  + +    +++S  +++     +
Sbjct: 220 HKISIIAANQMKTKLYVFGGQFDDT------YFNDLAEFDLSSFRRSDSHWEFIKPATFM 273

Query: 137 PRSSAAVAVHPSGIALLH-----GGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRD 191
           P     +A H + I+  H     GG+  +P+       ++ ++FD     +  ++  G  
Sbjct: 274 P---PPLANH-TMISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQTTG-- 321

Query: 192 SSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLET--NSKPD 249
           + P     H  I +++   +FGG     + Q +Y N ++  +  + KW KL T  N  P 
Sbjct: 322 NIPPPLQEHAAIIYRDLMCVFGG----KDAQDNYSNAVYFLNFRSLKWFKLPTFNNMIPR 377

Query: 250 ARSGHCF-IPTDNSAILMGG 268
           ARSGH   + ++N  ++MGG
Sbjct: 378 ARSGHSLTLLSNNKLLIMGG 397

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 100/256 (39%), Gaps = 48/256 (18%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLH 154
             IFGG+ T          +D+Y ++I ++ W        P P+    +  +   I+++ 
Sbjct: 174 FVIFGGD-THKVNDAGLMDDDIYLFNINSHKW------TIPTPQGPRPLGRYGHKISIIA 226

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCVERKFTKLEFGGRDSS----------PSARSGH 200
             +     ++K Y     + DT+  D  E  F    F   DS           P   + H
Sbjct: 227 ANQM----KTKLYVFGGQFDDTYFNDLAE--FDLSSFRRSDSHWEFIKPATFMPPPLANH 280

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSK-PDARSGHCFIPT 259
            +I++ +   +FGG  D   G T   N+++ FD +   W  ++T    P     H  I  
Sbjct: 281 TMISFDHKLWVFGG--DTPQGLT---NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIY 335

Query: 260 DNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVG 318
            +   + GG     A++N +       N  + LN     +  +W KL  F N  P  R G
Sbjct: 336 RDLMCVFGGKD---AQDNYS-------NAVYFLNF----RSLKWFKLPTFNNMIPRARSG 381

Query: 319 YSFNLWKQNKSVAFGG 334
           +S  L   NK +  GG
Sbjct: 382 HSLTLLSNNKLLIMGG 397

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 17/149 (11%)

Query: 113 YNDLYSYSIKNNSWKKYVSQNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYS 170
           Y+ L+  +I    W +   QN+P PR    A+  V   G   + GG      QS    Y 
Sbjct: 151 YHKLHPTTI----WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHD---QSV---YG 200

Query: 171 DTWLF----DCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           DTW+     + +    T       +++P  R GH      N F++FGG     N   S  
Sbjct: 201 DTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD 260

Query: 227 NDLWCFDISTYKWTKLE-TNSKPDARSGH 254
           +D++ F+I++YKWT  +    +P  R GH
Sbjct: 261 DDIYLFNINSYKWTIPKPVGQRPLGRYGH 289

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 91/215 (42%), Gaps = 36/215 (16%)

Query: 92  KHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQN-APLPRSSAAVAVH 146
           K +L++FGG+F D     T+F +    DL S+   ++ W+    ++  P P ++  +  +
Sbjct: 300 KTKLYLFGGQFDD-----TYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSY 354

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSS----PSARSGHRI 202
              + +  G          F       ++D V+  +  +E    ++     P     H  
Sbjct: 355 DHKLWVFGGDTLQGLTNQVF-------MYDPVDNDWCVVETFANNNDVSNIPPPIQEHAA 407

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGHCFIPTD 260
           + +K+   + GG  +  N    YLND++  ++ T KW KL       P  RSGH      
Sbjct: 408 VLYKDLMCVIGGKDESDN----YLNDVYFLNLKTLKWFKLPFYKEGVPQGRSGHSVTLLK 463

Query: 261 NSAIL-MGG----YCKIIA----KNNKNLMKGKIL 286
           N  IL MGG    Y  I +     ++ N+ KG IL
Sbjct: 464 NDKILIMGGDKFDYANIDSFDFHTSDTNMGKGTIL 498

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 99/263 (37%), Gaps = 71/263 (26%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGG 189
           +S+N P PR   A  +  +   +  G      K        D +LF+    K+T  +  G
Sbjct: 223 ISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD--DDIYLFNINSYKWTIPKPVG 280

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYK-----W 239
           +   P  R GH+I  IA    K    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 281 Q--RPLGRYGHKISIIATSQMKTKLYLFGGQFD-----DTYFNDLVVFDLSSFRRPDSHW 333

Query: 240 TKLETNS-KPDARSGHCFIPTDNSAILMGG-------------------YCKI--IAKNN 277
             +   S  P   + H     D+   + GG                   +C +   A NN
Sbjct: 334 EFIRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDWCVVETFANNN 393

Query: 278 -----------------KNLM---KGK-----ILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
                            K+LM    GK      LND + LNL    K  +W KL  +K  
Sbjct: 394 DVSNIPPPIQEHAAVLYKDLMCVIGGKDESDNYLNDVYFLNL----KTLKWFKLPFYKEG 449

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K +K +  GG
Sbjct: 450 VPQGRSGHSVTLLKNDKILIMGG 472

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 81/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVER--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    E   KFT       +++P  R GH      N F++FGG     N +    
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMD 256

Query: 227 NDLWCFDISTYKWT-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++  +I+++KWT       +P  R GH        +I+     K              
Sbjct: 257 DDVYLLNINSHKWTIPRPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 310

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   WQ+ K  +F   P      V Y + LW       FGG    
Sbjct: 311 FNDLAVYDLSSFRRPD-SHWQFLKPVSFVPPPLTNHTMVSYDYKLW------VFGG---- 359

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+M+    N WS
Sbjct: 360 -DTPQGL----INELFMYDPTTNDWS 380

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNS-KPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D +T  W+ ++T   KP    
Sbjct: 339 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFMYDPTTNDWSVVDTTGVKPPPLQ 393

Query: 253 GHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKN- 311
            H  +   +   ++GG      K++++    ++    + LNL    K ++W KL +F++ 
Sbjct: 394 EHAALLYKDLMCIVGG------KDDQDNYSQEV----YFLNL----KSFRWFKLPHFRSL 439

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 440 VPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 239 WTKLETNSKPDARSGHC---FIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N   ++GG           L    +  D W +   
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGG-----------LHDQSVYGDTWIIKSH 206

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  K+  + ++  +  P PRVG++  L   N  V FGG  D  +T  + E +  +D+Y+
Sbjct: 207 ENGNKFTSKTVEITETTPPPRVGHASTLCG-NAFVIFGG--DTHKT--NAEGLMDDDVYL 261

Query: 356 FHLELNKWSKLR 367
            ++  +KW+  R
Sbjct: 262 LNINSHKWTIPR 273

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 97/267 (36%), Gaps = 72/267 (26%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +   QN+P PR     + + S       I  LH              Y DTW+    +
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQSV----------YGDTWIISTND 190

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237
              +F        +++P  R GH      N F+LFGG     N +    +DL+ F++++Y
Sbjct: 191 NGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSY 250

Query: 238 KWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI-----------L 286
           KWT                IP       +G Y   I+    N MK K+            
Sbjct: 251 KWT----------------IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFDDTYF 294

Query: 287 NDAWKLNLT----PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYD 337
           ND    +L+    PD     WE LK     P P      + Y  +LW       FGG   
Sbjct: 295 NDLAVFDLSSFRRPD---SHWEFLKPTTFSPPPLTNHTMISYDNHLW------VFGG--- 342

Query: 338 LQETEESLESVFYNDLYMFHLELNKWS 364
                ++L+ +  N ++ + +  N WS
Sbjct: 343 -----DTLQGLI-NQVFKYDVANNDWS 363

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 85/194 (43%), Gaps = 28/194 (14%)

Query: 83  LMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQN-APLP 137
           +M AN    K +L++FGG+F D     T+F +    DL S+   ++ W+       +P P
Sbjct: 272 IMAAN--QMKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPP 324

Query: 138 RSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSAR 197
            ++  +  + + + +  G              +  + +D     ++  E  G  + P   
Sbjct: 325 LTNHTMISYDNHLWVFGGDTLQG-------LINQVFKYDVANNDWSIAETTG--TKPPPM 375

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLET--NSKPDARSGHC 255
             H  + +K+  ++ GG     +   +YLN ++  ++ T++W KL T     P  RSGH 
Sbjct: 376 QEHAAVVYKHVMVVVGG----KDEHDTYLNSVYFLNLKTHEWFKLPTFKAGIPQGRSGHS 431

Query: 256 FIPTDNSAIL-MGG 268
               +N  +L MGG
Sbjct: 432 LTLLNNDKLLIMGG 445

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 100/257 (38%), Gaps = 49/257 (19%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCVERK-F 182
           W ++    +P PR     + H S      + GG     +QS    Y D W  +  + K F
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGLR---EQSV---YGDVWSINHKDDKSF 90

Query: 183 TKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKL 242
           +        ++P  R GH      N  ILFGG     N      +DL+ F++++YKWT  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 243 E-TNSKPDARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT- 295
           E    +P  R GH        PT     L GG                  ND    +L+ 
Sbjct: 151 EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ-----------FDDTYFNDLSMFDLST 199

Query: 296 ---PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              PD  +W++ K K+F   P      + Y   LW       FGG        E+L+ + 
Sbjct: 200 FRKPD-AQWEFIKPKSFFPPPVSNHTMISYDNKLW------VFGG--------ETLQGLI 244

Query: 350 YNDLYMFHLELNKWSKL 366
            N+++++   +N WS +
Sbjct: 245 -NEVFVYDPIVNDWSVI 260

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 91/198 (45%), Gaps = 30/198 (15%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKYVSQNA-- 134
           H +     Q  K +LF+FGG+F D       ++NDL  + +    K ++  +++   +  
Sbjct: 163 HKISIIATQPTKTKLFLFGGQFDDT------YFNDLSMFDLSTFRKPDAQWEFIKPKSFF 216

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSP 194
           P P S+  +  + + + +  G              ++ +++D +   ++ +E  G  SSP
Sbjct: 217 PPPVSNHTMISYDNKLWVFGGETLQG-------LINEVFVYDPIVNDWSVIETTG--SSP 267

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKP---DAR 251
                H  + +KN   + GG     + + +Y+N ++  +++T KW KL  +  P     R
Sbjct: 268 PPIQEHAAVVYKNLMCVVGG----KDSKDNYMNSVYFLNLNTLKWFKL-PHINPGIMQGR 322

Query: 252 SGH-CFIPTDNSAILMGG 268
           SGH   +  D+S +++ G
Sbjct: 323 SGHTATLLNDDSILILSG 340

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 99/259 (38%), Gaps = 54/259 (20%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCVER--- 180
           W +    N+P PR     + H +  G   + GG      QS    Y DTW+    +    
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHD---QSV---YGDTWILTASDIDKT 200

Query: 181 ------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234
                 K T +E    +S+P  R GH      N F++FGG     N      +DL+  +I
Sbjct: 201 GAINSFKSTTIEI--TESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNI 258

Query: 235 STYKWTKLE-TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
           ++YKWT  +    +P  R GH  +              I A+  K  + G   +D +  +
Sbjct: 259 NSYKWTIPKPVGQRPLGRYGHKIV-------------TISAEQTKLYLFGGQFDDTYFGD 305

Query: 294 LT---------PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           L          PD   W + K   F   P P   ++   + Q+K   FGG        ++
Sbjct: 306 LAVFDLSSFRRPD-SHWVFLKPSGF--NPPPLTNHTMVTY-QDKIWVFGG--------DT 353

Query: 345 LESVFYNDLYMFHLELNKW 363
           LE    N +Y++    N W
Sbjct: 354 LEEGLINRVYLYSPTNNSW 372

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 27/183 (14%)

Query: 95  LFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK--KYVSQNAPLPRSSAAVAVHPS 148
           L++FGG+F D     T+F +    DL S+   ++ W   K    N P P ++  +  +  
Sbjct: 291 LYLFGGQFDD-----TYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPP-PLTNHTMVTYQD 344

Query: 149 GIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNY 208
            I +  G        ++ Y YS T         +  +E  G    P     H  I +K+ 
Sbjct: 345 KIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVETTG--DIPPPMQEHAAIVYKDL 396

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE--TNSKPDARSGHCFIPTDNSAIL- 265
             + GG     + + +YLN L+  ++ + KW KL    N+ P  RSGH      N  IL 
Sbjct: 397 MCVVGG----KDAEDNYLNTLYFLNLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQILI 452

Query: 266 MGG 268
           MGG
Sbjct: 453 MGG 455

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 111/277 (40%), Gaps = 66/277 (23%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGG 189
           ++++ P PR   A  +   G A +  G  +    S      D +L +    K+T  +  G
Sbjct: 213 ITESTPPPRVGHASTL--CGNAFVVFGGDTHKVNSDGLMDDDLYLLNINSYKWTIPKPVG 270

Query: 190 RDSSPSARSGHRII---AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYK-----WTK 241
           +   P  R GH+I+   A +    LFGG  D      +Y  DL  FD+S+++     W  
Sbjct: 271 Q--RPLGRYGHKIVTISAEQTKLYLFGGQFD-----DTYFGDLAVFDLSSFRRPDSHWVF 323

Query: 242 LETNS-KPDARSGHCFI--------------------------PTDNS-AIL-------- 265
           L+ +   P   + H  +                          PT+NS  I+        
Sbjct: 324 LKPSGFNPPPLTNHTMVTYQDKIWVFGGDTLEEGLINRVYLYSPTNNSWEIVETTGDIPP 383

Query: 266 -MGGYCKIIAKNNKNLMKGK-----ILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVG 318
            M  +  I+ K+   ++ GK      LN  + LNL    +  +W KL  +KN  P  R G
Sbjct: 384 PMQEHAAIVYKDLMCVVGGKDAEDNYLNTLYFLNL----QSLKWFKLPFYKNNIPQGRSG 439

Query: 319 YSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
           +S  L K ++ +  GG  D  +   S E++  +D+ M
Sbjct: 440 HSVTLLKNDQILIMGG--DKYDYSSSTENMHISDVDM 474

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 107/254 (42%), Gaps = 44/254 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQNA---PLPRSSAAVAVHPSGIA 151
             IFGG+ T    K     +D+Y ++I  NS+K  + Q     PL R    +++  +   
Sbjct: 155 FVIFGGD-THKTNKDGLMDDDIYLFNI--NSYKWTIPQPVGPRPLGRYGHKISIIATSQM 211

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLE-----FGGRDSSPSARSGHRI 202
                + GG+F         +++D  ++D     F K E        +   P   + H +
Sbjct: 212 KTKLYVFGGQFDD------SYFNDLCVYDL--SSFRKPESHWEFLKPKSFIPPPLTNHTM 263

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETN-SKPDARSGHCFIPTDN 261
           +++     +FGG     + Q   +N L+ FD     W  +ET   KP     H  +  ++
Sbjct: 264 VSYDYKLWVFGG-----DTQQGLINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMFND 318

Query: 262 SAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYS 320
              +MGG      K+ +++     LN  + LNL    K  +W K  ++K N P  R G+S
Sbjct: 319 LMCIMGG------KDEQDVY----LNSVYFLNL----KSLKWFKFNDYKLNIPQGRSGHS 364

Query: 321 FNLWKQNKSVAFGG 334
             L K N+ +  GG
Sbjct: 365 ITLLKNNRLLIMGG 378

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 71/178 (39%), Gaps = 28/178 (15%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE-TNSKPDAR 251
           +P  R GH      N F++FGG     N      +D++ F+I++YKWT  +    +P  R
Sbjct: 139 TPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGPRPLGR 198

Query: 252 SGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPK---KWQWEKLKN 308
            GH        +I+     K               ND    +L+   K    W++ K K+
Sbjct: 199 YGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVYDLSSFRKPESHWEFLKPKS 252

Query: 309 FKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKW 363
           F   P      V Y + LW       FGG     +T++ L     N L+MF   +N W
Sbjct: 253 FIPPPLTNHTMVSYDYKLW------VFGG-----DTQQGL----INQLFMFDPVINDW 295

 Score = 35.4 bits (80), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 99/250 (39%), Gaps = 48/250 (19%)

Query: 130 VSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLE-FG 188
           +++  P PR   A  +  +   +  G    + K        D +LF+    K+T  +  G
Sbjct: 135 ITEYTPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMD--DDIYLFNINSYKWTIPQPVG 192

Query: 189 GRDSSPSARSGHRI--IA---WKNYFILFGG-FRDLGNGQTSYLNDLWCFDISTYK---- 238
            R   P  R GH+I  IA    K    +FGG F D      SY NDL  +D+S+++    
Sbjct: 193 PR---PLGRYGHKISIIATSQMKTKLYVFGGQFDD------SYFNDLCVYDLSSFRKPES 243

Query: 239 -WTKLETNS-KPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTP 296
            W  L+  S  P   + H  +  D    + GG          +  +G ++N  +      
Sbjct: 244 HWEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG----------DTQQG-LINQLFMF---- 288

Query: 297 DPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMF 356
           DP    W  ++    +P P   ++  ++  N  +   G  D Q+       V+ N +Y  
Sbjct: 289 DPVINDWRVVETTGEKPPPVQEHAAVMF--NDLMCIMGGKDEQD-------VYLNSVYFL 339

Query: 357 HLELNKWSKL 366
           +L+  KW K 
Sbjct: 340 NLKSLKWFKF 349

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 97/265 (36%), Gaps = 68/265 (25%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +   Q++P PR     + + S       I  LH              Y DTW+ +  +
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV----------YGDTWIINVDD 143

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237
              +F+       + +P  R GH      N F++FGG     N +    +DL+ F+I+++
Sbjct: 144 SGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSF 203

Query: 238 KWT-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI----------- 285
           KWT       +P  R GH                 IIA N    MK K+           
Sbjct: 204 KWTIPHPVGPRPLGRYGHKI--------------SIIATNQ---MKTKLYLFGGQFDDTF 246

Query: 286 LNDAWKLNLTP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQ 339
            ND    +L+        W++ K K F   P      V Y   LW       FGG     
Sbjct: 247 FNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLW------IFGG----- 295

Query: 340 ETEESLESVFYNDLYMFHLELNKWS 364
           +T + L     N ++++ +  N WS
Sbjct: 296 DTMQGL----INKVFVYDIMSNDWS 316

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 112/291 (38%), Gaps = 51/291 (17%)

Query: 59  SKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN---- 114
           S  Q   + VDI+    P    H           +   IFGG+        TH  N    
Sbjct: 144 SGTQFSSKTVDISEFTPPPRVGHAATLCG-----NAFVIFGGD--------THKVNSEGL 190

Query: 115 ---DLYSYSIKNNSWK-KYVSQNAPLPRSSAAVAVHPSGIA----LLHGGEFSSPKQSKF 166
              DLY ++I +  W   +     PL R    +++  +        L GG+F       F
Sbjct: 191 MDDDLYLFNINSFKWTIPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQFDD----TF 246

Query: 167 YHYSDTWLFDCVERKFTKLEF-GGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSY 225
           ++    +      R  +  EF   +   P   + H ++++ +   +FGG  D   G    
Sbjct: 247 FNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--DTMQG---L 301

Query: 226 LNDLWCFDISTYKWTKLETN-SKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGK 284
           +N ++ +DI +  W+ +ET  ++P     H  +      I     C +  K+ +++    
Sbjct: 302 INKVFVYDIMSNDWSLVETTGARPPPLQEHAAL------IYKDLMCVVGGKDEQDIY--- 352

Query: 285 ILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYSFNLWKQNKSVAFGG 334
            LN  + LNL    K  +W K   FK   P  R G+S  L K NK +  GG
Sbjct: 353 -LNSIYFLNL----KSCRWFKFPVFKAGIPQGRSGHSITLLKNNKILIMGG 398

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 82/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCVE--RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    +  ++F+       +++P  R GH      N F++FGG     N +    
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 227 NDLWCFDISTYKWT-KLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++  +++++KWT       +P  R GH        +I+     K              
Sbjct: 151 DDVYLLNVNSHKWTIPHPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 204

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W + K  +F   P      V Y + LW       FGG    
Sbjct: 205 FNDLAVYDLSSFRRPD-SHWVFVKPASFVPPPLTNHTMVSYDYKLW------VFGG---- 253

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+++   +N WS
Sbjct: 254 -DTPQGL----INELFVYDPVVNDWS 274

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 64/143 (44%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETN-SKPDARS 252
           P   + H ++++     +FGG    G      +N+L+ +D     W+ +ET  +KP    
Sbjct: 233 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFVYDPVVNDWSVVETTGAKPPPLQ 287

Query: 253 GHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
            H  +      +     C +  K++++        D + +N+    K ++W KL +F++ 
Sbjct: 288 EHAAV------LYRDLMCVVGGKDDQD----NYSQDVYFMNM----KTFRWFKLPHFQDM 333

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 334 VPSPRSGHSVTLLANRKLLIMGG 356

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 19/129 (14%)

Query: 239 WTKLETNSKPDARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N  I++GG           L    +  D W L   
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGG-----------LHDQSVYGDTWILRAQ 100

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            + K++    ++  +  P PRVG++  L   N  V FGG  D  +T    E +  +D+Y+
Sbjct: 101 DNGKQFSARTIEITETTPPPRVGHAATLCG-NAFVIFGG--DTHKTNN--EGLMDDDVYL 155

Query: 356 FHLELNKWS 364
            ++  +KW+
Sbjct: 156 LNVNSHKWT 164

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 95/260 (36%), Gaps = 48/260 (18%)

Query: 126 WKKYVSQNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCVE 179
           W +    N+P PR     + + S       I  LH              Y DTW      
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV----------YGDTWSITSTN 191

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237
              +F        D SP  R GH      N F++FGG     N      +D++ F+I+++
Sbjct: 192 NGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSH 251

Query: 238 KWT-KLETNSKPDARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWK 291
           KWT       +P  R GH    I T +S     L GG                  ND   
Sbjct: 252 KWTIPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ-----------FDDTYFNDIAV 300

Query: 292 LNLTPDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            +L+   +    WE +K     P P   ++   +  NK   FGG     +T++ L     
Sbjct: 301 FDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTY-DNKLWVFGG-----DTKDGL----I 350

Query: 351 NDLYMFHL--ELNKWSKLRI 368
           ND+Y F     +N W+K+ +
Sbjct: 351 NDIYAFDPADSINTWTKIDV 370

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 28/198 (14%)

Query: 81  HPLMFANPQHNKHELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSQN-AP 135
           H +       +K +L++FGG+F D     T+F +    DL S+   ++ W+    +   P
Sbjct: 269 HKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFIKPKGLIP 323

Query: 136 LPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVE--RKFTKLEFGGRDSS 193
            P ++  +  + + + +  GG+      +K    +D + FD  +    +TK++  G    
Sbjct: 324 PPMTNHTMVTYDNKLWVF-GGD------TKDGLINDIYAFDPADSINTWTKIDVTG--DI 374

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLET--NSKPDAR 251
           P     H  + + N   + GG     +    YLN +  F+    KW K     +     R
Sbjct: 375 PCPVQEHSALIYDNLMCVIGG----KDENDMYLNSVHFFNFDKLKWFKFPIFKSGIMQGR 430

Query: 252 SGHCFIPTDNSAIL-MGG 268
           SGH     +N+ IL MGG
Sbjct: 431 SGHSISLLNNNKILIMGG 448

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDAR 251
           P AR  H    I+  N  +L GG +    G    L+D W FD+ T +W+ +++ S    R
Sbjct: 437 PVARMCHTFTTISRNNQLLLIGGRKAPHQG----LSDNWIFDMKTREWSMIKSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + +++GG
Sbjct: 493 HSACSLP-DGNVLILGG 508

>SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]
           {ON} similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 697

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 22/112 (19%)

Query: 240 TKLETNSKPDARSGHCFIPTD-NSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
           + ++++  P  R  H F   D N+ IL GG     A N       K L D W L      
Sbjct: 423 SAIDSSRIPQERMCHTFTYVDDNTCILAGGRT---APN-------KTLEDVWILTRKQSE 472

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGG--------VYDLQETE 342
             W+W++  N    P PR  +S  L  +++ + +GG        VYD+++ E
Sbjct: 473 GAWEWQQGLNL---PDPRFRHSACLLNEHQLLIYGGKTRGSTFLVYDMRKNE 521

>TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 17/118 (14%)

Query: 167 YHYSDTWLFDCVERKFTKLEFGGRDSSPSA------RSGHRIIAWKNYFILFGGFRDLGN 220
           Y  S+T+  D VER + ++     ++S +       R  H I     Y  LFGG   + +
Sbjct: 127 YISSETFNLDLVERTWVRVSTTVVNNSENTGPFFKPRILHTICYTNAYLYLFGGLT-ISD 185

Query: 221 GQTSYL---NDLWCFDISTYKWTKLETNSKPDARSGHCFI-------PTDNSAILMGG 268
           G    L   N+LW  ++ T KW+ +  +S   AR  H  +         D   +++GG
Sbjct: 186 GDPKILVPSNELWKLNLQTKKWSLVAKDSNIPARFSHTMVVKYEDDDSHDTKLVIIGG 243

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARS-----------GHCFI 257
            +L GG  D     T+   D+W FD+ T++WTK+ T  KP  +            GH  +
Sbjct: 696 IVLHGGSDD-----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMM 750

Query: 258 PTDNSAILMGG 268
            +   A+ +GG
Sbjct: 751 TSGCMAVCVGG 761

>Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W
           (REAL)
          Length = 719

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDAR 251
           P AR  H    +   +  +L GG +    G    L D W FDI   +W+ +++ S    R
Sbjct: 437 PDARMCHTFTTLCSNDQLLLVGGRKAPHQG----LCDNWIFDIKKREWSMIQSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + ++MGG
Sbjct: 493 HSACNLP-DGNVLIMGG 508

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 194 PSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDAR 251
           P AR  H + ++   +  +L GG +    G    L+D W FD  T +W+ ++  S    R
Sbjct: 450 PLARMCHTLTSFCGSSQLLLVGGRKAPHQG----LSDNWIFDTKTNEWSMVQKLSHTRFR 505

Query: 252 SGHCFIPTDNSAILMGGYCK 271
              C + +DNS ++ GG  K
Sbjct: 506 HSACNL-SDNSVLIFGGVTK 524

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEK--------- 305
            FIPT  S+ +     K + + N+   +G      + +N+ P+ +K + EK         
Sbjct: 281 MFIPTSTSSKIHQKLSKAVVRKNQRQNQGP---GTYIINMDPEVEKRELEKKQSQILRDR 337

Query: 306 ----LKNFKNQPSPRVGYSFNLWKQNKSVAFGGV 335
               LK  + Q SP VG+     KQ+   A+G  
Sbjct: 338 RKRQLKEKEKQESPDVGFETAFRKQSSPTAYGAT 371

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 9/59 (15%)

Query: 219 GNGQTSYLNDLWCFDISTYKWTKLETNSKPDARS---------GHCFIPTDNSAILMGG 268
           G+ +T    D+W +DI T  W+++ T+ K +A           GH  +     A+ +GG
Sbjct: 676 GSNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]
           {ON} similar to gnl|GLV|KLLA0F00374g Kluyveromyces
           lactis KLLA0F00374g and weakly similar to YOR371C
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 840

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%), Gaps = 16/90 (17%)

Query: 219 GNGQTSYLNDLWCFDISTYKWTKLETNSKPDARS----------GHCFIPTDNSAILMGG 268
           G+ +     D+W FD+ T  WT ++T  + +             GH  I    +A+ +GG
Sbjct: 668 GSDKDHVYGDMWWFDLDTETWTHVDTYCQEEKDGGFIPIEFTLVGHTLIQLGKNAVCIGG 727

Query: 269 YCK------IIAKNNKNLMKGKILNDAWKL 292
             +      +  KN KN  KG   N   KL
Sbjct: 728 LSQEDVNDFLGVKNKKNESKGAFNNSGSKL 757

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 46/120 (38%), Gaps = 19/120 (15%)

Query: 103 TDPETKLTHFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPK 162
           T PE      + +L + +       +   Q  PL  +  A  V      ++HGG   S  
Sbjct: 569 TTPEETSQAIFANLPASAKVGRPANRDARQRTPLSGNKDAKTV------IIHGGSDGS-- 620

Query: 163 QSKFYHYSDTWLFDCVERKFTKLEFGGRDSSPSARS-------GHRIIAWKNYFILFGGF 215
                 Y D W FD  + +++++    RD     R        GH I   ++ F+L+GG 
Sbjct: 621 ----RVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIFHSRDEFLLYGGL 676

>Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)
          Length = 892

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILM 266
            I+FGG+R  G+ +   +NDLW  +I   +  K           G+C      +AILM
Sbjct: 510 IIIFGGYRQTGDDRYEAMNDLWKIEIPVIRRGK----------KGYCKFSETANAILM 557

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (41%), Gaps = 28/110 (25%)

Query: 170 SDTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL--- 226
           SDT   D  +  F +L+       P AR+ H              F  LG+G+T+ +   
Sbjct: 417 SDTLKIDTQKNTFIQLQ--NHSVLPPARACHT-------------FTRLGDGETAMVIGG 461

Query: 227 --------NDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGG 268
                   ND W ++++T +W K      P+ R  H  + TD + +L+ G
Sbjct: 462 RNAPHRAVNDCWFYNLNTNEWQK--GPELPEPRFRHSCVATDKNTLLVCG 509

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILM 266
           I+FGG+R  G+ +   +NDLW          K+E       + G+C      +AILM
Sbjct: 500 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVTRRGKKGYCKFSETANAILM 546

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 219 GNGQTSYLNDLWCFDISTYKWTKLETNSKPD---------ARSGHCFIPTDNSAILMGG 268
           G+  T   +D+W FD  T  W ++ET ++ +         A +GH      +++I +GG
Sbjct: 664 GSNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa]
           {ON} Anc_7.9 YAL056W
          Length = 856

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 40/89 (44%), Gaps = 17/89 (19%)

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKP 248
           G    P  ++G+     K+  +L GG     +       D+W F+I T  W+K++T++K 
Sbjct: 657 GHQQHPQKKNGY---GDKSVLVLHGG-----SNNNKVFGDMWWFNIETKIWSKIDTHAKT 708

Query: 249 DARS---------GHCFIPTDNSAILMGG 268
           +            GH  + T+  +I +GG
Sbjct: 709 EKDELIPIEMKLVGHTMVDTNFMSINIGG 737

>Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W
           (REAL)
          Length = 695

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 189 GRDSSPSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNS 246
           G    P AR  H + A       +L GG +    G    L+D W FD    +W+ +++  
Sbjct: 432 GSSELPVARMCHTLTALYGNEQLLLIGGRKAPHQG----LSDNWIFDTKKREWSMIQSLP 487

Query: 247 KPDARSGHCFIPTDNSAILMG 267
               R   C +  DN  IL G
Sbjct: 488 HTRFRHSACNLSDDNVLILGG 508

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
           {ON} weakly similar to uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1594

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 22/118 (18%)

Query: 171 DTWLFDCVERKFTKLE-------FGGRDSSP--SARSGHRIIAWKNYFILFGGFRDLGNG 221
           + +  D + R + +LE        G  D  P  S R  H I    +   +FGG   + + 
Sbjct: 99  EVFFLDLISRSWKRLETEMDTQYIGEHDEVPKLSERFFHSISFCSSCLYIFGGL--MVSP 156

Query: 222 QTSY----LNDLWCFDISTYKWTKLETNSKPDARSGHCF------IPT-DNSAILMGG 268
           Q  Y     N+LW  D++T KW+ +  + +   R  H        I T D   +++GG
Sbjct: 157 QNGYELIASNELWKLDLTTRKWSLISRDPQIARRFAHTMHTKNENIETRDTKLVIVGG 214

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 17/116 (14%)

Query: 170 SDTWLFDCVERKFTKLEFGGRDSSPS--------ARSGHRIIAWKNYFILFGGFRDLGNG 221
           S+T+  D + R + +LE    +SS +         R  H +   + +  +FGG     + 
Sbjct: 125 SETFFLDLISRSWRRLETTIDESSTTDDTNIKTNGRLFHAMCFNEGFLYIFGGLMISPHN 184

Query: 222 QTSYL--NDLWCFDISTYKWTKLETNSKPDARSGHCF------IPT-DNSAILMGG 268
           +  ++  NDLW  D+   KW+ L  +     R  H         PT D   +++GG
Sbjct: 185 EYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDPTKDTKLVIVGG 240

>Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 1511
           aa] {ON} complement(6278..9313,9316..10815) [4536 nt,
           1512 aa]
          Length = 1511

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 175 FDCVERKFTKLE-FGGRDSSPSA--RSGHRIIAWKNYFILFGGFRDLGNGQTSYL---ND 228
            D + RK++K++     D++  A  R  H I+   +   LFGG       +   L   ND
Sbjct: 146 LDLISRKWSKIDTIIPNDNTDFALSRLFHSIVYLDSAIYLFGGLILCPRAENYKLVPTND 205

Query: 229 LWCFDISTYKWTKLETNSK 247
           LW  D++T KW  L  N++
Sbjct: 206 LWKLDLTTKKWYCLSKNNQ 224

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 229 LWCFDISTYKWTKLET---NSKPD---ARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMK 282
           ++  D+ + KW+K++T   N   D   +R  H  +  D++  L GG        N  L+ 
Sbjct: 143 IFHLDLISRKWSKIDTIIPNDNTDFALSRLFHSIVYLDSAIYLFGGLILCPRAENYKLVP 202

Query: 283 GKILNDAWKLNLTPDPKKW 301
               ND WKL+LT   KKW
Sbjct: 203 T---NDLWKLDLT--TKKW 216

>TBLA0F00420 Chr6 complement(104477..109498) [5022 bp, 1673 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1673

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 26/154 (16%)

Query: 200 HRIIAWKNYFILFGGFRDLGNGQTSY----LNDLWCFDISTYKWTKLETNSKPDARSGHC 255
           H +    +   +FGG   + N  +SY     N LW  D+ T  WT L  +S+   R  H 
Sbjct: 149 HSLCYTNSSLYMFGGL--IVNPNSSYELTPTNTLWKLDLETKVWTLLSMDSRITERFAHS 206

Query: 256 FIPT-------DNSAILMGGYCKIIAKNNKNLMKGKILN---DAWKLNLTPDPKKWQWEK 305
                      D   I++GG    + K+++N+    I N   + W+++      K++ + 
Sbjct: 207 MHVKNENDEIRDTKLIIVGG----LNKDDENVNSIDIFNLSHNCWEVDFN---TKYRDKV 259

Query: 306 LKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVY 336
             N  NQ    SP   +S  + K   ++     Y
Sbjct: 260 KTNIDNQVVSLSPTANFSILVEKNEANIPAIAFY 293

>NDAI0B01905 Chr2 (457444..462267) [4824 bp, 1607 aa] {ON}
          Length = 1607

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 13/95 (13%)

Query: 171 DTWLFDCVERKFTKLEFGG-----RDSSP--SARSGHRIIAWKNYFILFGGFRDLGNGQT 223
           + +  D + R + ++E        R SS   S R  H I   +N   +FGG     + Q 
Sbjct: 98  EVFYLDLITRTWERIETNATTALARTSSSQFSERLFHSICVNENALYIFGGLA--ISPQN 155

Query: 224 SY----LNDLWCFDISTYKWTKLETNSKPDARSGH 254
            Y     N+LW  D+ T KWT L  + +   R  H
Sbjct: 156 DYELIATNELWKLDLYTRKWTLLSKDPRITRRFNH 190

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 207 NYFILFGGFRDLGNGQTSYLNDLWCFDI 234
           N  ++FGG++ +G+ +   +NDLW  DI
Sbjct: 496 NRILIFGGYKQVGDDEYEAMNDLWQVDI 523

>KAFR0C02890 Chr3 (570621..574976) [4356 bp, 1451 aa] {ON} Anc_8.157
           YGL197W
          Length = 1451

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 67/147 (45%), Gaps = 26/147 (17%)

Query: 197 RSGHRIIAWKNYFILFGGFRDLGNGQTSY----LNDLWCFDISTYKWTKLETNSKPDARS 252
           R  H +    +   +FGG   + +  ++Y     N+LW  D++T +W+ L  N K   R 
Sbjct: 141 RIYHSMCYSNSSLYIFGGL--VVSPTSAYELVPTNELWRLDLTTKEWSLLSKNPKIKGRF 198

Query: 253 GH-CFIPTDNSAI------LMGGYCKIIAKNNKNLMKGKILN---DAWKLNLTP-DPKKW 301
            H   +  +N  I      ++GG    +  +N+ + K  + N   + W+ +  P DP   
Sbjct: 199 NHRVHVKNENVNIRDTKLVIVGG----LDDSNRPIYKVDVYNLTQNCWQDDAVPTDP--- 251

Query: 302 QWEKLKNFKNQP-SPRVGYSFNLWKQN 327
             + + N  N+P S  +G +F++  +N
Sbjct: 252 -LDIVANIDNEPVSLTIGSNFSIMVEN 277

>KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON}
           weakly similar to uniprot|Q08886 Saccharomyces
           cerevisiae YOR371C GPB1 Proposed beta subunit of the
           heterotrimeric G protein that interacts with the
           receptor Grp1p has signaling role in response to
           nutrients involved in regulation of pseudohyphal growth
           through cAMP levels homolog of Gpb2p
          Length = 795

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 10/51 (19%)

Query: 228 DLWCFDISTYKWTKLETNSKPDAR----------SGHCFIPTDNSAILMGG 268
           D+WC+D+    WTKL   +K              +GH F+      +++GG
Sbjct: 630 DMWCYDLDEGTWTKLSLKAKDKETGELKIVEFPLTGHTFVHNKQITVVIGG 680

>NCAS0C04370 Chr3 (896632..898698) [2067 bp, 688 aa] {ON} Anc_3.15
           YOL141W
          Length = 688

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 226 LNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTD-NSAILMGGYCKIIAKNNKNLMKGK 284
           +ND+W  D  T +W   +  S P+ R  HC +    N  ++ GG   +   +    +K  
Sbjct: 463 INDVWRLDEKTLQWE--QKTSLPEGRFRHCSVSVSTNETLIFGGKSSVTLSSANKFLKYD 520

Query: 285 ILNDAW 290
           I  D +
Sbjct: 521 ISADTY 526

>NDAI0H02020 Chr8 complement(493786..496980) [3195 bp, 1064 aa] {ON}
           
          Length = 1064

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 8/52 (15%)

Query: 191 DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKL 242
           + +PS  SG+   +     I+ GG   +GN     LND+W FD+ T  WTK+
Sbjct: 857 EHTPSTYSGN---SRNRTIIIHGG--SIGN---KVLNDMWWFDLETCTWTKM 900

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,122,220
Number of extensions: 2965499
Number of successful extensions: 9472
Number of sequences better than 10.0: 89
Number of HSP's gapped: 9312
Number of HSP's successfully gapped: 178
Length of query: 651
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 535
Effective length of database: 40,180,143
Effective search space: 21496376505
Effective search space used: 21496376505
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)